GCF_928722305.1 - 45 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CAKMXI010000001.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NI-siderophore	276,297	306,081	High	desferrioxamin B/desferrioxamine E	other:other
Region 1.2	lanthipeptide-class-iii,lanthipeptide-class-ii	351,634	382,817

NZ_CAKMXI010000002.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	RiPP-like	44,627	54,830
Region 2.2	lanthipeptide-class-i	115,788	141,053
Region 2.3	azole-containing-RiPP	466,816	497,811	High	berninamycin K/berninamycin J/berninamycin A/berninamycin B	ribosomal:RiPP

NZ_CAKMXI010000003.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	butyrolactone	403,388	414,314

NZ_CAKMXI010000004.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	terpene-precursor	111,745	132,788
Region 4.2	terpene	609,763	630,836

NZ_CAKMXI010000005.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	terpene	87,908	108,960	Low	steffimycin D	PKS:Type II+saccharide:hybrid/tailoring
Region 5.2	NRPS-like	396,004	437,854

NZ_CAKMXI010000006.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	betalactone,butyrolactone	443,096	475,834
Region 6.2	ectoine	499,707	505,423	Medium	ectoine	other:other

NZ_CAKMXI010000007.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	T1PKS,lanthipeptide-class-i	1	22,979
Region 7.2	terpene-precursor	24,026	45,177
Region 7.3	T3PKS	85,577	126,635
Region 7.4	melanin	199,736	210,209	High	melanin	other:other
Region 7.5	T2PKS,terpene	247,795	320,313	High	spore pigment	PKS
Region 7.6	NRPS	385,895	411,765

NZ_CAKMXI010000009.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	NRP-metallophore,NRPS	4,422	62,903	High	coelichelin	NRPS:Type I

NZ_CAKMXI010000010.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	NRPS	200,836	250,819	Medium	mirubactin	NRPS:Type I
Region 10.2	terpene	254,231	282,433	High	isorenieratene	terpene

NZ_CAKMXI010000011.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	RiPP-like	1,946	13,238	Low	14-hydroxyisochainin	PKS:Modular type I
Region 11.2	NRPS,T1PKS	227,711	291,987	Low	desulfoclethramycin/clethramycin	other:other

NZ_CAKMXI010000012.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	NRPS	17,756	79,861	Low	depsibosamycin B/depsibosamycin C/depsibosamycin D	NRPS:Type I
Region 12.2	melanin	149,593	159,943	Medium	grixazone A	terpene
Region 12.3	oligosaccharide	243,028	274,376	Low	auroramycin	PKS

NZ_CAKMXI010000013.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	terpene	103,867	130,458	Medium	hopene	terpene
Region 13.2	NRP-metallophore,NRPS	211,093	274,219	High	coelibactin	NRPS:Type I

NZ_CAKMXI010000015.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	RiPP-like	42,062	53,441	Medium	streptamidine	ribosomal:unmodified
Region 15.2	terpene-precursor,PKS-like	53,950	103,322	Low	rustmicin	PKS:Iterative type I
Region 15.3	NRPS	174,553	209,944

NZ_CAKMXI010000016.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	T1PKS,terpene	1	33,247	Low	mycinamicin II	PKS
Region 16.2	RiPP-like	112,089	122,316
Region 16.3	hglE-KS,T1PKS	129,932	183,608
Region 16.4	ectoine	186,921	192,723	Medium	ectoine	other:other

NZ_CAKMXI010000018.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	T1PKS	1	62,117	Low	auroramycin	PKS
Region 18.2	NI-siderophore	87,723	120,313	Low	kinamycin	PKS

NZ_CAKMXI010000024.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	T1PKS	7,086	38,381	Low	Neoabyssomicin B/Abyssomicin 2/Abyssomicin 4	PKS

NZ_CAKMXI010000025.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 25.1	NRPS,terpene	1	28,724

NZ_CAKMXI010000028.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 28.1	NRPS	1	19,977

NZ_CAKMXI010000029.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 29.1	T1PKS	1	20,207

NZ_CAKMXI010000030.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 30.1	NRPS	1	16,349

NZ_CAKMXI010000032.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 32.1	T1PKS	1	10,243

NZ_CAKMXI010000033.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 33.1	T1PKS	1	6,326	High	halstoctacosanolide A	PKS

NZ_CAKMXI010000036.1 (Streptomyces atroolivaceus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 36.1	T1PKS	1	4,348

No secondary metabolite regions were found in these records:: NZ_CAKMXI010000008.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000014.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000017.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000019.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000020.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000021.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000022.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000023.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000026.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000027.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000031.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000034.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000035.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000037.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000038.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000039.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000040.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000041.1 (Streptomyces atroolivaceus); NZ_CAKMXI010000042.1 (Streptomyces atroolivaceus)

Compact view

NZ_CAKMXI010000001.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 276,297 - 306,081 nt. (total: 29,785 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

NBY68_RS01315: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

NBY68_RS01345: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: carboxylase

NBY68_RS01355: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Hydrolases: protease

NBY68_RS01270: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: decarboxylase

NBY68_RS01320: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase

NBY68_RS01350: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.82	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000940.5	0.81	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.80	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002305.2	0.80	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.64	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.57	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002073.3	0.56	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.82	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000940.5	0.81	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.80	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002305.2	0.80	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.64	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.57	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002073.3	0.56	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.03 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.94 out of 36.53

Confidence: medium

Additional weak hits (4):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.26 out of 30.22

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.62 out of 23.43

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.33 out of 27.18

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.54 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_CAKMXI010000001.1 - Region 2 - lanthipeptide-class-ii,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 351,634 - 382,817 nt. (total: 31,184 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

NBY68_RS01635: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: methyltransferase

NBY68_RS01670: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: protease

NBY68_RS01570: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

NBY68_RS01625: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.36	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000504.5	0.32	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000496.5	0.32	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.32	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000518.3	0.31	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000519.4	0.31	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.30	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000517.4	0.29	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000527.5	0.27	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000553.3	0.27	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000504.5	0.48	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000496.5	0.47	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.46	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000518.3	0.46	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000519.4	0.46	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.45	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001407.5	0.45	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000517.4	0.44	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0001387.5	0.44	other (other)	nucleocidin	Streptomyces calvus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for NBY68_RS01625

allorf_380873_381025

Leader:

MTAGLRPARRSPLEFA

Core:

VTGGLGRVRPRGTRTTPERAPGARRRSRCCRCVC

Core with dehydrations:

VDhbGGLGRVRPRGDhbRDhbDhbPERAPGARRRDhaRCysCysRCysVCys

antiSMASH-DB 4.0 matches for allorf_380873_381025

100.0%

NZ_CAKMXI010000001.1:

Lanthipeptides: allorf_380873_381025_lanthipeptide

1

VTGGLGRVRPRGTRTTPERAPGARRRSRCCRCVC

34

VTGGLGRVRPRGTRTTPERAPGARRRSRCCRCVC

1

VTGGLGRVRPRGTRTTPERAPGARRRSRCCRCVC

34

25.0%

NZ_CP020570.1and 15 others:

NZ_CP020570.1 Lanthipeptides: allorf_2516141_2516284_lanthipeptideNZ_CP020570.1 Lanthipeptides: allorf_2516141_2516284_lanthipeptideNZ_CP070242.1 Lanthipeptides: allorf_2528027_2528170_lanthipeptideNZ_CP070242.1 Lanthipeptides: allorf_2528027_2528170_lanthipeptideNZ_CP070242.1 Lanthipeptides: allorf_2528027_2528170_lanthipeptideNZ_CP070260.1 Lanthipeptides: allorf_5476524_5476667_lanthipeptideNZ_CP070260.1 Lanthipeptides: allorf_5476524_5476667_lanthipeptideNZ_CP070260.1 Lanthipeptides: allorf_5476524_5476667_lanthipeptideNZ_CP070260.1 Lanthipeptides: allorf_5476524_5476667_lanthipeptideNZ_JAJDST010000044.1 Lanthipeptides: allorf_029750_029893_lanthipeptideNZ_JAJDST010000044.1 Lanthipeptides: allorf_029750_029893_lanthipeptideNZ_JAJDST010000044.1 Lanthipeptides: allorf_029750_029893_lanthipeptideNZ_WWGL01000034.1 Lanthipeptides: allorf_1026403_1026546_lanthipeptideNZ_WWGL01000034.1 Lanthipeptides: allorf_1026403_1026546_lanthipeptideNZ_WWGL01000034.1 Lanthipeptides: allorf_1026403_1026546_lanthipeptide

Lanthipeptides: allorf_2516141_2516284_lanthipeptide

3

GGLGRVRPRGTRTTP

17

GG GRVR R R P

5

GGFGRVRGRKMRVAP

19

25.0%

NZ_CP058556.1and 4 others:

NZ_CP058556.1 Lanthipeptides: allorf_5603706_5603849_lanthipeptideNZ_CP058556.1 Lanthipeptides: allorf_5603706_5603849_lanthipeptideNZ_CP058556.1 Lanthipeptides: allorf_5603706_5603849_lanthipeptideNZ_CP059898.1 Lanthipeptides: allorf_2457020_2457163_lanthipeptide

Lanthipeptides: allorf_5603706_5603849_lanthipeptide

3

GGLGRVRPRGTRTTP

17

GG GRVR R R P

5

GGFGRVRGRKMRAAP

19

with 2 more sequence matches

17.6%

NZ_AP023360.1:

Lanthipeptides: CS0771_RS32205_lanthipeptide

25

RRSRCCRCVC

34

S CC CVC

6

HTSMCCHCVC

15

16.3%

NZ_CP049945.1:

Lanthipeptides: allorf_6834514_6834684_lanthipeptide

15

TTPERAPGARRRSRCCR

31

+P R+PG +R ++ CR

5

ASPVRSPGPQRPAKVCR

21

MIBiG 4.0 matches for allorf_380873_381025

8.8%

BGC0002322.3 (CEJ66604.1):

Lasso peptide: citrocin

3

GGLGRV

8

GG+G++

1

GGVGKI

6

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (6):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.16 out of 31.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.34 out of 27.18

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.80 out of 24.78

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_380873_381025 - Class II

Cleavage pHMM score: -6.20

RODEO score: 0

Monoisotopic mass: 3650.0 Da

Molecular weight: 3652.3 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3670.3 Da N = 1

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_CAKMXI010000002.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 44,627 - 54,830 nt. (total: 10,204 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

NBY68_RS04090: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002805.2	0.27	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0001430.4	0.26	NRPS, PKS	myxochromide S	Stigmatella aurantiaca Sg a15
BGC0002078.2	0.20	NRPS	omnipeptin	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002805.2	0.27	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0001430.4	0.26	NRPS, PKS	myxochromide S	Stigmatella aurantiaca Sg a15
BGC0002078.2	0.20	NRPS	omnipeptin	uncultured bacterium

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.76 out of 30.25

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.97 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CAKMXI010000002.1 - Region 2 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 115,788 - 141,053 nt. (total: 25,266 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

NBY68_RS04460: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

NBY68_RS04465: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001727.3	0.40	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000514.5	0.40	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0002120.3	0.38	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000529.5	0.36	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000711.5	0.33	saccharide	neomycin	Streptomyces fradiae
BGC0000713.5	0.33	saccharide	ribostamycin	Streptomyces ribosidificus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001727.3	0.40	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000514.5	0.40	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0002120.3	0.38	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000529.5	0.36	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000711.5	0.33	saccharide	neomycin	Streptomyces fradiae
BGC0000713.5	0.33	saccharide	ribostamycin	Streptomyces ribosidificus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

Additional weak hits (3):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.34 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.27 out of 33.14

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 23.72 out of 30.12

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 156 - 248; Score: 57.3

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
OsdR	Development and stress management regulator

NZ_CAKMXI010000002.1 - Region 3 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 466,816 - 497,811 nt. (total: 30,996 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

NBY68_RS06175: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: back translocase

NBY68_RS06220: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

NBY68_RS06225: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Lyases: dehydratase

NBY68_RS06185: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002363.3	0.92	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0001472.5	0.92	ribosomal	berninamycin A	Streptomyces bernensis
BGC0002311.3	0.71	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001986.3	0.48	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0002127.3	0.48	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001174.4	0.47	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0001146.5	0.47	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001640.3	0.47	ribosomal	kocurin	Kocuria rosea
BGC0000606.5	0.46	ribosomal	lactazole	Streptomyces lactacystinaeus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002363.3	0.92	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0001472.5	0.92	ribosomal	berninamycin A	Streptomyces bernensis
BGC0002311.3	0.71	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001986.3	0.48	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0002127.3	0.48	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001174.4	0.47	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0001146.5	0.47	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001640.3	0.47	ribosomal	kocurin	Kocuria rosea
BGC0000606.5	0.46	ribosomal	lactazole	Streptomyces lactacystinaeus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (14):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.36 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.91 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.98 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.37 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.64 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.41 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.24 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.56 out of 36.53

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 21 - 103; Score: 38.9

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

Core peptide predictions

No core peptides found.

NZ_CAKMXI010000003.1 - Region 1 - butyrolactone

Download region GenBank file

Download region SVG

Location: 403,388 - 414,314 nt. (total: 10,927 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

NBY68_RS09520: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

NBY68_RS09525: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

NBY68_RS09565: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000849.4	0.59	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0001924.3	0.42	terpene	ascofuranone	Acremonium egyptiacum
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000667.3	0.41	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0000507.5	0.39	ribosomal	epicidin	Staphylococcus epidermidis
BGC0002578.2	0.38	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000849.4	0.59	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0001924.3	0.42	terpene	ascofuranone	Acremonium egyptiacum
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000667.3	0.41	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0000507.5	0.39	ribosomal	epicidin	Staphylococcus epidermidis
BGC0002578.2	0.38	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.54 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.57 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.11 out of 26.85

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.37 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.86 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.99 out of 27.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CAKMXI010000004.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 111,745 - 132,788 nt. (total: 21,044 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

NBY68_RS11370: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: dehydratase

NBY68_RS11340: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

NBY68_RS11325: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000918.3	0.40	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.36	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000649.3	0.35	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000918.3	0.40	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.36	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000649.3	0.35	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

NBY68_RS11325: PT_FPPS_like

Domain 1 (59 - 340): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.34 out of 39.62

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.85 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.31 out of 26.85

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_CAKMXI010000004.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 609,763 - 630,836 nt. (total: 21,074 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

NBY68_RS13535: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

NBY68_RS13550: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

NBY68_RS13565: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000622.5	0.50	ribosomal	megacin	Bacillus megaterium
BGC0002629.2	0.40	ribosomal	limnothamide	Limnothrix sp. CACIAM 69d
BGC0001167.4	0.39	ribosomal	piricyclamide 7005E1, piricyclamide 7005E2, piricyclamide 7005E3, piricyclamide 7005E4	Microcystis aeruginosa PCC 7005
BGC0000597.4	0.35	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000508.3	0.34	ribosomal	epidermin	Staphylococcus epidermidis
BGC0000480.5	0.33	ribosomal	tenuecyclamide A, tenuecyclamide C	Nostoc spongiaeforme var. tenue str. Carmeli
BGC0000595.3	0.33	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000531.3	0.32	ribosomal	mutacin I	Streptococcus mutans
BGC0000514.5	0.32	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0002663.2	0.32	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000622.5	0.50	ribosomal	megacin	Bacillus megaterium
BGC0002629.2	0.40	ribosomal	limnothamide	Limnothrix sp. CACIAM 69d
BGC0001167.4	0.39	ribosomal	piricyclamide 7005E1, piricyclamide 7005E2, piricyclamide 7005E3, piricyclamide 7005E4	Microcystis aeruginosa PCC 7005
BGC0000597.4	0.35	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000508.3	0.34	ribosomal	epidermin	Staphylococcus epidermidis
BGC0000480.5	0.33	ribosomal	tenuecyclamide A, tenuecyclamide C	Nostoc spongiaeforme var. tenue str. Carmeli
BGC0000595.3	0.33	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000531.3	0.32	ribosomal	mutacin I	Streptococcus mutans
BGC0000514.5	0.32	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0002663.2	0.32	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

NBY68_RS13565: T1TS

Domain 1 (5 - 315): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (5):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.38 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.55 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.90 out of 18.57

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.01 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_CAKMXI010000005.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 87,908 - 108,960 nt. (total: 21,053 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

NBY68_RS14010: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

NBY68_RS14055: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

Transferases: formyltransferase

NBY68_RS14065: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Lyases: cyclase hydratase

NBY68_RS14000: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

NBY68_RS14020: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002708.2	0.75	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002707.2	0.51	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002034.3	0.41	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000592.5	0.41	ribosomal	microviridin B	Microcystis aeruginosa NIES-298
BGC0001996.2	0.40	other (other)	oryzine A, oryzine B	Aspergillus oryzae RIB40
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000631.5	0.40	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0000772.5	0.39	saccharide	lipopolysaccharide	Brucella melitensis
BGC0001336.5	0.39	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001940.3	0.38	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002708.2	0.75	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002707.2	0.51	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002034.3	0.41	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000592.5	0.41	ribosomal	microviridin B	Microcystis aeruginosa NIES-298
BGC0001996.2	0.40	other (other)	oryzine A, oryzine B	Aspergillus oryzae RIB40
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000631.5	0.40	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0000772.5	0.39	saccharide	lipopolysaccharide	Brucella melitensis
BGC0001336.5	0.39	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001940.3	0.38	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene			C10	C1-C10	none
sesquiterpene			C15	C1-C10	none

Genes with terpene domains:

NBY68_RS14020: T1TS

Domain 1 (4 - 315): Type 1 terpene synthase

Subtype: Germacrene A synthase type

Reactions:: GPP → monoterpene_C1-C10; FPP → sesquiterpene_C1-C10

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (13):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.22 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.15 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.76 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.18 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.15 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.70 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.96 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.04 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.90 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.72 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GPP	Geranyl diphoshate

TFBS definitions

Regulator	Description

NZ_CAKMXI010000005.1 - Region 2 - NRPS-like

Download region GenBank file

Download region SVG

Location: 396,004 - 437,854 nt. (total: 41,851 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer

NBY68_RS15460: flavodoxin

smcogs: SMCOG1134: flavodoxin

Transferases: glycosyltransferase methyltransferase

NBY68_RS15550: methyltransferase

smcogs: SMCOG1089: methyltransferase

NBY68_RS15605: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: dehalogenase hydrolase

