GCF_023657025.1 - 9 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JAGSCE010000012.1 (Staphylococcus aureus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	RiPP-like	53,037	63,321

NZ_JAGSCE010000017.1 (Staphylococcus aureus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	cyclic-lactone-autoinducer	2,469	23,176

NZ_JAGSCE010000001.1 (Staphylococcus aureus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	terpene-precursor	157,865	178,746

NZ_JAGSCE010000020.1 (Staphylococcus aureus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	lanthipeptide-class-i	32,452	47,482	High	hyicin 3682	ribosomal:RiPP

NZ_JAGSCE010000003.1 (Staphylococcus aureus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 33.1	NI-siderophore	10,728	45,216	High	staphyloferrin B	other:other
Region 33.2	NRPS	69,257	116,432	High	aureusimine A/aureusimine B/aureusimine C	NRPS:Type I

NZ_JAGSCE010000004.1 (Staphylococcus aureus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 44.1	terpene,T3PKS,epipeptide	8,867	72,027
Region 44.2	opine-like-metallophore	110,266	132,378	High	staphylopine	other:other

NZ_JAGSCE010000008.1 (Staphylococcus aureus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 51.1	NI-siderophore	82,006	115,021	High	staphyloferrin A	other:non-nrp siderophore

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	RiPP-like	53,037	63,321
Region 8.1	cyclic-lactone-autoinducer	2,469	23,176
Region 11.1	terpene-precursor	157,865	178,746
Region 12.1	lanthipeptide-class-i	32,452	47,482	High	hyicin 3682	ribosomal:RiPP
Region 33.1	NI-siderophore	10,728	45,216	High	staphyloferrin B	other:other
Region 33.2	NRPS	69,257	116,432	High	aureusimine A/aureusimine B/aureusimine C	NRPS:Type I
Region 44.1	terpene,T3PKS,epipeptide	8,867	72,027
Region 44.2	opine-like-metallophore	110,266	132,378	High	staphylopine	other:other
Region 51.1	NI-siderophore	82,006	115,021	High	staphyloferrin A	other:non-nrp siderophore

No secondary metabolite regions were found in these records:: NZ_JAGSCE010000010.1 (Staphylococcus aureus); NZ_JAGSCE010000011.1 (Staphylococcus aureus); NZ_JAGSCE010000013.1 (Staphylococcus aureus); NZ_JAGSCE010000014.1 (Staphylococcus aureus); NZ_JAGSCE010000015.1 (Staphylococcus aureus); NZ_JAGSCE010000016.1 (Staphylococcus aureus); NZ_JAGSCE010000018.1 (Staphylococcus aureus); NZ_JAGSCE010000019.1 (Staphylococcus aureus); NZ_JAGSCE010000021.1 (Staphylococcus aureus); NZ_JAGSCE010000022.1 (Staphylococcus aureus); NZ_JAGSCE010000023.1 (Staphylococcus aureus); NZ_JAGSCE010000024.1 (Staphylococcus aureus); NZ_JAGSCE010000025.1 (Staphylococcus aureus); NZ_JAGSCE010000026.1 (Staphylococcus aureus); NZ_JAGSCE010000027.1 (Staphylococcus aureus); NZ_JAGSCE010000028.1 (Staphylococcus aureus); NZ_JAGSCE010000029.1 (Staphylococcus aureus); NZ_JAGSCE010000002.1 (Staphylococcus aureus); NZ_JAGSCE010000030.1 (Staphylococcus aureus); NZ_JAGSCE010000031.1 (Staphylococcus aureus); NZ_JAGSCE010000032.1 (Staphylococcus aureus); NZ_JAGSCE010000033.1 (Staphylococcus aureus); NZ_JAGSCE010000034.1 (Staphylococcus aureus); NZ_JAGSCE010000035.1 (Staphylococcus aureus); NZ_JAGSCE010000036.1 (Staphylococcus aureus); NZ_JAGSCE010000037.1 (Staphylococcus aureus); NZ_JAGSCE010000038.1 (Staphylococcus aureus); NZ_JAGSCE010000039.1 (Staphylococcus aureus); NZ_JAGSCE010000040.1 (Staphylococcus aureus); NZ_JAGSCE010000041.1 (Staphylococcus aureus); NZ_JAGSCE010000042.1 (Staphylococcus aureus); NZ_JAGSCE010000043.1 (Staphylococcus aureus); NZ_JAGSCE010000044.1 (Staphylococcus aureus); NZ_JAGSCE010000045.1 (Staphylococcus aureus); NZ_JAGSCE010000046.1 (Staphylococcus aureus); NZ_JAGSCE010000047.1 (Staphylococcus aureus); NZ_JAGSCE010000048.1 (Staphylococcus aureus); NZ_JAGSCE010000049.1 (Staphylococcus aureus); NZ_JAGSCE010000050.1 (Staphylococcus aureus); NZ_JAGSCE010000051.1 (Staphylococcus aureus); NZ_JAGSCE010000052.1 (Staphylococcus aureus); NZ_JAGSCE010000005.1 (Staphylococcus aureus); NZ_JAGSCE010000006.1 (Staphylococcus aureus); NZ_JAGSCE010000007.1 (Staphylococcus aureus); NZ_JAGSCE010000009.1 (Staphylococcus aureus)

