GCF_900221035.1 - 37 region(s)

Download region SVG

Location: 216,025 - 226,492 nt. (total: 10,468 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

CPH93_RS00975: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000912.3	0.79	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.78	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.63	other (other)	melanin	Streptomyces avermitilis
BGC0000908.3	0.57	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.35	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.34	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.34	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000627.4	0.29	ribosomal	ustiloxin B	Aspergillus flavus NRRL3357

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000912.3	0.79	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.78	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.63	other (other)	melanin	Streptomyces avermitilis
BGC0000908.3	0.57	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.35	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.34	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.34	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000627.4	0.29	ribosomal	ustiloxin B	Aspergillus flavus NRRL3357

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.64 out of 33.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.66 out of 26.85

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LT907981.1 - Region 2 - NRPS-like,T1PKS,benzoxazole,butyrolactone,oligosaccharide

Download region SVG

Location: 248,183 - 441,764 nt. (total: 193,582 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
benzoxazole: (ksIII and AMP-binding and PP-binding and Amidohydro_1)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CPH93_RS01150: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

CPH93_RS01250: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CPH93_RS01305: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: PPTase acylase aminotransferase glycosyltransferase sulfotransferase transferase

CPH93_RS01080: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

CPH93_RS01090: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

CPH93_RS01200: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CPH93_RS01215: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CPH93_RS01220: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

CPH93_RS01225: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CPH93_RS01240: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

CPH93_RS01245: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CPH93_RS01320: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CPH93_RS01355: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: hydrolase

CPH93_RS01070: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: dehydratase

CPH93_RS01110: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

CPH93_RS01165: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

CPH93_RS01230: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

CPH93_RS01235: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

CPH93_RS01065: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CPH93_RS01210: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CPH93_RS01260: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CPH93_RS01265: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CPH93_RS01285: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CPH93_RS01290: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CPH93_RS01315: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CPH93_RS36590: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	1.70	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001877.4	1.59	PKS	cyphomycin	Streptomyces sp. ISID311
BGC0001273.3	1.34	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	1.33	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	1.32	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001458.4	1.26	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0000850.5	1.21	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002191.2	1.18	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	1.10	PKS	FR901512	fungal sp. No.14919
BGC0000037.4	1.04	PKS	cichorine	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001877.4	0.85	PKS	cyphomycin	Streptomyces sp. ISID311
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.75	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.67	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000041.3	0.66	PKS	oronofacic acid	Pseudomonas syringae
BGC0001856.4	0.65	PKS	caniferolide A, caniferolide B, caniferolide C, caniferolide D	Streptomyces caniferus
BGC0002276.2	0.64	NRPS	choline	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.81 out of 23.79

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.03 out of 36.53

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.16 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.35 out of 27.55

Confidence: medium

Additional weak hits (17):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.56 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.43 out of 26.85

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 21.55

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.13 out of 29.51

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.83 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.70 out of 26.06

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.05 out of 19.26

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.85 out of 32.74

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.98 out of 35.63

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.39 out of 36.53

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.93 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.32 out of 26.12

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 248182 - 441764:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-ohmal - Me-ohmal) + (pk - Me-ohmal - ccmal) + (ccmal - redmal) + (ohmal - redmal - ohmal) + (ohmal - ohmal - mal - Me-ohmal - redmal) + (ohmal - redmal - ohmal) + (Me-ohmal - ccmal) + (AHBA - pk) + (Gln) + (Asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 248182 - 291974:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn) + (Gln)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 272803 - 441764:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (AHBA - pk) + (Me-mal - Me-ohmal - Me-ohmal) + (pk - Me-ohmal - ccmal) + (ccmal - redmal) + (ohmal - redmal - ohmal) + (ohmal - ohmal - mal - Me-ohmal - redmal) + (ohmal - redmal - ohmal) + (Me-ohmal - ccmal)
Non-colinear ordering:: CPH93_RS01215 + CPH93_RS01320 + CPH93_RS01315 + CPH93_RS01290 + CPH93_RS01285 + CPH93_RS36590 + CPH93_RS01265 + CPH93_RS01260