NBY68_RS15540: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

NBY68_RS15615: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase synthase

NBY68_RS15500: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

NBY68_RS15545: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000343.5	0.46	NRPS	enterobactin	Pseudomonas sp. J465
BGC0000913.3	0.46	other (other)	MK-8	Enterobacter cloacae
BGC0002474.2	0.45	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001596.3	0.44	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0000933.3	0.44	other (other)	xiamenmycin A	Streptomyces xiamenensis
BGC0001521.3	0.43	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002000.4	0.42	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000632.5	0.42	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0001895.4	0.42	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0001343.3	0.41	PKS	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000343.5	0.46	NRPS	enterobactin	Pseudomonas sp. J465
BGC0000913.3	0.46	other (other)	MK-8	Enterobacter cloacae
BGC0002474.2	0.45	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001596.3	0.44	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0000933.3	0.44	other (other)	xiamenmycin A	Streptomyces xiamenensis
BGC0001521.3	0.43	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002000.4	0.42	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000632.5	0.42	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0001895.4	0.42	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0001343.3	0.41	PKS	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (21):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.18 out of 25.75

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.34 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.48 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.21 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.07 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.37 out of 31.73

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.37 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.27 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.87 out of 21.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.28 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.40 out of 36.54

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.91 out of 32.93

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.64 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.42 out of 18.57

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.33 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.97 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.61 out of 35.63

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

NBY68_RS15545: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (114..513): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: VAALFAFSAPGGALQVGGAQQVYGMSEGQLNFTR
Nearest Stachelhaus code(s):: Sal ALPSQGVLNK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein

NZ_CAKMXI010000006.1 - Region 1 - betalactone,butyrolactone

Download region GenBank file

Download region SVG

Location: 443,096 - 475,834 nt. (total: 32,739 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase phosphate reductase

NBY68_RS17950: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

NBY68_RS17955: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

NBY68_RS17975: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

NBY68_RS18030: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase kinase

NBY68_RS17980: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

NBY68_RS18000: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: ligase synthase

NBY68_RS17960: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

NBY68_RS17995: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

NBY68_RS17930: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	1.00	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.88	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.57	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001201.3	0.38	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0002631.2	0.38	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001310.5	0.36	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002578.2	0.33	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001224.5	0.27	other (other)	reductasporine	uncultured bacterium
BGC0001485.4	0.26	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002514.3	0.24	PKS	julichrome Q6.6	Streptomyces sampsonii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.79	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.79	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.69	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.56	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0002514.3	0.45	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0001485.4	0.45	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.36 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.76 out of 20.97

Confidence: medium

Additional weak hits (13):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.59 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.47 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.22 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.15 out of 18.57

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 25.75

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.36 out of 27.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.59 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.36 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.90 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.53 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.34 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.13 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A

NZ_CAKMXI010000006.1 - Region 2 - ectoine

Download region GenBank file

Download region SVG

Location: 499,707 - 505,423 nt. (total: 5,717 nt) Show pHMM detection rules used

Region on contig edge.

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.78	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.75	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.69	other (other)	ectoine	Sporosarcina pasteurii
BGC0000855.3	0.64	other (other)	ectoine	Methylomicrobium kenyense
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.55	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000858.3	0.55	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.54	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.54	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.49	other (other)	ectoine	Methylophaga alcalica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.78	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.75	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.69	other (other)	ectoine	Sporosarcina pasteurii
BGC0000855.3	0.64	other (other)	ectoine	Methylomicrobium kenyense
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.55	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000858.3	0.55	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.54	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.54	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.49	other (other)	ectoine	Methylophaga alcalica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.96 out of 26.85

Confidence: medium

Additional weak hits (1):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CAKMXI010000007.1 - Region 1 - T1PKS,lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1 - 22,979 nt. (total: 22,979 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

NBY68_RS35370: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase phosphatase

NBY68_RS18255: thioesterase

smcogs: SMCOG1004: thioesterase

NBY68_RS18265: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Lyases: cyclase dehydratase

NBY68_RS18275: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

NBY68_RS18280: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Ligases: synthase

NBY68_RS18320: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.91	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002154.2	0.62	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.62	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.62	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001284.4	0.59	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001276.3	0.56	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.56	PKS	6-methylsalicyclic acid	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002154.2	0.65	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001276.3	0.62	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.62	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for NBY68_RS18275

NBY68_RS18270

Leader:

MTTALTAETDFDLDLDLEVVIQDSPA

Core:

MEAKSFTGTGTCLSCPVTSWHC

Core with dehydrations:

MEAKDhaFDhbGDhbGDhbCysLDhaCysPVDhbDhaWHCys

antiSMASH-DB 4.0 matches for NBY68_RS18270

100.0%

NZ_CAKMXI010000007.1and 2 others:

NZ_CP022685.1 Lanthipeptides: KY5_RS41710_lanthipeptideNZ_LIPF01000008.1 Lanthipeptides: AMK11_RS38025_lanthipeptide

Lanthipeptides: NBY68_RS18270_lanthipeptide

1

MEAKSFTGTGTCLSCPVTSWHC

22

MEAKSFTGTGTCLSCPVTSWHC

1

MEAKSFTGTGTCLSCPVTSWHC

22

81.8%

NZ_CP104317.1:

Lanthipeptides: NW605_RS04585_lanthipeptide

3

AKSFTGTGTCLSCPVTSWHC

22

+KSFTGTGTCLSCPVTSW+C

1

SKSFTGTGTCLSCPVTSWNC

20

63.6%

NZ_BNBL01000022.1:

Lanthipeptides: IE295_RS32570_lanthipeptide

5

SFTGTGTCLSCPVTSWHC

22

+ TGTGTC+SCP+TSWHC

1

TMTGTGTCISCPITSWHC

18

with 7 more sequence matches

54.5%

NZ_BNBU01000007.1:

Lanthipeptides: IE303_RS23625_lanthipeptide

5

SFTGTGTCLSCPVTSWHC

22

S T TGTC+SCPVT +C

2

SVTITGTCMSCPVTVMYC

19

29.6%

NZ_KB892552.1:

Lanthipeptides: allorf_45163_45315_lanthipeptide

4

KSFTGTGTCLSCPVTSWHC

22

+S TG+G PV HC

6

RSLTGSGGRCRLPVDVKHC

24

27.3%

NZ_CP070326.1and 2 others:

NZ_JAPTYM010000001.1 Lanthipeptides: O1M07_RS10855_lanthipeptideNZ_LJSN01000002.1 Lanthipeptides: AOB60_RS45965_lanthipeptide

Lanthipeptides: JNO44_RS11360_lanthipeptide

15

CPVTSWHC

22

CP TSW C

9

CPSTSWRC

16

20.7%

NZ_KB235922.1and 1 other:

NZ_KB235922.1 Lanthipeptides: PLEUR7319_RS34845_lanthipeptide

Lanthipeptides: PLEUR7319_RS34845_lanthipeptide

8

GTGTCLSCPVTSW

20

G G + CP SW

14

GCGNTMICPAISW

26

16.7%

NZ_CP059734.1:

Lanthipeptides: SG34_RS31140_lanthipeptide

4

KSFTGTGTCLSCPVTSWHC

22

++FT G+ + P HC

17

QAFTAMGSAICSPCPPRHC

35

13.5%

NZ_QNRN01000010.1:

Lanthipeptides: DET63_RS17575_lanthipeptide

5

SFTGTGTCLSCPVTSW

20

F G CP +W

16

QFPGDDLRKDCPKENW

31

10.6%

NZ_CP098485.1:

Lanthipeptides: allorf_6386562_6386786_lanthipeptide

4

KSFTGTGTCLS---CPV

17

+ F G G C++ CPV

38

RKFNGAGRCVAASGCPV

54

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (5):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.40 out of 29.51

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.78 out of 20.01

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.49 out of 29.38

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.27 out of 30.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Core peptide predictions

NBY68_RS18270 - Class I

Cleavage pHMM score: 0.90

RODEO score: 21

Monoisotopic mass: 2219.0 Da

Molecular weight: 2220.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2238.6 Da N = 1; 2256.6 Da N = 2; 2274.6 Da N = 3; 2292.6 Da N = 4

Predicted core structure(s)

For candidate cluster 1, location 0 - 22979:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS35370: mmal

PKS_AT (103..402): mmal

ATSignature: 2-Methylbutyryl-CoA

Top 3 matches:: 2-Methylbutyryl-CoA: 62.5%; Methylmalonyl-CoA: 58.3%; Methoxymalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 131.2
Methoxymalonyl-CoA: 126.2
Ethylmalonyl-CoA: 118.7
2-Methylbutyryl-CoA: 118.6
Propionyl-CoA: 96.5
trans-1,2-CPDA: 85.5
Isobutyryl-CoA: 66.5
Malonyl-CoA: 60.9
CHC-CoA: 54.2
Benzoyl-CoA: 50.0
3-Methylbutyryl-CoA: 26.1
Acetyl-CoA: 21.3
fatty_acid: 16.8
inactive: 15.2

Link to PARAS substrate predictor

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 159 - 248; Score: 63.6

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_CAKMXI010000007.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 24,026 - 45,177 nt. (total: 21,152 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

NBY68_RS18395: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: transporter

NBY68_RS18360: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001928.2	0.39	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000676.5	0.39	terpene	aphidicolin, aphidicolan-16β-ol, 3-deoxyaphidicolin, 17-deoxyaphidicolin	Phoma betae
BGC0000688.4	0.39	terpene	copalyl diphosphate	Diaporthe amygdali
BGC0000646.5	0.39	terpene	β-carotein	uncultured bacterium
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001928.2	0.39	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000676.5	0.39	terpene	aphidicolin, aphidicolan-16β-ol, 3-deoxyaphidicolin, 17-deoxyaphidicolin	Phoma betae
BGC0000688.4	0.39	terpene	copalyl diphosphate	Diaporthe amygdali
BGC0000646.5	0.39	terpene	β-carotein	uncultured bacterium
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