Compact view

NZ_JAGSCE010000012.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 53,037 - 63,321 nt. (total: 10,285 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000626.3	0.36	ribosomal	thuricin	Bacillus thuringiensis
BGC0001229.4	0.36	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0002442.3	0.35	ribosomal	toyoncin	Bacillus toyonensis
BGC0002656.2	0.33	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002116.3	0.33	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0002447.3	0.31	ribosomal	cerecyclin	Bacillus cereus
BGC0002110.3	0.31	ribosomal	birimositide	Streptomyces rimosus subsp. rimosus WC-3908
BGC0000487.5	0.31	ribosomal	carnocyclin	Carnobacterium maltaromaticum
BGC0000488.4	0.29	ribosomal	circularin A	Clostridium beijerinckii
BGC0000323.5	0.28	NRPS	cichofactin A, cichofactin B	Pseudomonas cichorii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000626.3	0.36	ribosomal	thuricin	Bacillus thuringiensis
BGC0001229.4	0.36	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0002442.3	0.35	ribosomal	toyoncin	Bacillus toyonensis
BGC0002656.2	0.33	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002116.3	0.33	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0002447.3	0.31	ribosomal	cerecyclin	Bacillus cereus
BGC0002110.3	0.31	ribosomal	birimositide	Streptomyces rimosus subsp. rimosus WC-3908
BGC0000487.5	0.31	ribosomal	carnocyclin	Carnobacterium maltaromaticum
BGC0000488.4	0.29	ribosomal	circularin A	Clostridium beijerinckii
BGC0000323.5	0.28	NRPS	cichofactin A, cichofactin B	Pseudomonas cichorii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.83 out of 26.06

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.93 out of 26.33

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.71 out of 27.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 15.28 out of 18.16

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 26.38 out of 27.78

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 25.31

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.83 out of 27.78

Confidence: medium

Additional weak hits (3):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.81 out of 27.04

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.94 out of 36.54

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes

NZ_JAGSCE010000017.1 - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 2,469 - 23,176 nt. (total: 20,708 nt) Show pHMM detection rules used

Region on contig edge.

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: kinase

KC252_RS09570: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Lyases: hydratase