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CPH93_RS01065: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (415..819): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATFDVSGTSLNLIVIGEVNEYGPTEATIGCTA
Nearest Stachelhaus code(s):: Asn DGTKIGEIGK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

CPH93_RS01125: Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (11..409): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QWITFDAAQWEAQCFSGGEVNLYGPTECTINATA
Nearest Stachelhaus code(s):: Gln DAWQFGLINK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

CPH93_RS01215: AHBA - pk

CAL_domain (37..445): AHBA

minowa: AHBA

Prediction, score:

AHBA: 323.1
shikimic_acid: 254.6
Acetyl-CoA: 16.7
NH2: 0.1
fatty_acid: 0.0

PKS_AT (1182..1477): pk

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 204.4
Methylmalonyl-CoA: 194.5
Methoxymalonyl-CoA: 159.8
2-Methylbutyryl-CoA: 138.1
trans-1,2-CPDA: 127.2
Propionyl-CoA: 110.8
CHC-CoA: 105.9
Malonyl-CoA: 86.8
Benzoyl-CoA: 49.4
Isobutyryl-CoA: 47.8
3-Methylbutyryl-CoA: 37.2
Acetyl-CoA: 34.1
fatty_acid: 31.5
inactive: 17.8

CPH93_RS01260: mmal - mal

PKS_AT (569..866): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 219.2
Ethylmalonyl-CoA: 213.2
Methoxymalonyl-CoA: 177.8
2-Methylbutyryl-CoA: 165.6
trans-1,2-CPDA: 141.7
Propionyl-CoA: 123.8
Malonyl-CoA: 109.6
CHC-CoA: 100.0
Isobutyryl-CoA: 81.5
Benzoyl-CoA: 68.7
Acetyl-CoA: 58.0
3-Methylbutyryl-CoA: 39.9
fatty_acid: 33.3
inactive: 31.4

PKS_AT (2116..2410): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 235.5
inactive: 129.6
Methoxymalonyl-CoA: 63.2
Methylmalonyl-CoA: 55.8
Propionyl-CoA: 39.8
Isobutyryl-CoA: 33.0
Ethylmalonyl-CoA: 27.6
Benzoyl-CoA: 26.3
Acetyl-CoA: 26.3
CHC-CoA: 16.2
2-Methylbutyryl-CoA: 14.9
fatty_acid: 13.1
trans-1,2-CPDA: 8.8
3-Methylbutyryl-CoA: 0.0

CPH93_RS01265: mal - mal - mal

PKS_AT (564..862): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 224.5
inactive: 114.6
Methoxymalonyl-CoA: 55.0
Methylmalonyl-CoA: 44.1
Propionyl-CoA: 30.5
Isobutyryl-CoA: 28.3
Acetyl-CoA: 24.3
Benzoyl-CoA: 18.4
Ethylmalonyl-CoA: 12.0
CHC-CoA: 11.2
fatty_acid: 7.6
2-Methylbutyryl-CoA: 6.7
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2036..2333): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 231.1
inactive: 117.3
Methoxymalonyl-CoA: 59.2
Methylmalonyl-CoA: 51.5
Propionyl-CoA: 31.7
Isobutyryl-CoA: 27.1
Ethylmalonyl-CoA: 25.2
Acetyl-CoA: 24.8
Benzoyl-CoA: 23.1
CHC-CoA: 13.8
fatty_acid: 12.5
2-Methylbutyryl-CoA: 12.1
trans-1,2-CPDA: 9.2
3-Methylbutyryl-CoA: 0.0

PKS_AT (4159..4460): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 205.7
inactive: 99.8
Methoxymalonyl-CoA: 64.5
Methylmalonyl-CoA: 40.9
Isobutyryl-CoA: 33.3
Propionyl-CoA: 32.6
Benzoyl-CoA: 24.6
Ethylmalonyl-CoA: 22.4
Acetyl-CoA: 20.7
2-Methylbutyryl-CoA: 14.7
fatty_acid: 12.6
CHC-CoA: 4.7
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