NBY68_RS18395: PT_FPPS_like

Domain 1 (92 - 361): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.60 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.09 out of 23.43

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.88 out of 28.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.84 out of 36.53

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.34 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 28.67 out of 39.62

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_CAKMXI010000007.1 - Region 3 - T3PKS

Download region GenBank file

Download region SVG

Location: 85,577 - 126,635 nt. (total: 41,059 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

NBY68_RS18630: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

NBY68_RS18655: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

NBY68_RS18660: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

NBY68_RS18665: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

NBY68_RS18690: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

NBY68_RS18735: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

NBY68_RS18790: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: kinase methyltransferase

NBY68_RS18730: Methylation

MITE: MITE0000155Methylation (identity: 78.00%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

NBY68_RS18755: methyltransferase

smcogs: SMCOG1248: methyltransferase

NBY68_RS18795: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: hydrolase

NBY68_RS18645: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase

NBY68_RS18725: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Translocases: transport transporter

NBY68_RS18705: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

NBY68_RS18745: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

NBY68_RS18775: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.85	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001647.3	0.47	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001077.4	0.47	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002477.3	0.46	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0002496.3	0.46	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001964.2	0.46	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0001928.2	0.45	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002358.3	0.45	PKS	cyclofaulknamycin	Streptomyces albidoflavus
BGC0000232.5	0.45	PKS	hatomarubigin A, hatomarubigin B, hatomarubigin C, hatomarubigin D	Streptomyces sp. 2238-SVT4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.85	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001647.3	0.47	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001077.4	0.47	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002477.3	0.46	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0002496.3	0.46	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001964.2	0.46	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0001928.2	0.45	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002358.3	0.45	PKS	cyclofaulknamycin	Streptomyces albidoflavus
BGC0000232.5	0.45	PKS	hatomarubigin A, hatomarubigin B, hatomarubigin C, hatomarubigin D	Streptomyces sp. 2238-SVT4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.64 out of 23.79

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.84 out of 36.53

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (9):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.81 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.29 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.45 out of 32.74

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.50 out of 29.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.68 out of 24.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.83 out of 25.88

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CAKMXI010000007.1 - Region 4 - melanin

Download region GenBank file

Download region SVG

Location: 199,736 - 210,209 nt. (total: 10,474 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

NBY68_RS19120: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: glycosyltransferase

NBY68_RS19150: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000911.3	0.81	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0001485.4	0.37	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000662.5	0.37	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.37	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.36	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001624.3	0.36	other (other)	iso-A82775C	Pestalotiopsis fici

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000911.3	0.81	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0001485.4	0.37	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000662.5	0.37	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.37	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.36	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001624.3	0.36	other (other)	iso-A82775C	Pestalotiopsis fici

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.54 out of 26.85

Confidence: medium

Additional weak hits (6):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.42 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.83 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.97 out of 32.74

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.03 out of 30.22

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.57 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CAKMXI010000007.1 - Region 5 - T2PKS,terpene

Download region GenBank file

Download region SVG

Location: 247,795 - 320,313 nt. (total: 72,519 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

NBY68_RS19380: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

NBY68_RS19450: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acetyltransferase methyltransferase

NBY68_RS19490: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

NBY68_RS19650: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

NBY68_RS19390: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

NBY68_RS19585: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

NBY68_RS19480: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

NBY68_RS19485: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

NBY68_RS19510: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase

NBY68_RS19395: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

NBY68_RS19410: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

NBY68_RS19465: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

NBY68_RS19470: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	1.14	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000272.3	0.88	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.81	PKS	spore pigment	Streptomyces avermitilis
BGC0000215.5	0.73	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.55	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.48	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.47	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000658.3	0.46	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001513.3	0.46	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001273.3	0.45	PKS	asperlactone	Aspergillus ochraceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000271.5	0.75	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.74	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.69	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001513.3	0.57	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

NBY68_RS19510: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (336 - 697): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.29 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.12 out of 23.79

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.46 out of 27.55

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.17 out of 30.11

Confidence: medium

Additional weak hits (19):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.44 out of 30.22

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.05 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.76 out of 26.85

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.57 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.54 out of 20.01

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.71 out of 20.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.50 out of 20.01

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.52 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.01 out of 27.78

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.05 out of 27.18

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.84 out of 28.14

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.35 out of 25.88

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.90 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.55 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.83 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.89 out of 23.43

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.98 out of 29.65

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

Terpene

TFBS Finder

NRPS/PKS substrate predictions

NBY68_RS19395: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (13..406): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: ESALAQMHVF-PFAYYGASYNCFGQSEIGPLATV
Nearest Stachelhaus code(s):: Abu DAWFYGAPLK (21% 8Å match)
Stachelhaus code match:: 60% (weak)

NBY68_RS19410: X

AMP-binding (82..332): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SAAVYGLFTGGGMIIFGAEVDIYGLSE----VMG
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 247794 to 320313
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

NBY68_RS19355: MET (Score: 46.4; E-value: 6.6e-15)
NBY68_RS19380: OXY (Score: 12.6; E-value: 0.00012)
NBY68_RS19450: OXY (Score: 289.5; E-value: 1.2e-88)
NBY68_RS19460: CYC C5-C18 (Score: 210.1; E-value: 2.1e-65)
NBY68_RS19465: KS (Score: 709.8; E-value: 2.3e-216)
NBY68_RS19470: CLF (Score: 550.1; E-value: 6.4e-168)
NBY68_RS19475: ACP (Score: 58.5; E-value: 1.1e-18)
NBY68_RS19480: CYC C9-C14 (Score: 240.8; E-value: 1.1e-74)
NBY68_RS19485: CYC C4-C21/C2-C23|C2-C19 (Score: 161.5; E-value: 1.2e-50)
NBY68_RS19490: MET C6|C8 (Score: 528.5; E-value: 1.3e-161)

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CatR	H2O2-responsive repressor
CelR	Cellobiose uptake repressor
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_CAKMXI010000007.1 - Region 6 - NRPS

Download region GenBank file

Download region SVG

Location: 385,895 - 411,765 nt. (total: 25,871 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

NBY68_RS19980: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

NBY68_RS20050: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase carbamoyltransferase

NBY68_RS20065: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

NBY68_RS20070: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

Ligases: ligase

NBY68_RS20060: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.95 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.09 out of 21.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.25 out of 30.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 17.16 out of 22.40

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.58 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.26 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 8, location 385894 - 411765:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS20060: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (483..886): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDPSLMELQALSGGEWDLYGPTETTVWATT
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_CAKMXI010000009.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 4,422 - 62,903 nt. (total: 58,482 nt) Show pHMM detection rules used

Region on contig edge.

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

NBY68_RS21935: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

NBY68_RS22050: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: formyltransferase kinase

NBY68_RS21930: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

NBY68_RS21980: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

NBY68_RS21995: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: esterase

NBY68_RS21975: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

Ligases: ligase synthase

NBY68_RS21900: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

NBY68_RS21965: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: permease

NBY68_RS22010: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000325.5	0.95	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001261.3	0.58	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.57	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.57	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.57	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.56	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.56	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000325.5	0.77	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.30 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.73 out of 36.53

Confidence: medium

Additional weak hits (12):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.57 out of 30.11

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.12 out of 18.57

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.39 out of 36.53

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.17 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.56 out of 39.62

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.96 out of 27.55

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.12 out of 36.53

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.21 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 4421 - 62903:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn - D-Thr - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS21965: Fo-OH-Orn - Thr - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (144..542): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISVNELYLWCGGEYHGYGPAETTIGVSH
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1624..2038): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTHFDFAVWEGNQIFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3052..3452): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_CAKMXI010000010.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 200,836 - 250,819 nt. (total: 49,984 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

NBY68_RS24275: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

NBY68_RS24350: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

NBY68_RS24380: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Isomerases: isomerase racemase

NBY68_RS24250: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

NBY68_RS24285: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

NBY68_RS24320: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: permease

NBY68_RS24355: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000392.5	0.65	NRPS	mirubactin	Actinosynnema mirum DSM 43827
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000343.5	0.63	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000392.5	0.65	NRPS	mirubactin	Actinosynnema mirum DSM 43827
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000343.5	0.63	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.03 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.84 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.74 out of 36.53

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 19.13 out of 20.01

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 25.31

Confidence: medium

Additional weak hits (15):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.73 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.74 out of 23.43

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.76 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.41 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.67 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.82 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.73 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.88 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.24 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.85 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.99 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.42 out of 36.53

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.90 out of 32.93

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.89 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 200835 - 250819:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - D-Arg)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS24320: X - Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (470..863): X

nrpys: Ser, Thr, Dhpg, Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHQYFD-SAFDVDTVLGGERNIYGPTEATVDSTT
Nearest Stachelhaus code(s):: Arg DSDDVGAVDK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1932..2326): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LLQAFDVAFWQVNLVVGAEFNAYGPTEVTINSTL
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWNVGAVNK (91% 8Å match); Arg DVENVGAINK (50% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_CAKMXI010000010.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 254,231 - 282,433 nt. (total: 28,203 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

NBY68_RS24470: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

NBY68_RS24500: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

NBY68_RS24490: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

NBY68_RS24540: isochorismatase

smcogs: SMCOG1027: isochorismatase

Ligases: synthetase

NBY68_RS24465: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.82	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.75	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.75	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.71	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.70	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0002192.3	0.52	PKS	FR901512	fungal sp. No.14919
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.82	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.75	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.75	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.71	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.70	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0002192.3	0.52	PKS	FR901512	fungal sp. No.14919
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