KC252_RS09605: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002667.2	0.42	ribosomal	estericin A	Clostridium estertheticum
BGC0001687.3	0.39	other (other)	N-tetradecanoyl tyrosine	uncultured bacterium CSL12
BGC0002579.2	0.39	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0000624.3	0.30	ribosomal	salivaricin CRL1328 α peptide, salivaricin CRL1328 β peptide	Lactobacillus salivarius
BGC0000207.5	0.30	PKS	chartreusin	Streptomyces chartreusis
BGC0001872.3	0.30	PKS	fabclavine-polyamine	Xenorhabdus bovienii SS-2004
BGC0001053.5	0.29	NRPS, PKS	tubulysin A	Archangium disciforme
BGC0001130.5	0.27	NRPS, PKS	fabclavine Ia, fabclavine Ib, fabclavine IIa, fabclavine IIb	Xenorhabdus budapestensis
BGC0001700.5	0.23	PKS	niphimycin C, niphimycin D, niphimycin E, 17-O-methylniphimycin, niphimycin Iα, 19-O-malonylniphimycin	Streptomyces sp. IMB7-145
BGC0000082.5	0.22	PKS	kijanimicin	Actinomadura kijaniata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002667.2	0.42	ribosomal	estericin A	Clostridium estertheticum
BGC0001687.3	0.39	other (other)	N-tetradecanoyl tyrosine	uncultured bacterium CSL12
BGC0002579.2	0.39	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0000624.3	0.30	ribosomal	salivaricin CRL1328 α peptide, salivaricin CRL1328 β peptide	Lactobacillus salivarius
BGC0000207.5	0.30	PKS	chartreusin	Streptomyces chartreusis
BGC0001872.3	0.30	PKS	fabclavine-polyamine	Xenorhabdus bovienii SS-2004
BGC0001053.5	0.29	NRPS, PKS	tubulysin A	Archangium disciforme
BGC0001130.5	0.27	NRPS, PKS	fabclavine Ia, fabclavine Ib, fabclavine IIa, fabclavine IIb	Xenorhabdus budapestensis
BGC0001700.5	0.23	PKS	niphimycin C, niphimycin D, niphimycin E, 17-O-methylniphimycin, niphimycin Iα, 19-O-malonylniphimycin	Streptomyces sp. IMB7-145
BGC0000082.5	0.22	PKS	kijanimicin	Actinomadura kijaniata

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.02 out of 21.84

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.53 out of 28.19

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.68 out of 27.04

Confidence: medium

Additional weak hits (2):

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 30.11

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
MexT	Global virulence regulator
ZuR variant 1	Zinc-responsive repressor

NZ_JAGSCE010000001.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 157,865 - 178,746 nt. (total: 20,882 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

KC252_RS00680: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: carboxylase

KC252_RS00720: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Hydrolases: peptidase

KC252_RS00735: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Ligases: synthase synthetase

KC252_RS00670: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

KC252_RS00695: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001534.3	0.54	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0001535.3	0.44	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000234.5	0.42	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001605.3	0.40	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000905.5	0.40	other (other)	heme D1	Heliobacillus mobilis
BGC0000906.3	0.40	other (other)	heme D1	Heliophilum fasciatum
BGC0001529.5	0.40	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001534.3	0.54	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0001535.3	0.44	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000234.5	0.42	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001605.3	0.40	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000905.5	0.40	other (other)	heme D1	Heliobacillus mobilis
BGC0000906.3	0.40	other (other)	heme D1	Heliophilum fasciatum
BGC0001529.5	0.40	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

KC252_RS00695: PT_FPPS_like

Domain 1 (30 - 293): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.78 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.41 out of 23.79

Confidence: medium

Additional weak hits (3):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.52 out of 33.73

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.06 out of 25.88

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.88 out of 31.73

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism

NZ_JAGSCE010000020.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 32,452 - 47,482 nt. (total: 15,031 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

KC252_RS10470: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase dehydratase

KC252_RS10480: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

KC252_RS10485: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001618.3	0.79	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0002576.2	0.74	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000508.3	0.62	ribosomal	epidermin	Staphylococcus epidermidis
BGC0000533.3	0.54	ribosomal	mutacin III	Streptococcus mutans
BGC0000530.5	0.53	ribosomal	mutacin B-Ny266	Streptococcus mutans N66
BGC0000514.5	0.53	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0000531.3	0.52	ribosomal	mutacin I	Streptococcus mutans
BGC0000537.3	0.49	ribosomal	nisin U	Streptococcus uberis
BGC0000541.5	0.49	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.49	ribosomal	paenicidin B	Paenibacillus terrae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001618.3	0.79	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0002576.2	0.74	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000508.3	0.62	ribosomal	epidermin	Staphylococcus epidermidis
BGC0000533.3	0.54	ribosomal	mutacin III	Streptococcus mutans
BGC0000530.5	0.53	ribosomal	mutacin B-Ny266	Streptococcus mutans N66
BGC0000514.5	0.53	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0000531.3	0.52	ribosomal	mutacin I	Streptococcus mutans
BGC0000537.3	0.49	ribosomal	nisin U	Streptococcus uberis
BGC0000541.5	0.49	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.49	ribosomal	paenicidin B	Paenibacillus terrae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for KC252_RS10485

KC252_RS10490

Leader:

MENVLDLDVQVKAKNDTSDSA

Core:

GDERITSFIGCTPGCGKTGSFNSFCC

Core with dehydrations:

GDERIDhbDhaFIGCysDhbPGCysGKDhbGDhaFNDhaFCysCys

antiSMASH-DB 4.0 matches for KC252_RS10490

100.0%

NC_007622.1and 12 others:

NC_017337.1 Lanthipeptides: SAOV_RS09475_lanthipeptideNZ_CP010941.1 Lanthipeptides: UC16_RS09555_lanthipeptideNZ_CP038268.1 Lanthipeptides: SaO55_RS09715_lanthipeptideNZ_CP042650.1 Lanthipeptides: FTD94_RS09865_lanthipeptideNZ_CP065857.1 Lanthipeptides: I1A60_RS09290_lanthipeptideNZ_CP094743.1 Lanthipeptides: MUA62_RS09290_lanthipeptideNZ_CP096114.1 Lanthipeptides: M0D62_RS09005_lanthipeptideNZ_CP102957.1 Lanthipeptides: NW959_RS08715_lanthipeptideNZ_GG730342.1 Lanthipeptides: SAUG_RS17375_lanthipeptideNZ_JAGSAD010000008.1 Lanthipeptides: KC182_RS10520_lanthipeptideNZ_JAGSCE010000020.1 Lanthipeptides: KC252_RS10490_lanthipeptideNZ_KZ984531.1 Lanthipeptides: AHP18_RS05855_lanthipeptide

Lanthipeptides: SAB_RS08990_lanthipeptide

1

GDERITSFIGCTPGCGKTGSFNSFCC

26

GDERITSFIGCTPGCGKTGSFNSFCC

1

GDERITSFIGCTPGCGKTGSFNSFCC

26

88.5%

NZ_CP102975.1:

Lanthipeptides: NW953_RS09010_lanthipeptide

4

RITSFIGCTPGCGKTGSFNSFCC

26

RITSFIGCTPGCGKTGSFNSFCC

1

RITSFIGCTPGCGKTGSFNSFCC

23

84.6%

NZ_LR134304.1:

Lanthipeptides: EL116_RS09245_lanthipeptide

4

RITSFIGCTPGCGKTGSFNSFCC

26

RITS IGCTPGCGKTGSFNSFCC

1

RITSVIGCTPGCGKTGSFNSFCC

23

with 91 more sequence matches

Only the first 10 are displayed here.

76.9%

NZ_CP023076.1:

Lanthipeptides: CJ017_RS08945_lanthipeptide

3

ERITSFIGCTPGCGKTGSFNSFCC

26

ERITS CTPGC KTGSFNSFCC

1

ERITSHSLCTPGCAKTGSFNSFCC

24

76.9%

NZ_VKCY01000012.1:

Lanthipeptides: FNK43_RS09020_lanthipeptide

3

ERITSFIGCTPGCGKTGSFNSFCC

26

ERITSF CTPGC KTGSFNS+CC

1

ERITSFSLCTPGCAKTGSFNSYCC

24

73.1%

NC_003923.1and 8 others:

NC_009641.1 Lanthipeptides: NWMN_RS09635_lanthipeptideNZ_CP054876.1 Lanthipeptides: HUW54_RS09150_lanthipeptideNZ_CP077098.1 Lanthipeptides: KSF82_RS09475_lanthipeptideNZ_CP092781.1 Lanthipeptides: ML436_RS08940_lanthipeptideNZ_CP102959.1 Lanthipeptides: NW979_RS08780_lanthipeptideNZ_CP102962.1 Lanthipeptides: NW971_RS09555_lanthipeptideNZ_LR133917.1 Lanthipeptides: ELZ45_RS09155_lanthipeptideNZ_LS483317.1 Lanthipeptides: DQL75_RS09700_lanthipeptide

Lanthipeptides: MW_RS09420_lanthipeptide

4

RITSFIGCTPGCGKTGSFNSFCC

26

RITS CTPGC KTGSFNSFCC

1

RITSHSLCTPGCAKTGSFNSFCC

23

69.2%

NC_007622.1and 1 other:

NZ_LR133917.1 Lanthipeptides: ELZ45_RS09165_lanthipeptide

Lanthipeptides: SAB_RS08995_lanthipeptide

4

RITSFIGCTPGCGKTGSFNSFCC

26

RITS C+ GCGKTGSFNSFCC

1

RITSHFLCSFGCGKTGSFNSFCC

23

69.2%

NC_022873.1and 92 others:

NZ_CM000742.1 Lanthipeptides: BMYCO0001_RS26515_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18180_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18175_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18170_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18165_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19775_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19770_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19765_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18710_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18705_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18700_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21370_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21365_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21360_lanthipeptideNZ_CP035965.1 Lanthipeptides: EXW35_RS16385_lanthipeptideNZ_CP035965.1 Lanthipeptides: EXW35_RS16380_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16155_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16150_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16145_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16140_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26195_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26190_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26185_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26180_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16265_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16260_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16255_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16250_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16620_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16615_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16610_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16605_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16110_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16105_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16100_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16095_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14125_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14120_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14115_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18355_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18350_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18345_lanthipeptideNZ_CP047366.1 Lanthipeptides: GSN03_RS15835_lanthipeptideNZ_CP047366.1 Lanthipeptides: GSN03_RS15830_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16415_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16410_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16405_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15130_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15125_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15120_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15990_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15985_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15980_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15975_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25975_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25970_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25965_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25960_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15810_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15805_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15800_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15795_lanthipeptideNZ_JAIPUK010000008.1 Lanthipeptides: K9P71_RS24265_lanthipeptideNZ_JAIPUK010000008.1 Lanthipeptides: K9P71_RS24260_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06155_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06150_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06145_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06140_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21535_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21530_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21525_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11095_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11090_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11085_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11080_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11075_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18900_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18895_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18890_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18885_lanthipeptideNZ_LDHL01000037.1 Lanthipeptides: ABD98_RS26430_lanthipeptideNZ_LDHL01000037.1 Lanthipeptides: ABD98_RS26425_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27280_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27275_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27270_lanthipeptideNZ_MSTN01000016.1 Lanthipeptides: BVF97_RS28620_lanthipeptideNZ_NIUP01000011.1 Lanthipeptides: CEU84_RS08145_lanthipeptideNZ_NIUP01000011.1 Lanthipeptides: CEU84_RS08140_lanthipeptideNZ_NKAX01000026.1 Lanthipeptides: CE086_RS26165_lanthipeptideNZ_NKAX01000026.1 Lanthipeptides: CE086_RS26160_lanthipeptideNZ_NVGU01000011.1 Lanthipeptides: COL71_RS14760_lanthipeptideNZ_NVGU01000011.1 Lanthipeptides: COL71_RS14755_lanthipeptide

Lanthipeptides: YBT1518_RS19670_lanthipeptide

5

ITSFIGCTPGCGKTGSFNSFCC

26

ITS CTPGCG TGSFNSFCC

1

ITSISACTPGCGNTGSFNSFCC

22

69.2%

NZ_CP047792.1and 1 other:

NZ_JAGSAY010000004.1 Lanthipeptides: KC186_RS06745_lanthipeptide

Lanthipeptides: E3S88_RS07345_lanthipeptide

4

RITSFIGCTPGCGKTGSFNSFCC

26

RITS CTPGC TGSFNSFCC

1

RITSHSLCTPGCANTGSFNSFCC

23

69.2%

NZ_CP102962.1and 1 other:

NZ_LS483317.1 Lanthipeptides: DQL75_RS09705_lanthipeptide

Lanthipeptides: NW971_RS09560_lanthipeptide

4

RITSFIGCTPGCGKTGSFNSFCC

26

RITS + C+ GCGKTGSFNSFCC

1

RITSHLLCSFGCGKTGSFNSFCC

23

65.4%

NC_003923.1and 5 others:

NC_009641.1 Lanthipeptides: NWMN_RS09640_lanthipeptideNZ_CP054876.1 Lanthipeptides: HUW54_RS09155_lanthipeptideNZ_CP077098.1 Lanthipeptides: KSF82_RS09480_lanthipeptideNZ_CP102959.1 Lanthipeptides: NW979_RS08785_lanthipeptideNZ_CP102975.1 Lanthipeptides: NW953_RS09015_lanthipeptide

Lanthipeptides: MW_RS09425_lanthipeptide

4

RITSFIGCTPGCGKTGSFNSFCC

26

RITS + C+ GC KTGSFNSFCC

1

RITSHLFCSFGCEKTGSFNSFCC

23

65.4%

NC_006582.1and 6 others:

NZ_BOQQ01000001.1 Lanthipeptides: KI354_RS00530_lanthipeptideNZ_BOQS01000001.1 Lanthipeptides: KI364_RS00675_lanthipeptideNZ_CP019985.1 Lanthipeptides: BC8716_RS09795_lanthipeptideNZ_CP104963.1 Lanthipeptides: N7M99_RS07725_lanthipeptideNZ_FRBS01000002.1 Lanthipeptides: BUC05_RS08990_lanthipeptideNZ_JAODPB010000001.1 Lanthipeptides: N6H06_RS03040_lanthipeptide

Lanthipeptides: ABC_RS22115_lanthipeptide

5

ITSFIGCTPGCGKTGSFNSFCC

26

TS CTPGCG+TGSFNSFCC

1

FTSVSFCTPGCGETGSFNSFCC

22

65.4%

NC_014023.1and 36 others:

NC_014023.1 Lanthipeptides: BMQ_RS27575_lanthipeptideNZ_CP018875.1 Lanthipeptides: BUW91_RS26425_lanthipeptideNZ_CP018875.1 Lanthipeptides: BUW91_RS26420_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28075_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28070_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28065_lanthipeptideNZ_CP031776.1 Lanthipeptides: D0441_RS30140_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01185_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01180_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01175_lanthipeptideNZ_CP048884.1 Lanthipeptides: BMG_RS27510_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26980_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26975_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26970_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26985_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26980_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26975_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27820_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27815_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27810_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25635_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25630_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25625_lanthipeptideNZ_JAHHYI010000015.1 Lanthipeptides: KM925_RS26245_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28075_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28070_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28065_lanthipeptideNZ_NKAQ01000005.1 Lanthipeptides: CE057_RS19640_lanthipeptideNZ_NKAQ01000005.1 Lanthipeptides: CE057_RS19635_lanthipeptideNZ_NTZG01000054.1 Lanthipeptides: CN510_RS18265_lanthipeptideNZ_NUIN01000020.1 Lanthipeptides: CN973_RS26930_lanthipeptideNZ_NUOI01000090.1 Lanthipeptides: COE08_RS30285_lanthipeptideNZ_NUOI01000090.1 Lanthipeptides: COE08_RS30280_lanthipeptideNZ_NUOQ01000009.1 Lanthipeptides: COE31_RS05925_lanthipeptideNZ_NUXL01000007.1 Lanthipeptides: COJ36_RS20885_lanthipeptideNZ_NUZS01000089.1 Lanthipeptides: COJ90_RS28785_lanthipeptide

Lanthipeptides: BMQ_RS27580_lanthipeptide

5

ITSFIGCTPGCGKTGSFNSFCC

26

ITS CTPGCG TGS+NSFCC

1

ITSVSLCTPGCGDTGSWNSFCC

22

MIBiG 4.0 matches for KC252_RS10490

32.4%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

5

ITSFIGCTPGCGKTGSF

21

ITS CTPGC KTG+

1

ITSISLCTPGC-KTGAL

16

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.53 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.09 out of 20.97

Confidence: medium

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

KC252_RS10490 - Class I

Cleavage pHMM score: 3.70

RODEO score: 31

Monoisotopic mass: 2532.1 Da

Molecular weight: 2533.9 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2551.9 Da N = 1; 2569.9 Da N = 2

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 144 - 237; Score: 45.8

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_JAGSCE010000003.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 10,728 - 45,216 nt. (total: 34,489 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KC252_RS02145: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase

KC252_RS02160: sugar transferase

smcogs: SMCOG1146: sugar transferase

KC252_RS02165: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: deaminase

KC252_RS02095: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: decarboxylase dehydratase

KC252_RS02125: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

KC252_RS02155: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

KC252_RS02090: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000943.5	0.97	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0000946.5	0.59	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0000942.4	0.56	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002471.3	0.56	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0002073.3	0.53	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002692.2	0.53	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000939.5	0.51	other (other)	aerobactin	Grimontia hollisae
BGC0000947.5	0.50	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001531.5	0.49	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000868.5	0.49	other (other)	teichuronic acid	Bacillus subtilis subsp. subtilis str. 168