CPH93_RS36590: mal - mal - mal - mmal - mal

PKS_AT (572..868): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 225.7
inactive: 118.6
Methoxymalonyl-CoA: 58.0
Methylmalonyl-CoA: 48.0
Propionyl-CoA: 31.4
Isobutyryl-CoA: 29.4
Acetyl-CoA: 22.3
Benzoyl-CoA: 21.4
Ethylmalonyl-CoA: 21.1
2-Methylbutyryl-CoA: 11.4
CHC-CoA: 10.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2095..2386): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 228.4
inactive: 115.0
Methoxymalonyl-CoA: 58.9
Methylmalonyl-CoA: 47.3
Propionyl-CoA: 39.1
Isobutyryl-CoA: 23.6
Acetyl-CoA: 21.1
Benzoyl-CoA: 17.7
Ethylmalonyl-CoA: 15.1
CHC-CoA: 12.4
2-Methylbutyryl-CoA: 10.8
fatty_acid: 9.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3554..3850): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 235.0
inactive: 128.3
Methoxymalonyl-CoA: 62.8
Methylmalonyl-CoA: 55.5
Propionyl-CoA: 39.3
Isobutyryl-CoA: 31.9
Benzoyl-CoA: 25.3
Acetyl-CoA: 24.4
Ethylmalonyl-CoA: 20.3
CHC-CoA: 16.2
2-Methylbutyryl-CoA: 13.1
fatty_acid: 11.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (5262..5559): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 217.1
Ethylmalonyl-CoA: 209.0
2-Methylbutyryl-CoA: 174.1
Methoxymalonyl-CoA: 174.0
trans-1,2-CPDA: 150.3
Propionyl-CoA: 120.0
CHC-CoA: 99.7
Malonyl-CoA: 92.8
Isobutyryl-CoA: 77.3
Benzoyl-CoA: 55.7
Acetyl-CoA: 50.4
3-Methylbutyryl-CoA: 37.2
fatty_acid: 29.3
inactive: 20.1

PKS_AT (6834..7137): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 236.0
inactive: 130.8
Methoxymalonyl-CoA: 66.5
Methylmalonyl-CoA: 57.9
Isobutyryl-CoA: 37.6
Propionyl-CoA: 36.0
Benzoyl-CoA: 24.6
Acetyl-CoA: 22.2
Ethylmalonyl-CoA: 20.7
CHC-CoA: 15.9
2-Methylbutyryl-CoA: 14.6
fatty_acid: 13.2
trans-1,2-CPDA: 9.1
3-Methylbutyryl-CoA: 0.0

CPH93_RS01285: mal - mal - mal

PKS_AT (577..871): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.0
inactive: 113.9
Methoxymalonyl-CoA: 69.3
Methylmalonyl-CoA: 58.5
Propionyl-CoA: 35.6
Isobutyryl-CoA: 23.4
Acetyl-CoA: 23.0
Benzoyl-CoA: 17.5
fatty_acid: 14.5
Ethylmalonyl-CoA: 13.8
CHC-CoA: 12.8
2-Methylbutyryl-CoA: 10.4
trans-1,2-CPDA: 8.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (2121..2418): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 229.6
inactive: 124.1
Methoxymalonyl-CoA: 67.3
Methylmalonyl-CoA: 59.2
Propionyl-CoA: 40.7
Ethylmalonyl-CoA: 28.8
Acetyl-CoA: 28.1
Isobutyryl-CoA: 27.6
Benzoyl-CoA: 23.3
CHC-CoA: 18.5
fatty_acid: 15.1
2-Methylbutyryl-CoA: 12.6
trans-1,2-CPDA: 9.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (4191..4485): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 238.2
inactive: 120.5
Methoxymalonyl-CoA: 60.8
Methylmalonyl-CoA: 51.8
Propionyl-CoA: 30.2
Isobutyryl-CoA: 24.3
Acetyl-CoA: 22.2
Benzoyl-CoA: 17.3
Ethylmalonyl-CoA: 15.6
CHC-CoA: 11.6
2-Methylbutyryl-CoA: 8.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