NBY68_RS24465: PT_FPPS_like

Domain 1 (71 - 380): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

NBY68_RS24475: PT_phytoene_like

Domain 1 (16 - 311): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

NBY68_RS24495: Lycopene_cycl

Domain 1 (11 - 383): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.22 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.90 out of 30.12

Confidence: medium

Additional weak hits (7):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.00 out of 24.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.41 out of 25.88

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

NZ_CAKMXI010000011.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1,946 - 13,238 nt. (total: 11,293 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

NBY68_RS24730: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000306.5	0.32	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0002553.2	0.28	other (other)	tunicamycin	Rathayibacter iranicus
BGC0000529.5	0.28	ribosomal	microbisporicin A2	Microbispora corallina
BGC0002788.2	0.25	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001752.4	0.21	NRPS	qinichelins	Streptomyces sp. MBT76
BGC0000241.5	0.21	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.20	PKS	nenestatin	Micromonospora echinospora
BGC0000240.5	0.20	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora pacifica
BGC0000127.5	0.19	PKS	pyoluteorin	Pseudomonas protegens Pf-5

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000306.5	0.32	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0002553.2	0.28	other (other)	tunicamycin	Rathayibacter iranicus
BGC0000529.5	0.28	ribosomal	microbisporicin A2	Microbispora corallina
BGC0002788.2	0.25	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001752.4	0.21	NRPS	qinichelins	Streptomyces sp. MBT76
BGC0000241.5	0.21	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.20	PKS	nenestatin	Micromonospora echinospora
BGC0000240.5	0.20	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora pacifica
BGC0000127.5	0.19	PKS	pyoluteorin	Pseudomonas protegens Pf-5

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.92 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CAKMXI010000011.1 - Region 2 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 227,711 - 291,987 nt. (total: 64,277 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

NBY68_RS25765: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

NBY68_RS25775: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

NBY68_RS25780: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

NBY68_RS25850: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

NBY68_RS25865: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

NBY68_RS25920: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

NBY68_RS25835: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

NBY68_RS25870: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase hydrolase peptidase

NBY68_RS25770: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

NBY68_RS25900: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

NBY68_RS25960: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Ligases: ligase synthase

NBY68_RS25820: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

NBY68_RS25845: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

NBY68_RS25860: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000041.3	0.63	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.57	PKS	ACT-Toxin II	Alternaria alternata
BGC0000037.4	0.55	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001268.4	0.54	NRPS, PKS	fusarin C	Fusarium fujikuroi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.68	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.94 out of 26.85

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.89 out of 23.79

Confidence: medium

Additional weak hits (12):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.98 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.22 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.12 out of 31.73

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.96 out of 29.51

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.22 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.55 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.73 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.99 out of 20.01

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.90 out of 20.01

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.08 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 227710 - 291987:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - redmal) + (Cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 227710 - 273548:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - redmal) + (Cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 248120 - 291987:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - redmal) + (Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS25820: X

AMP-binding (39..438): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TVSVFHANAWGAAAGCGGAMQGWGLTETSPLATF
Nearest Stachelhaus code(s):: Abu DAWFYGAPLK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

NBY68_RS25835: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (1104..1500): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVSFDLSVYDGNSMMSGDWSLGGATEASIWSIL
Nearest Stachelhaus code(s):: Cys DLYNMSLIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

NBY68_RS25865: mal

PKS_AT (103..398): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 66.7%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 210.9
inactive: 108.0
Methoxymalonyl-CoA: 84.0
Methylmalonyl-CoA: 77.3
Isobutyryl-CoA: 49.9
Propionyl-CoA: 40.0
Acetyl-CoA: 29.2
Ethylmalonyl-CoA: 28.1
3-Methylbutyryl-CoA: 27.9
fatty_acid: 23.9
2-Methylbutyryl-CoA: 22.1
Benzoyl-CoA: 21.7
CHC-CoA: 18.9
trans-1,2-CPDA: 13.7

NBY68_RS25870: mmal

PKS_AT (573..869): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 83.3%; Malonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 190.7
Ethylmalonyl-CoA: 178.2
Methoxymalonyl-CoA: 161.1
2-Methylbutyryl-CoA: 128.3
Malonyl-CoA: 103.9
trans-1,2-CPDA: 103.2
Propionyl-CoA: 95.1
CHC-CoA: 88.1
Isobutyryl-CoA: 82.4
Benzoyl-CoA: 54.7
fatty_acid: 42.3
Acetyl-CoA: 41.4
3-Methylbutyryl-CoA: 30.3
inactive: 22.2

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CAKMXI010000012.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 17,756 - 79,861 nt. (total: 62,106 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase

NBY68_RS26315: sugar transferase

smcogs: SMCOG1146: sugar transferase

Lyases: dehydratase

NBY68_RS26320: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

NBY68_RS26325: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

NBY68_RS26235: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

NBY68_RS26240: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.69	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.69	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.25 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 26.21 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 26.31 out of 28.19

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.08 out of 25.31

Confidence: medium

Additional weak hits (24):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.29 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.74 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.48 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.43 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.77 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.43 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.28 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.63 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.80 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.81 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.42 out of 29.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.95 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.29 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.00 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.12 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.41 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.08 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.19 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.69 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.49 out of 27.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 17755 - 79861:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ile - Gln - Ile - D-Gln) + (Ile - Phe)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS26235: Ile - Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (473..875): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDASTFEAFLASGGELNVYGPTETTTFATL
Nearest Stachelhaus code(s):: Ile DAFFLGVTFK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1537..1939): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: MTQAFDAAFWEMTLVLAGEVNAYGPTETTVCATM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

NBY68_RS26240: Ile - Gln - Ile - Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (502..903): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDTSFDASTFEVFLAAGGELHVYGPTETTTFVTR
Nearest Stachelhaus code(s):: Ile DAFFLGVTFK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1605..2012): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: HWMTFDASVWEVQFLCGGEHNLYGPTEATIDATA
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2672..3074): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDSSFDASTFEAFMCAGGELHVYGPTETTTFATR
Nearest Stachelhaus code(s):: Ile DAFFLGVTFK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (3735..4138): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: HWMTFDASVWELQFLCGGEHNLYGPTETTVDATA
Nearest Stachelhaus code(s):: Gln DAWQFGLVDK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
ZuR variant 1	Zinc-responsive repressor

NZ_CAKMXI010000012.1 - Region 2 - melanin

Download region GenBank file

Download region SVG

Location: 149,593 - 159,943 nt. (total: 10,351 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000662.5	0.82	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.78	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.52	other (other)	melanin	Streptomyces avermitilis
BGC0000889.5	0.51	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.50	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0002826.2	0.50	other (other)	closoxazole A, closoxazole B	Clostridium cavendishii DSM 21758
BGC0000885.3	0.48	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001295.5	0.46	other (other)	cremeomycin	Streptomyces cremeus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000662.5	0.82	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.78	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.52	other (other)	melanin	Streptomyces avermitilis
BGC0000889.5	0.51	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.50	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0002826.2	0.50	other (other)	closoxazole A, closoxazole B	Clostridium cavendishii DSM 21758
BGC0000885.3	0.48	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001295.5	0.46	other (other)	cremeomycin	Streptomyces cremeus

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.78 out of 29.72

Confidence: medium

Additional weak hits (3):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.62 out of 20.01

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.35 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

NZ_CAKMXI010000012.1 - Region 3 - oligosaccharide

Download region GenBank file

Download region SVG

Location: 243,028 - 274,376 nt. (total: 31,349 nt) Show pHMM detection rules used

Region on contig edge.

oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

NBY68_RS27105: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

NBY68_RS27115: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

NBY68_RS27190: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase acylase aminotransferase glycosyltransferase methyltransferase transferase

NBY68_RS27085: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

NBY68_RS27100: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

NBY68_RS27110: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

NBY68_RS27125: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

NBY68_RS27130: methyltransferase

smcogs: SMCOG1248: methyltransferase

NBY68_RS27145: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

NBY68_RS27150: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

NBY68_RS27165: aminotransferase

smcogs: SMCOG1019: aminotransferase

NBY68_RS27170: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase

NBY68_RS27155: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: dehydratase

NBY68_RS27140: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

NBY68_RS27175: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

NBY68_RS27185: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002164.2	0.60	NRPS	peramine	Epichloe festucae
BGC0000278.3	0.60	PKS	urdamycin	Streptomyces fradiae
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001249.5	0.59	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002164.2	0.60	NRPS	peramine	Epichloe festucae
BGC0000278.3	0.60	PKS	urdamycin	Streptomyces fradiae
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001249.5	0.59	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.03 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.46 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CAKMXI010000013.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 103,867 - 130,458 nt. (total: 26,592 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

NBY68_RS27710: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

NBY68_RS27745: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: aminotransferase transferase

NBY68_RS27705: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

NBY68_RS27770: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: dehydratase

NBY68_RS27695: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

NBY68_RS27750: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002508.2	0.48	other (other)	8-azaguanine	Streptomyces pathocidini
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002508.2	0.48	other (other)	8-azaguanine	Streptomyces pathocidini
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

NBY68_RS27735: PT_phytoene_like

Domain 1 (17 - 280): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

NBY68_RS27740: PT_phytoene_like

Domain 1 (13 - 295): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

NBY68_RS27750: PT_FPPS_like

Domain 1 (73 - 366): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

NBY68_RS27755: T2TS

Domain 1 (25 - 652): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.76 out of 21.84

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.54 out of 23.79

Confidence: strong

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.09 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.12 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_CAKMXI010000013.1 - Region 2 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 211,093 - 274,219 nt. (total: 63,127 nt) Show pHMM detection rules used

Region on contig edge.