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000943.5	0.97	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0000946.5	0.59	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0000942.4	0.56	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002471.3	0.56	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0002073.3	0.53	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002692.2	0.53	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000939.5	0.51	other (other)	aerobactin	Grimontia hollisae
BGC0000947.5	0.50	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001531.5	0.49	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000868.5	0.49	other (other)	teichuronic acid	Bacillus subtilis subsp. subtilis str. 168

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 25.47 out of 26.06

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 28.84 out of 29.38

Confidence: strong

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.09 out of 21.55

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.78 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.17 out of 29.38

Confidence: medium

Additional weak hits (5):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.25 out of 30.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.93 out of 32.74

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.51 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.45 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
FuR variant 1	Ferric Uptake Regulator
MogR	Repressor of flagellar motility genes

NZ_JAGSCE010000003.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 69,257 - 116,432 nt. (total: 47,176 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase phosphate reductase

KC252_RS02325: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

KC252_RS02345: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

KC252_RS02415: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

KC252_RS02435: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: PPTase acetyltransferase aminotransferase glycosyltransferase kinase phosphotransferase

KC252_RS02300: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

KC252_RS02315: sugar transferase

smcogs: SMCOG1146: sugar transferase

KC252_RS02395: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

KC252_RS02405: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

KC252_RS02420: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

KC252_RS02445: Glucose-specific phosphotransferase enzyme IIA

smcogs: SMCOG1145: Glucose-specific phosphotransferase enzyme IIA

Hydrolases: hydrolase

KC252_RS02430: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: dehydratase

KC252_RS02320: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

KC252_RS02390: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000308.5	0.92	NRPS	aureusimine A, aureusimine B, aureusimine C	Staphylococcus aureus subsp. aureus str. JKD6008
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000308.5	0.92	NRPS	aureusimine A, aureusimine B, aureusimine C	Staphylococcus aureus subsp. aureus str. JKD6008
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.63 out of 27.55

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 25.18 out of 27.78

Confidence: strong

Additional weak hits (11):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.56 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 26.07 out of 32.74

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.50 out of 30.98

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.38 out of 29.25

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.01 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.55 out of 30.11

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.52 out of 33.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.42 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.38 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.77 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.49 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 69256 - 116432:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - Tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KC252_RS02390: Val - Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (417..807): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LQNGFDAATFEGWLLIGGEINGYGPTENTTFTTT
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1442..1834): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAWAFDASVMECSIITGGAFNAYGPSESTVITSY
Nearest Stachelhaus code(s):: Tyr DAMSIGAVIK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes

NZ_JAGSCE010000004.1 - Region 1 - T3PKS,epipeptide,terpene

Download region GenBank file

Download region SVG

Location: 8,867 - 72,027 nt. (total: 63,161 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
epipeptide: (TIGR04078 and yydH)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase reductase

KC252_RS02780: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

KC252_RS02795: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

KC252_RS02805: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

KC252_RS02830: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

KC252_RS02880: hydroxymethylglutaryl-CoA reductase

smcogs: SMCOG1187: hydroxymethylglutaryl-CoA reductase

KC252_RS02910: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

KC252_RS03005: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

KC252_RS03010: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

Transferases: acetyltransferase acyltransferase aminotransferase phosphotransferase

KC252_RS02765: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

KC252_RS02800: aminotransferase

smcogs: SMCOG1019: aminotransferase

KC252_RS02825: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

KC252_RS02915: Glucose-specific phosphotransferase enzyme IIA

smcogs: SMCOG1145: Glucose-specific phosphotransferase enzyme IIA

Hydrolases: hydrolase

KC252_RS02930: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

KC252_RS03000: hydrolase

smcogs: SMCOG1179: hydrolase

Ligases: synthase

KC252_RS02875: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

Translocases: transport

KC252_RS02845: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000647.3	0.38	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000645.3	0.32	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0001636.4	0.30	NRPS	KK-1	Curvularia clavata
BGC0000656.5	0.27	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0001184.4	0.26	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001510.5	0.22	other (other)	anisomycin	Streptomyces hygrospinosus
BGC0000646.5	0.22	terpene	β-carotein	uncultured bacterium
BGC0000259.3	0.22	PKS	prodigiosin	Serratia marcescens
BGC0001412.3	0.22	saccharide	polysaccharide C	Bacteroides fragilis
BGC0000641.3	0.21	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000645.3	0.52	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000648.3	0.49	terpene	carotenoid	Myxococcus xanthus
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000646.5	0.46	terpene	β-carotein	uncultured bacterium
BGC0002561.3	0.45	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0000641.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none