CPH93_RS01290: mal - mal

PKS_AT (585..881): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.6
inactive: 108.8
Methoxymalonyl-CoA: 64.7
Methylmalonyl-CoA: 59.6
Propionyl-CoA: 37.3
2-Methylbutyryl-CoA: 31.5
Isobutyryl-CoA: 30.1
Ethylmalonyl-CoA: 29.3
Benzoyl-CoA: 26.6
Acetyl-CoA: 21.4
fatty_acid: 17.3
CHC-CoA: 16.9
trans-1,2-CPDA: 14.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (2356..2649): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.0
inactive: 113.5
Methoxymalonyl-CoA: 63.2
Methylmalonyl-CoA: 43.1
Propionyl-CoA: 35.3
Isobutyryl-CoA: 22.7
Acetyl-CoA: 20.7
Ethylmalonyl-CoA: 11.1
Benzoyl-CoA: 8.7
2-Methylbutyryl-CoA: 7.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

CPH93_RS01315: pk - mmal - mal

PKS_AT (574..870): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 233.4
Methylmalonyl-CoA: 233.2
Methoxymalonyl-CoA: 189.8
2-Methylbutyryl-CoA: 164.7
trans-1,2-CPDA: 154.9
CHC-CoA: 123.2
Propionyl-CoA: 118.1
Malonyl-CoA: 112.5
Isobutyryl-CoA: 82.8
Benzoyl-CoA: 73.7
Acetyl-CoA: 53.2
3-Methylbutyryl-CoA: 44.0
fatty_acid: 34.8
inactive: 27.8

PKS_AT (2126..2423): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 231.5
Ethylmalonyl-CoA: 231.0
Methoxymalonyl-CoA: 187.0
2-Methylbutyryl-CoA: 162.6
trans-1,2-CPDA: 157.5
CHC-CoA: 120.8
Propionyl-CoA: 115.9
Malonyl-CoA: 109.2
Isobutyryl-CoA: 85.6
Benzoyl-CoA: 73.5
Acetyl-CoA: 52.8
3-Methylbutyryl-CoA: 44.1
fatty_acid: 34.4
inactive: 26.9

PKS_AT (3670..3964): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 233.0
inactive: 118.8
Methoxymalonyl-CoA: 66.8
Methylmalonyl-CoA: 55.7
Propionyl-CoA: 38.0
2-Methylbutyryl-CoA: 26.2
Isobutyryl-CoA: 23.0
Ethylmalonyl-CoA: 22.5
Acetyl-CoA: 19.0
fatty_acid: 18.4
Benzoyl-CoA: 15.9
CHC-CoA: 9.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

CPH93_RS01320: mmal - mmal - mmal

PKS_AT (551..848): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 218.4
Ethylmalonyl-CoA: 215.7
Methoxymalonyl-CoA: 172.2
2-Methylbutyryl-CoA: 159.4
trans-1,2-CPDA: 134.9
Propionyl-CoA: 117.2
CHC-CoA: 111.5
Malonyl-CoA: 107.7
Isobutyryl-CoA: 64.7
Benzoyl-CoA: 55.2
Acetyl-CoA: 51.2
fatty_acid: 24.4
inactive: 23.8
3-Methylbutyryl-CoA: 15.4

PKS_AT (1577..1874): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 229.2
Ethylmalonyl-CoA: 225.3
Methoxymalonyl-CoA: 185.5
2-Methylbutyryl-CoA: 158.9
trans-1,2-CPDA: 146.6
CHC-CoA: 119.2
Malonyl-CoA: 111.3
Propionyl-CoA: 110.1
Isobutyryl-CoA: 78.7
Benzoyl-CoA: 70.2
Acetyl-CoA: 55.9
3-Methylbutyryl-CoA: 30.5
fatty_acid: 29.4
inactive: 27.1

PKS_AT (3156..3453): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 231.3
Ethylmalonyl-CoA: 230.0
Methoxymalonyl-CoA: 185.5
2-Methylbutyryl-CoA: 163.7
trans-1,2-CPDA: 138.8
CHC-CoA: 121.3
Malonyl-CoA: 113.3
Propionyl-CoA: 113.1
Isobutyryl-CoA: 81.7
Benzoyl-CoA: 68.1
Acetyl-CoA: 57.6
fatty_acid: 38.2
3-Methylbutyryl-CoA: 31.0
inactive: 24.0