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase reductase

NBY68_RS28210: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

NBY68_RS28215: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

NBY68_RS28300: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

NBY68_RS28440: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: glycosyltransferase kinase methyltransferase

NBY68_RS28205: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

NBY68_RS28330: methyltransferase

smcogs: SMCOG1089: methyltransferase

NBY68_RS28430: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

Hydrolases: esterase

NBY68_RS28305: thioesterase

smcogs: SMCOG1004: thioesterase

NBY68_RS28425: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

NBY68_RS28435: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: isomerase

NBY68_RS28325: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

NBY68_RS28275: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

NBY68_RS28280: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

NBY68_RS28335: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

NBY68_RS28355: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

NBY68_RS28385: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

NBY68_RS28390: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

NBY68_RS28450: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000324.5	1.04	NRPS	coelibactin	Streptomyces coelicolor A3(2)
BGC0001128.4	0.61	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.60	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000324.5	0.80	NRPS	coelibactin	Streptomyces coelicolor A3(2)
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.45 out of 29.51

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.25 out of 29.72

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.51 out of 29.38

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.60 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.46 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.36 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.64 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.85 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.69 out of 28.19

Confidence: medium

Additional weak hits (34):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.09 out of 29.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.16 out of 30.22

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.07 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.60 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.91 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.55 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.93 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.80 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.44 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.96 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.79 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.10 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.74 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.24 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.12 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.60 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.41 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.51 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.07 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.35 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.16 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.63 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.69 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.98 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.44 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.30 out of 28.14

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.45 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.44 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.28 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 211092 - 274219:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - Cys) + (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS28275: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..447): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NASLFTLSCPGGSLQVGGAQQVFGMAEGLINLTR
Nearest Stachelhaus code(s):: diOH-Bz PLPSQGVVNK (82% 8Å match); diOH-Bz or Sal TLPAQGVIAK (79% 8Å match)
Stachelhaus code match:: 80% (moderate)

NBY68_RS28280: Thr - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (554..949): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TAMSFDLATWDAQCLLGGDVALGGMTEAAVHSTV
Nearest Stachelhaus code(s):: Thr DLWQLGLVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1607..2007): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVSFDLSVYDGNTLVSGDVAMGGATEASIWSNT
Nearest Stachelhaus code(s):: Cys DLYNLSMIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

NBY68_RS28285: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (544..943): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDIAFDLSVYDGNSLISGDVSLGGATEGSIWSIA
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
DosR	Hypoxia stress response regulator
FuR variant 1	Ferric Uptake Regulator
NtrC	Nitrogen regulatory protein C
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_CAKMXI010000015.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 42,062 - 53,441 nt. (total: 11,380 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.78	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000519.4	0.50	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000496.5	0.45	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000501.3	0.42	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.78	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000519.4	0.50	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000496.5	0.45	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000501.3	0.42	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.47 out of 23.79

Confidence: medium

Additional weak hits (1):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_CAKMXI010000015.1 - Region 2 - PKS-like,terpene-precursor

Download region GenBank file

Download region SVG

Location: 53,950 - 103,322 nt. (total: 49,373 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

NBY68_RS29940: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

NBY68_RS29950: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

NBY68_RS29960: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

NBY68_RS29970: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acylase

NBY68_RS29935: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: phosphatase

NBY68_RS29975: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Ligases: synthase synthetase

NBY68_RS29890: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

NBY68_RS29945: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Translocases: transporter

NBY68_RS30060: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000065.5	0.28	PKS	rustmicin	Streptomyces galbus
BGC0000068.5	0.18	PKS	geldanamycin	Streptomyces hygroscopicus
BGC0000677.5	0.17	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002173.2	0.16	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000798.3	0.16	saccharide	dhurrin	Sorghum bicolor
BGC0000675.5	0.15	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000886.4	0.15	other (other)	allylmalonyl-CoA	Streptomyces tsukubensis
BGC0001813.4	0.14	NRPS	tyrobetaine	Streptomyces sp. NRRL WC-3703
BGC0001911.3	0.14	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.14	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000065.5	0.61	PKS	rustmicin	Streptomyces galbus
BGC0000068.5	0.49	PKS	geldanamycin	Streptomyces hygroscopicus
BGC0000677.5	0.49	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002173.2	0.47	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000798.3	0.46	saccharide	dhurrin	Sorghum bicolor
BGC0000675.5	0.46	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000886.4	0.45	other (other)	allylmalonyl-CoA	Streptomyces tsukubensis
BGC0001813.4	0.45	NRPS	tyrobetaine	Streptomyces sp. NRRL WC-3703
BGC0001911.3	0.44	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.43	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

NBY68_RS29890: PT_FPPS_like

Domain 1 (6 - 110): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.77 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.54 out of 29.38

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 26.44 out of 28.19

Confidence: strong

Additional weak hits (15):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.02 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 19.18 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 19.51 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.61 out of 20.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.94 out of 29.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.81 out of 27.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.94 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.00 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.06 out of 23.43

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 53949 - 103322:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 62302 - 103322:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS29935: mal

PKS_AT (14..283): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 24.9
Methoxymalonyl-CoA: 20.5
Methylmalonyl-CoA: 19.3
2-Methylbutyryl-CoA: 8.8
fatty_acid: 7.1
trans-1,2-CPDA: 0.0
inactive: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
FuR variant 1	Ferric Uptake Regulator
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_CAKMXI010000015.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 174,553 - 209,944 nt. (total: 35,392 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

NBY68_RS30505: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Hydrolases: deaminase

NBY68_RS30480: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Ligases: ligase synthase

NBY68_RS30475: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

NBY68_RS30510: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

NBY68_RS35450: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.70	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.70	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.33 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.83 out of 28.14

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.52 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.04 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.76 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.62 out of 29.38

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 174552 - 209944:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Ser - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS30510: X - X

AMP-binding (479..882): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWSTFDAAMWESQLSSAGESNTYGPTECSIDSTA
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1583..1982): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HIASFDVSMEQAETNLSSDVCCYGPTEATVTCLL
Nearest Stachelhaus code(s):: Arg DVEEIGAITK (44% 8Å match); Ahp DVENAGVVTK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

NBY68_RS35450: Ser - X

Search NORINE for peptide: strict or relaxed

AMP-binding (508..908): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVCSGEHNLYGPTEAAVDVTS
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1563..1957): X

nrpys: Leu, Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDESFDASTFEGFLLAGGDSNMYGPTECTTFSTG
Nearest Stachelhaus code(s):: Leu or Ile DAFFLGMTFK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_CAKMXI010000016.1 - Region 1 - T1PKS,terpene

Download region GenBank file

Download region SVG

Location: 1 - 33,247 nt. (total: 33,247 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

NBY68_RS30535: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase

NBY68_RS30565: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

NBY68_RS30540: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

NBY68_RS30550: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

NBY68_RS30605: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.87	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.85	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.57	PKS	FR901512	fungal sp. No.14919
BGC0000041.3	0.57	PKS	oronofacic acid	Pseudomonas syringae
BGC0001254.3	0.56	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000037.4	0.55	PKS	cichorine	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000041.3	0.62	PKS	oronofacic acid	Pseudomonas syringae
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

NBY68_RS30560: T2TS

Domain 1 (193 - 508): Type 2 terpene synthase

Subtype: unknown

NBY68_RS30565: T1TS

Domain 1 (6 - 289): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.52 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.13 out of 23.79

Confidence: medium

Additional weak hits (1):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.27 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 33247:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal) + (mal)
Non-colinear ordering:: NBY68_RS30530 + NBY68_RS30535 + NBY68_RS30540

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS30530: mmal

PKS_AT (1849..2143): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 196.4
Ethylmalonyl-CoA: 185.2
Methoxymalonyl-CoA: 163.5
2-Methylbutyryl-CoA: 140.0
Propionyl-CoA: 124.6
trans-1,2-CPDA: 117.5
CHC-CoA: 95.8
Malonyl-CoA: 95.4
Isobutyryl-CoA: 60.5
Benzoyl-CoA: 47.9
fatty_acid: 39.0
Acetyl-CoA: 32.2
3-Methylbutyryl-CoA: 24.6
inactive: 19.5

NBY68_RS30540: mal

PKS_AT (592..889): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.7
inactive: 111.8
Methoxymalonyl-CoA: 74.9
Methylmalonyl-CoA: 70.9
Isobutyryl-CoA: 50.0
Propionyl-CoA: 35.4
Ethylmalonyl-CoA: 30.2
2-Methylbutyryl-CoA: 23.9
Benzoyl-CoA: 23.3
Acetyl-CoA: 15.3
fatty_acid: 14.1
CHC-CoA: 8.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism

NZ_CAKMXI010000016.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 112,089 - 122,316 nt. (total: 10,228 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0000500.5	0.38	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000617.5	0.37	ribosomal	coagulin	Bacillus coagulans
BGC0000589.5	0.37	ribosomal	microcin M	Escherichia coli Nissle 1917
BGC0000551.5	0.37	ribosomal	SapB	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0000500.5	0.38	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000617.5	0.37	ribosomal	coagulin	Bacillus coagulans
BGC0000589.5	0.37	ribosomal	microcin M	Escherichia coli Nissle 1917
BGC0000551.5	0.37	ribosomal	SapB	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

Additional weak hits (3):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.75 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.69 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.99 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor

NZ_CAKMXI010000016.1 - Region 3 - T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 129,932 - 183,608 nt. (total: 53,677 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