Genes with terpene domains:

KC252_RS02790: PT_phytoene_like

Domain 1 (7 - 286): Prenyltransferase; Phytoene synthase like

Subtype: Diapophytoene synthase

Reactions:: FPP → diapophytoene

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.67 out of 26.85

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.06 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.23 out of 26.06

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.61 out of 29.38

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.07 out of 27.78

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 15.94 out of 18.46

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.34 out of 30.25

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.24 out of 30.25

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.86 out of 29.38

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 20.97 out of 20.97

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.94 out of 21.55

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.02 out of 21.55

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.02 out of 21.55

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.40 out of 21.55

Confidence: medium

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 22.40

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.42 out of 28.19

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.51 out of 32.93

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.78 out of 32.93

Confidence: medium

Additional weak hits (13):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 19.34 out of 29.51

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 25.85 out of 31.73

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.00 out of 30.98

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.42 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 25.23 out of 32.38

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.40 out of 20.01

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 18.55 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 18.87 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.50 out of 30.11

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.33 out of 35.63

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.38 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 25.10 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
FuR variant 1	Ferric Uptake Regulator
HypR	L-hydroxyproline utilization repressor
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence
RutR	Regulator of the pyrimidine and purine metabolism
ZuR variant 1	Zinc-responsive repressor

NZ_JAGSCE010000004.1 - Region 2 - opine-like-metallophore

Download region GenBank file

Download region SVG

Location: 110,266 - 132,378 nt. (total: 22,113 nt) Show pHMM detection rules used

opine-like-metallophore: (CntL and CntM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KC252_RS03275: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002487.3	0.96	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0002488.3	0.79	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002490.2	0.59	other (other)	yersinopine	Yersinia pestis CO92
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002489.2	0.52	other (other)	pseudopaline	Pseudomonas aeruginosa PAO1
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.48	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001184.4	0.44	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0000519.4	0.40	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002487.3	0.96	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0002488.3	0.79	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002490.2	0.59	other (other)	yersinopine	Yersinia pestis CO92
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002489.2	0.52	other (other)	pseudopaline	Pseudomonas aeruginosa PAO1
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.48	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001184.4	0.44	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0000519.4	0.40	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.19 out of 19.26

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.80 out of 18.16

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.03 out of 26.06

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 25.67 out of 27.78

Confidence: strong

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 27.24 out of 32.74

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.99 out of 32.93

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 15.26 out of 18.16

Confidence: strong

Additional weak hits (4):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 26.47 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.06 out of 29.38

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.65 out of 20.01

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 2	Ferric Uptake Regulator
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes

NZ_JAGSCE010000008.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 82,006 - 115,021 nt. (total: 33,016 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KC252_RS06200: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

KC252_RS06205: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: kinase

KC252_RS06170: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000944.5	0.96	other (non-nrp siderophore)	staphyloferrin A	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002682.2	0.56	other (other)	aerobactin	Vibrio mimicus
BGC0000939.5	0.56	other (other)	aerobactin	Grimontia hollisae
BGC0000947.5	0.54	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002073.3	0.53	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001870.3	0.50	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0000943.5	0.50	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002683.2	0.46	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002471.3	0.44	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0001948.3	0.43	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000944.5	0.96	other (non-nrp siderophore)	staphyloferrin A	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002682.2	0.56	other (other)	aerobactin	Vibrio mimicus
BGC0000939.5	0.56	other (other)	aerobactin	Grimontia hollisae
BGC0000947.5	0.54	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002073.3	0.53	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001870.3	0.50	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0000943.5	0.50	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002683.2	0.46	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002471.3	0.44	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0001948.3	0.43	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.68 out of 29.38

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.22 out of 20.97

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.34 out of 20.97

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.07 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.42 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.42 out of 29.38

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.29 out of 24.78

Confidence: medium

Additional weak hits (2):

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 18.58 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 30.11

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
FuR variant 1	Ferric Uptake Regulator
LexA variant 2	Repressor of DNA damage response