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DmdR1	Iron(II)-dependent repressor
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT907981.1 - Region 3 - terpene

Download region SVG

Location: 502,303 - 527,185 nt. (total: 24,883 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CPH93_RS01675: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

CPH93_RS01735: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: esterase

CPH93_RS01755: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: synthase

CPH93_RS01740: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002725.3	0.74	ribosomal	prunipeptin	Streptomyces prunicolor NBRC 13075
BGC0000664.5	0.67	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.62	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.58	terpene	carotenoid	Streptomyces avermitilis
BGC0001456.3	0.58	terpene	isorenieratene	Streptomyces argillaceus
BGC0001227.3	0.58	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000650.3	0.48	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000645.3	0.48	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000648.3	0.47	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.47	terpene	β-carotein	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002725.3	0.74	ribosomal	prunipeptin	Streptomyces prunicolor NBRC 13075
BGC0000664.5	0.67	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.62	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.58	terpene	carotenoid	Streptomyces avermitilis
BGC0001456.3	0.58	terpene	isorenieratene	Streptomyces argillaceus
BGC0001227.3	0.58	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000650.3	0.48	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000645.3	0.48	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000648.3	0.47	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.47	terpene	β-carotein	uncultured bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

CPH93_RS01715: Lycopene_cycl

Domain 1 (5 - 382): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

CPH93_RS01730: PT_phytoene_like

Domain 1 (16 - 315): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.13 out of 18.57

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (13):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.18 out of 27.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.68 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.83 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.45 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.63 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.12 out of 30.98

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 25.23 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 26.30 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.07 out of 32.38

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT907981.1 - Region 4 - NRPS,NRPS-like,other

Download region SVG

Location: 538,417 - 596,077 nt. (total: 57,661 nt) Show pHMM detection rules used

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CPH93_RS01975: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CPH93_RS01990: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CPH93_RS02020: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acetyltransferase acyltransferase glycosyltransferase methyltransferase

CPH93_RS01835: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

CPH93_RS01840: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

CPH93_RS01845: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

CPH93_RS01925: methyltransferase

smcogs: SMCOG1089: methyltransferase

CPH93_RS01965: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Lyases: dehydratase

CPH93_RS01825: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

CPH93_RS01830: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

CPH93_RS01945: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CPH93_RS01950: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CPH93_RS01955: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CPH93_RS01960: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002051.2	1.75	NRPS	antipain	Streptomyces sp.
BGC0001249.5	1.25	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	1.14	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	1.10	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	1.09	NRPS	enniatin	Fusarium equiseti
BGC0001570.5	1.07	NRPS	deimino-antipain	Streptomyces albulus
BGC0002135.2	1.05	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	1.01	NRPS	peramine	Epichloe festucae
BGC0002286.3	1.00	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.00	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002051.2	0.83	NRPS	antipain	Streptomyces sp.
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001570.5	0.69	NRPS	deimino-antipain	Streptomyces albulus
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.66 out of 30.12

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (19):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.04 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.40 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.07 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.82 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.06 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.28 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.94 out of 27.04

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.32 out of 27.04

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.91 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.85 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.27 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.99 out of 39.62

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.37 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.21 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.19 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.91 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 538416 - 596077:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (Phe) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 549054 - 592243:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (Phe) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 554160 - 596077:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (Phe) + (Val)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CPH93_RS01950: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (468..857): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HGAAFDVALEEPNLVLGGELNVYGVTEAAISSTV
Nearest Stachelhaus code(s):: Arg DVENVGVISK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

CPH93_RS01955: Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (39..444): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MWYIFDPHLMEAVAMVGGDHNAYGPAEATVASTV
Nearest Stachelhaus code(s):: Phe DPLVMGAVIK (82% 8Å match)
Stachelhaus code match:: 80% (moderate)