NBY68_RS31255: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

NBY68_RS31265: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: acylase aminotransferase phosphotransferase

NBY68_RS31135: Glucose-specific phosphotransferase enzyme IIA

smcogs: SMCOG1145: Glucose-specific phosphotransferase enzyme IIA

NBY68_RS31140: aminotransferase

smcogs: SMCOG1019: aminotransferase

NBY68_RS31190: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

NBY68_RS31245: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: dehydratase

NBY68_RS31195: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

NBY68_RS31180: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

NBY68_RS31185: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

NBY68_RS31225: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.53	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001268.4	0.52	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002164.2	0.50	NRPS	peramine	Epichloe festucae
BGC0000861.5	0.42	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0002648.2	0.42	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000862.3	0.41	other (other)	eicosapentaenoic acid	Shewanella pneumatophori
BGC0000869.5	0.41	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002164.2	0.58	NRPS	peramine	Epichloe festucae
BGC0000861.5	0.54	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0002648.2	0.54	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000862.3	0.53	other (other)	eicosapentaenoic acid	Shewanella pneumatophori
BGC0000869.5	0.53	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 33.36 out of 36.53

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (13):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.11 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.19 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.19 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.07 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.55 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.04 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.89 out of 30.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.73 out of 19.26

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.57 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.80 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.21 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.11 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.98 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 129931 - 183608:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS31180: mmal

PKS_AT (912..1146): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 30.5
Methoxymalonyl-CoA: 28.1
Ethylmalonyl-CoA: 22.9
Propionyl-CoA: 16.8
2-Methylbutyryl-CoA: 13.4
inactive: 9.8
Malonyl-CoA: 7.6
3-Methylbutyryl-CoA: 5.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0

NBY68_RS31185: mal

PKS_AT (574..870): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 89.9
Methoxymalonyl-CoA: 43.8
Methylmalonyl-CoA: 35.7
inactive: 31.7
CHC-CoA: 19.6
2-Methylbutyryl-CoA: 17.2
fatty_acid: 13.5
trans-1,2-CPDA: 12.4
Ethylmalonyl-CoA: 11.8
Propionyl-CoA: 10.8
Isobutyryl-CoA: 5.5
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
DmdR1	Iron(II)-dependent repressor

NZ_CAKMXI010000016.1 - Region 4 - ectoine

Download region GenBank file

Download region SVG

Location: 186,921 - 192,723 nt. (total: 5,803 nt) Show pHMM detection rules used

Region on contig edge.

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.76	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.74	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.69	other (other)	ectoine	Sporosarcina pasteurii
BGC0000855.3	0.64	other (other)	ectoine	Methylomicrobium kenyense
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.58	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000858.3	0.55	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.54	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.53	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.53	other (other)	ectoine	Methylophaga alcalica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.76	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.74	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.69	other (other)	ectoine	Sporosarcina pasteurii
BGC0000855.3	0.64	other (other)	ectoine	Methylomicrobium kenyense
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.58	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000858.3	0.55	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.54	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.53	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.53	other (other)	ectoine	Methylophaga alcalica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.73 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CAKMXI010000018.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 62,117 nt. (total: 62,117 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

NBY68_RS32210: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

NBY68_RS32255: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

NBY68_RS32265: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

NBY68_RS32280: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

Transferases: acylase glycosyltransferase

NBY68_RS32245: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

NBY68_RS32250: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: esterase

NBY68_RS32220: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

NBY68_RS32285: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

NBY68_RS32205: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

NBY68_RS32215: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

NBY68_RS32240: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

NBY68_RS32260: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

NBY68_RS32270: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000041.3	0.68	PKS	oronofacic acid	Pseudomonas syringae
BGC0001522.5	0.67	PKS	auroramycin	Streptomyces filamentosus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000041.3	0.68	PKS	oronofacic acid	Pseudomonas syringae
BGC0001522.5	0.67	PKS	auroramycin	Streptomyces filamentosus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.03 out of 27.04

Confidence: medium

Additional weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.64 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.54 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.04 out of 29.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 27.24 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.47 out of 36.54

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.03 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.07 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 62117:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal) + (ccmal - ccmal) + (ccmal - ccmal)
Non-colinear ordering:: NBY68_RS32245 + NBY68_RS32240 + NBY68_RS32270

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS32240: mal - mal

PKS_AT (582..875): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.6
inactive: 105.2
Methoxymalonyl-CoA: 62.4
Methylmalonyl-CoA: 43.4
Propionyl-CoA: 27.8
Isobutyryl-CoA: 18.3
fatty_acid: 13.8
Benzoyl-CoA: 11.7
Acetyl-CoA: 10.9
CHC-CoA: 6.9
2-Methylbutyryl-CoA: 5.5
Ethylmalonyl-CoA: 2.5
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2312..2604): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.8
inactive: 93.5
Methoxymalonyl-CoA: 62.0
Methylmalonyl-CoA: 47.1
Propionyl-CoA: 16.7
Isobutyryl-CoA: 15.5
Benzoyl-CoA: 14.3
Acetyl-CoA: 14.1
fatty_acid: 9.0
CHC-CoA: 5.8
Ethylmalonyl-CoA: 5.2
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

NBY68_RS32245: mmal

PKS_AT (563..861): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 197.4
Ethylmalonyl-CoA: 181.5
Methoxymalonyl-CoA: 158.5
2-Methylbutyryl-CoA: 124.4
trans-1,2-CPDA: 114.6
CHC-CoA: 102.7
Propionyl-CoA: 97.1
Malonyl-CoA: 93.7
Isobutyryl-CoA: 85.9
Benzoyl-CoA: 64.5
Acetyl-CoA: 50.5
3-Methylbutyryl-CoA: 40.1
inactive: 32.8
fatty_acid: 21.2

NBY68_RS32270: mal - mal

PKS_AT (557..850): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 168.7
inactive: 79.6
Methylmalonyl-CoA: 67.3
Methoxymalonyl-CoA: 62.0
Propionyl-CoA: 35.7
Ethylmalonyl-CoA: 33.9
Benzoyl-CoA: 30.4
Isobutyryl-CoA: 26.6
Acetyl-CoA: 26.4
CHC-CoA: 15.1
trans-1,2-CPDA: 14.3
2-Methylbutyryl-CoA: 13.9
fatty_acid: 12.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (2293..2588): mal

ATSignature: CE-Malonyl-CoA, Malonyl-CoA, Ethylmalonyl-CoA, Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: CE-Malonyl-CoA: 54.2%; Malonyl-CoA: 54.2%; Ethylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 105.4
Methoxymalonyl-CoA: 52.0
Methylmalonyl-CoA: 51.4
inactive: 39.5
Ethylmalonyl-CoA: 23.4
Benzoyl-CoA: 14.2
fatty_acid: 12.6
Acetyl-CoA: 12.4
CHC-CoA: 11.7
Isobutyryl-CoA: 11.4
trans-1,2-CPDA: 9.7
Propionyl-CoA: 9.6
2-Methylbutyryl-CoA: 4.8
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NZ_CAKMXI010000018.1 - Region 2 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 87,723 - 120,313 nt. (total: 32,591 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

NBY68_RS32465: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

NBY68_RS32510: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

NBY68_RS32460: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0001531.5	0.51	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0001531.5	0.51	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.00 out of 20.47

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.47 out of 27.18

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.75 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.00 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.66 out of 30.12

Confidence: medium

Additional weak hits (6):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.52 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.12 out of 27.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_CAKMXI010000024.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 7,086 - 38,381 nt. (total: 31,296 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

NBY68_RS34680: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

NBY68_RS34705: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

NBY68_RS34725: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

NBY68_RS34710: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000037.4	0.61	PKS	cichorine	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000037.4	0.61	PKS	cichorine	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (3):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.67 out of 20.01

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.76 out of 26.06

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

NBY68_RS34710: mal

PKS_AT (582..738): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 99.9
inactive: 46.4
Methylmalonyl-CoA: 35.2
Methoxymalonyl-CoA: 33.7
Propionyl-CoA: 25.9
Isobutyryl-CoA: 25.9
fatty_acid: 17.6
CHC-CoA: 15.3
2-Methylbutyryl-CoA: 14.8
Ethylmalonyl-CoA: 14.3
Benzoyl-CoA: 14.3
Acetyl-CoA: 12.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

NBY68_RS34725: mal

PKS_AT (1546..1828): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 168.5
inactive: 71.2
Methoxymalonyl-CoA: 57.3
Methylmalonyl-CoA: 45.4
Propionyl-CoA: 32.6
Ethylmalonyl-CoA: 29.8
Isobutyryl-CoA: 23.3
2-Methylbutyryl-CoA: 20.8
Benzoyl-CoA: 19.4
Acetyl-CoA: 18.8
fatty_acid: 15.4
CHC-CoA: 15.4
trans-1,2-CPDA: 12.7
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_CAKMXI010000025.1 - Region 1 - NRPS,terpene

Download region GenBank file

Download region SVG

Location: 1 - 28,724 nt. (total: 28,724 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

NBY68_RS34735: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

NBY68_RS34760: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

NBY68_RS34810: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Hydrolases: deaminase esterase

NBY68_RS34750: putative esterase

smcogs: SMCOG1104: putative esterase

NBY68_RS34775: thioesterase

smcogs: SMCOG1004: thioesterase

NBY68_RS34795: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: cyclase dehydratase hydratase

NBY68_RS34740: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

NBY68_RS34780: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

NBY68_RS34800: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase synthase

NBY68_RS34755: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

NBY68_RS34790: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

NBY68_RS34805: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0002075.3	0.58	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001250.4	0.54	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.54	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.54	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002164.2	0.51	NRPS	peramine	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