CPH93_RS01960: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (53..442): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPSFDASTFEGFFIVGGEVNGYGPTEAATFTTA
Nearest Stachelhaus code(s):: Val DAFFIGGTFK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT907981.1 - Region 5 - butyrolactone

Download region SVG

Location: 665,690 - 676,670 nt. (total: 10,981 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CPH93_RS02375: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.79	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000908.3	0.41	other (other)	melanin	Streptomyces avermitilis
BGC0002313.3	0.39	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0001928.2	0.36	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001906.2	0.34	PKS	2-acetyl-1,3,6,8-tetrahydroxynaphthalene, 1,3,6,8-tetrahydroxynaphthalene	Daldinia eschscholzii IFB-TL01
BGC0002462.3	0.31	saccharide	coformycin	Streptomyces kaniharaensis
BGC0002719.2	0.30	NRPS	thanafactin A	Pseudomonas fluorescens
BGC0000384.6	0.30	NRPS	lyngbyatoxin	Lyngbya majuscula

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.79	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000908.3	0.41	other (other)	melanin	Streptomyces avermitilis
BGC0002313.3	0.39	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0001928.2	0.36	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001906.2	0.34	PKS	2-acetyl-1,3,6,8-tetrahydroxynaphthalene, 1,3,6,8-tetrahydroxynaphthalene	Daldinia eschscholzii IFB-TL01
BGC0002462.3	0.31	saccharide	coformycin	Streptomyces kaniharaensis
BGC0002719.2	0.30	NRPS	thanafactin A	Pseudomonas fluorescens
BGC0000384.6	0.30	NRPS	lyngbyatoxin	Lyngbya majuscula

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.36 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.30 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LT907981.1 - Region 6 - T1PKS,t3nrps-iterative

Download region SVG

Location: 723,328 - 828,632 nt. (total: 105,305 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CPH93_RS02675: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CPH93_RS02730: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase acylase glycosyltransferase transferase

CPH93_RS02670: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

CPH93_RS02700: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CPH93_RS02715: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CPH93_RS02740: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CPH93_RS02820: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

CPH93_RS02865: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

Hydrolases: esterase hydrolase

CPH93_RS02725: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

CPH93_RS02810: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: decarboxylase

CPH93_RS02760: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

CPH93_RS02705: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CPH93_RS02710: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CPH93_RS02720: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CPH93_RS02750: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CPH93_RS02755: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CPH93_RS02780: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CPH93_RS37190: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: permease

CPH93_RS02830: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.85	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.85	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.85	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.83	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000107.3	0.59	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.25 out of 18.46

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.59 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (8):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.69 out of 36.54

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.26 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.09 out of 29.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.42 out of 39.62

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.06 out of 29.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.79 out of 30.22

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.67 out of 32.74

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.83 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 723327 - 828632:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal) + (pk - ccmal) + (ccmal) + (ohmal) + (ccmal - ccmal - ccmal) + (mal)
Non-colinear ordering:: CPH93_RS37190 + CPH93_RS02780 + CPH93_RS02720 + CPH93_RS02715 + CPH93_RS02710 + CPH93_RS02705

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CPH93_RS02705: mal

PKS_AT (610..935): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 210.0
inactive: 110.2
Methoxymalonyl-CoA: 62.1
Methylmalonyl-CoA: 54.2
Propionyl-CoA: 46.1
Isobutyryl-CoA: 24.8
2-Methylbutyryl-CoA: 20.8
Acetyl-CoA: 15.5
CHC-CoA: 14.1
Benzoyl-CoA: 12.5
fatty_acid: 12.2
trans-1,2-CPDA: 9.9
Ethylmalonyl-CoA: 9.0
3-Methylbutyryl-CoA: 8.4

CPH93_RS02710: mal - mal - mal

PKS_AT (574..874): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.2
inactive: 119.1
Methoxymalonyl-CoA: 58.7
Methylmalonyl-CoA: 54.9
Propionyl-CoA: 47.3
2-Methylbutyryl-CoA: 20.2
Isobutyryl-CoA: 18.3
Acetyl-CoA: 15.3
fatty_acid: 12.3
CHC-CoA: 11.4
Benzoyl-CoA: 11.4
Ethylmalonyl-CoA: 6.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2331..2648): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 227.1
inactive: 109.7
Methoxymalonyl-CoA: 70.4
Methylmalonyl-CoA: 66.3
Propionyl-CoA: 42.0
Isobutyryl-CoA: 28.3
2-Methylbutyryl-CoA: 23.4
CHC-CoA: 20.1
Benzoyl-CoA: 20.0
Ethylmalonyl-CoA: 19.9
Acetyl-CoA: 18.8
trans-1,2-CPDA: 14.8
fatty_acid: 13.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (4129..4428): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 204.3
inactive: 115.7
Methoxymalonyl-CoA: 57.8
Methylmalonyl-CoA: 49.7
Propionyl-CoA: 42.1
Isobutyryl-CoA: 18.3
Acetyl-CoA: 15.1
Benzoyl-CoA: 13.3
2-Methylbutyryl-CoA: 12.4
CHC-CoA: 9.1
fatty_acid: 7.7
Ethylmalonyl-CoA: 5.5
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

CPH93_RS02715: mal

PKS_AT (586..897): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 223.6
inactive: 96.9
Methoxymalonyl-CoA: 66.4
Methylmalonyl-CoA: 56.8
Propionyl-CoA: 33.8
Ethylmalonyl-CoA: 31.1
Isobutyryl-CoA: 27.5
Benzoyl-CoA: 21.0
2-Methylbutyryl-CoA: 18.6
Acetyl-CoA: 15.0
CHC-CoA: 14.7
fatty_acid: 11.9
trans-1,2-CPDA: 7.9
3-Methylbutyryl-CoA: 0.0

CPH93_RS02720: mal

PKS_AT (563..862): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.4
inactive: 125.2
Methoxymalonyl-CoA: 60.1
Methylmalonyl-CoA: 52.6
Propionyl-CoA: 45.2
Isobutyryl-CoA: 21.5
2-Methylbutyryl-CoA: 20.4
Acetyl-CoA: 15.0
CHC-CoA: 12.0
fatty_acid: 11.7
Benzoyl-CoA: 10.7
trans-1,2-CPDA: 4.8
Ethylmalonyl-CoA: 4.1
3-Methylbutyryl-CoA: 0.0

CPH93_RS02740: pk

PKS_AT (38..280): pk

ATSignature: (unknown)

No matches above 50%

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

CPH93_RS02750: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (18..435): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YLQFFDCAMFDCFAFFAGEENLYGPTELTITIAA
Nearest Stachelhaus code(s):: Ala DCFFFALITK (91% 8Å match); bMe-Asp DCFFFALITK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

CPH93_RS02755: X

AMP-binding (14..412): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ASMFWDYGLYKMPITNTGAVRQFGQTECKRVSIM
Nearest Stachelhaus code(s):: 3S-Abu DYYPTTQRIK (79% 8Å match); Asp DYYPTTMRVK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

CPH93_RS37190: mal - mal

PKS_AT (687..986): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.6
inactive: 124.5
Methoxymalonyl-CoA: 63.0
Methylmalonyl-CoA: 53.4
Propionyl-CoA: 44.1
Isobutyryl-CoA: 23.8
2-Methylbutyryl-CoA: 18.2
Acetyl-CoA: 14.9
CHC-CoA: 13.1
Benzoyl-CoA: 12.0
Ethylmalonyl-CoA: 9.6
fatty_acid: 8.3
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2450..2750): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.3
inactive: 119.6
Methoxymalonyl-CoA: 58.1
Methylmalonyl-CoA: 54.8
Propionyl-CoA: 42.0
2-Methylbutyryl-CoA: 25.2
Isobutyryl-CoA: 24.8
Acetyl-CoA: 15.1
Benzoyl-CoA: 13.7
fatty_acid: 12.6
CHC-CoA: 9.4
trans-1,2-CPDA: 6.1
Ethylmalonyl-CoA: 3.5
3-Methylbutyryl-CoA: 0.0