NBY68_RS34780: T1TS

Domain 1 (5 - 323): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.95 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.13 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.49 out of 28.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 28724:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS34730: Leu - X - Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (477..876): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAVAFDAVVLEMLLFVGGEVNAYGPTEITVAATM
Nearest Stachelhaus code(s):: Leu DALLFGAVVK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1544..1948): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISIWQSEVVVTGEVNAYGPTECSDDVTH
Nearest Stachelhaus code(s):: Dpr DIWEVTADDK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2606..2898): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YHCSFDLGLTAGKVVVGGEVNHYGPTETTVGCLD
Nearest Stachelhaus code(s):: Asp DLTKVGHVGK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

NBY68_RS34755: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (8..454): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWAAFDLSVFDAYSLFAGEYNLYGPTETNVCTFH
Nearest Stachelhaus code(s):: Pro DLFYLALVCK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

NBY68_RS34805: X

AMP-binding (34..439): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VLTLHTACVISGTSLTGAAFNLYGQTELASVLTL
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

NZ_CAKMXI010000028.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 19,977 nt. (total: 19,977 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

NBY68_RS35050: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

NBY68_RS35055: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: aminotransferase glycosyltransferase transferase

NBY68_RS35065: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

NBY68_RS35080: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

NBY68_RS35090: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

NBY68_RS35095: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

Lyases: dehydratase

NBY68_RS35085: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

NBY68_RS35040: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

NBY68_RS35045: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.81 out of 39.62

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.38 out of 27.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 19977:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Tyr) + (Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS35045: Tyr - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (102..500): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: IARAFDAAVSETTLVIAGEFNAYGPTETTVSCTM
Nearest Stachelhaus code(s):: Tyr DASTVAAVCK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1649..2048): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSWDASTLEVWARTGGDTAGYGPTETTVFSTR
Nearest Stachelhaus code(s):: Val or aIle DALWWGGVFK (82% 8Å match); Val DALWIGGVFK (53% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_CAKMXI010000029.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 20,207 nt. (total: 20,207 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

NBY68_RS35105: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

NBY68_RS35110: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

NBY68_RS35125: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.64	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.64	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 20207:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (Me-mal) + (Me-redmal)
Non-colinear ordering:: NBY68_RS35110 + NBY68_RS35115 + NBY68_RS35120 + NBY68_RS35105

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS35105: mmal

PKS_AT (579..876): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 87.5%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 195.0
Ethylmalonyl-CoA: 178.3
Methoxymalonyl-CoA: 164.4
2-Methylbutyryl-CoA: 115.1
trans-1,2-CPDA: 106.3
Malonyl-CoA: 96.4
Propionyl-CoA: 95.4
CHC-CoA: 91.0
Isobutyryl-CoA: 73.7
Benzoyl-CoA: 55.0
Acetyl-CoA: 50.3
3-Methylbutyryl-CoA: 48.5
inactive: 26.9
fatty_acid: 16.1

NBY68_RS35110: mmal

PKS_AT (564..859): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 194.1
Ethylmalonyl-CoA: 168.5
Methoxymalonyl-CoA: 161.3
2-Methylbutyryl-CoA: 138.8
Propionyl-CoA: 123.9
trans-1,2-CPDA: 116.5
CHC-CoA: 107.7
Malonyl-CoA: 101.3
Acetyl-CoA: 70.8
Isobutyryl-CoA: 68.8
Benzoyl-CoA: 58.0
3-Methylbutyryl-CoA: 40.8
inactive: 39.7
fatty_acid: 25.7

NBY68_RS35115: mmal

PKS_AT (718..1023): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 191.4
Ethylmalonyl-CoA: 187.6
Methoxymalonyl-CoA: 153.5
2-Methylbutyryl-CoA: 113.6
Propionyl-CoA: 112.9
trans-1,2-CPDA: 108.2
Malonyl-CoA: 97.4
CHC-CoA: 88.5
Isobutyryl-CoA: 77.0
Benzoyl-CoA: 57.0
Acetyl-CoA: 45.8
inactive: 40.4
3-Methylbutyryl-CoA: 20.3
fatty_acid: 14.7

Link to PARAS substrate predictor

NZ_CAKMXI010000030.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 16,349 nt. (total: 16,349 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

NBY68_RS35130: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

NBY68_RS35135: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

NBY68_RS35150: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 16349:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Phe) + (X - Asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS35135: Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (119..519): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: MYRLFDASTYEGLFYVGGDTNTYGPTECTQCAVH
Nearest Stachelhaus code(s):: Dhpg DAYHGGTLCK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

NBY68_RS35150: X - Asp - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (472..878): X

nrpys: Orn, Lys

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHASDALWPPWDVMVGGERNFYGPTETTVDSLV
Nearest Stachelhaus code(s):: Orn DTEDMGFVDK (65% 8Å match); Lys DADDGGFVDK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1543..1945): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTAT--VIGGEVNAYGPTESTVNCTE
Nearest Stachelhaus code(s):: Asp DLTKVGAVNK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2615..2904): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDICLLELQALVGGERNLYGPTETTIWSTS
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_CAKMXI010000032.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 10,243 nt. (total: 10,243 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

NBY68_RS35205: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

NBY68_RS35200: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.63	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.63	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 10243:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS35200: mmal

PKS_AT (983..1281): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.1
Ethylmalonyl-CoA: 196.1
Methoxymalonyl-CoA: 179.0
2-Methylbutyryl-CoA: 131.8
trans-1,2-CPDA: 117.6
Malonyl-CoA: 107.7
Propionyl-CoA: 92.6
Isobutyryl-CoA: 87.7
CHC-CoA: 86.1
Benzoyl-CoA: 63.4
Acetyl-CoA: 61.1
3-Methylbutyryl-CoA: 55.9
inactive: 39.5
fatty_acid: 24.2

NBY68_RS35205: mmal

PKS_AT (573..870): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 211.2
Ethylmalonyl-CoA: 201.2
Methoxymalonyl-CoA: 177.1
2-Methylbutyryl-CoA: 127.3
trans-1,2-CPDA: 126.0
Propionyl-CoA: 105.8
CHC-CoA: 104.8
Malonyl-CoA: 102.1
Isobutyryl-CoA: 94.6
Benzoyl-CoA: 72.8
Acetyl-CoA: 69.2
3-Methylbutyryl-CoA: 63.4
fatty_acid: 36.9
inactive: 35.8

Link to PARAS substrate predictor

NZ_CAKMXI010000033.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 6,326 nt. (total: 6,326 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

NBY68_RS35210: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

NBY68_RS35215: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001268.4	0.59	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000041.3	0.52	PKS	oronofacic acid	Pseudomonas syringae
BGC0002171.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002240.3	0.48	PKS	BAB, BAA	Metarhizium anisopliae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001268.4	0.59	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000041.3	0.52	PKS	oronofacic acid	Pseudomonas syringae
BGC0002171.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002240.3	0.48	PKS	BAB, BAA	Metarhizium anisopliae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

NBY68_RS35215: mmal

PKS_AT (573..789): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 146.0
Ethylmalonyl-CoA: 135.7
Methoxymalonyl-CoA: 122.7
2-Methylbutyryl-CoA: 91.8
trans-1,2-CPDA: 78.2
CHC-CoA: 69.1
Malonyl-CoA: 66.6
Propionyl-CoA: 65.2
Isobutyryl-CoA: 57.4
Benzoyl-CoA: 57.3
Acetyl-CoA: 42.5
3-Methylbutyryl-CoA: 27.0
inactive: 24.7
fatty_acid: 22.2

Link to PARAS substrate predictor

NZ_CAKMXI010000036.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 4,348 nt. (total: 4,348 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

NBY68_RS35240: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.62	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000122.5	0.49	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000043.5	0.49	PKS	curacin A	Moorea producens 19L
BGC0000353.5	0.47	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000041.3	0.46	PKS	oronofacic acid	Pseudomonas syringae
BGC0002138.2	0.46	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0001544.3	0.45	NRPS, PKS	chlorflavonin	Aspergillus campestris IBT 28561
BGC0001235.4	0.45	NRPS, PKS	antalid	Polyangium spumosum
BGC0002229.2	0.44	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0001794.4	0.44	NRPS, PKS	swainsonine	Alternaria oxytropis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.62	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000122.5	0.49	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000043.5	0.49	PKS	curacin A	Moorea producens 19L
BGC0000353.5	0.47	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000041.3	0.46	PKS	oronofacic acid	Pseudomonas syringae
BGC0002138.2	0.46	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0001544.3	0.45	NRPS, PKS	chlorflavonin	Aspergillus campestris IBT 28561
BGC0001235.4	0.45	NRPS, PKS	antalid	Polyangium spumosum
BGC0002229.2	0.44	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0001794.4	0.44	NRPS, PKS	swainsonine	Alternaria oxytropis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 4348:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NBY68_RS35240: mal

PKS_AT (25..329): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 184.4
inactive: 82.8
Methylmalonyl-CoA: 80.0
Methoxymalonyl-CoA: 75.4
Isobutyryl-CoA: 46.3
Propionyl-CoA: 45.3
Ethylmalonyl-CoA: 43.0
2-Methylbutyryl-CoA: 28.3
Acetyl-CoA: 22.9
trans-1,2-CPDA: 16.4
Benzoyl-CoA: 16.3
CHC-CoA: 13.9
fatty_acid: 9.6
3-Methylbutyryl-CoA: 9.5

Link to PARAS substrate predictor