CPH93_RS02780: pk - mal

PKS_AT (577..875): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 232.0
Methylmalonyl-CoA: 225.3
Methoxymalonyl-CoA: 189.5
2-Methylbutyryl-CoA: 169.4
trans-1,2-CPDA: 151.7
Propionyl-CoA: 118.7
CHC-CoA: 116.5
Malonyl-CoA: 108.4
Isobutyryl-CoA: 85.6
Benzoyl-CoA: 67.6
Acetyl-CoA: 53.4
3-Methylbutyryl-CoA: 51.0
fatty_acid: 35.1
inactive: 33.8

PKS_AT (2361..2661): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.8
inactive: 117.3
Methoxymalonyl-CoA: 57.3
Methylmalonyl-CoA: 54.3
Propionyl-CoA: 44.9
2-Methylbutyryl-CoA: 28.4
Isobutyryl-CoA: 20.2
fatty_acid: 12.8
Acetyl-CoA: 12.8
Benzoyl-CoA: 12.7
CHC-CoA: 9.5
trans-1,2-CPDA: 8.5
3-Methylbutyryl-CoA: 6.3
Ethylmalonyl-CoA: 3.2

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
RpoN	Regulator of nitrogen assimilation and virulence
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT907981.1 - Region 7 - butyrolactone

Download region SVG

Location: 957,922 - 968,842 nt. (total: 10,921 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

CPH93_RS03510: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.76	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.76	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.54	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.44	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000914.5	0.33	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0002571.2	0.31	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0000874.5	0.30	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0002657.2	0.26	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0001771.4	0.25	NRPS	scleric acid	Streptomyces sclerotialus
BGC0001967.4	0.25	NRPS, PKS	acyldepsipeptide 1	Streptomyces hawaiiensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.76	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.76	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.54	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.44	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000914.5	0.33	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0002571.2	0.31	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0000874.5	0.30	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0002657.2	0.26	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0001771.4	0.25	NRPS	scleric acid	Streptomyces sclerotialus
BGC0001967.4	0.25	NRPS, PKS	acyldepsipeptide 1	Streptomyces hawaiiensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.99 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.74 out of 29.65

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.18 out of 25.75

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LT907981.1 - Region 8 - T3PKS

Download region SVG

Location: 1,060,809 - 1,101,993 nt. (total: 41,185 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CPH93_RS04015: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

Hydrolases: glucosidase

CPH93_RS04195: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Ligases: synthase

CPH93_RS04110: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001454.5	0.89	other (other)	germicidin	Streptomyces argillaceus
BGC0001810.3	0.45	PKS	trehangelin	Polymorphospora rubra
BGC0000484.5	0.43	ribosomal	glycocin F	Lactobacillus plantarum
BGC0001483.4	0.42	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001387.5	0.42	other (other)	nucleocidin	Streptomyces calvus
BGC0000501.3	0.42	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001197.5	0.41	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001454.5	0.89	other (other)	germicidin	Streptomyces argillaceus
BGC0001810.3	0.45	PKS	trehangelin	Polymorphospora rubra
BGC0000484.5	0.43	ribosomal	glycocin F	Lactobacillus plantarum
BGC0001483.4	0.42	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001387.5	0.42	other (other)	nucleocidin	Streptomyces calvus
BGC0000501.3	0.42	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001197.5	0.41	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.80 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

Additional weak hits (13):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.77 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.64 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.32 out of 29.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.75 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.80 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.23 out of 36.54

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.81 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.98 out of 21.55

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.42 out of 29.65

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator

NZ_LT907981.1 - Region 9 - T1PKS,hglE-KS

Download region SVG

Location: 1,132,520 - 1,184,439 nt. (total: 51,920 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CPH93_RS04435: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CPH93_RS04440: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CPH93_RS04445: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: glycosyltransferase halogenase kinase

CPH93_RS04320: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

CPH93_RS04380: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CPH93_RS04405: halogenase

smcogs: SMCOG1119: halogenase

Hydrolases: hydrolase

CPH93_RS04385: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase

CPH93_RS04395: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CPH93_RS04400: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.56	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000041.3	0.54	PKS	oronofacic acid	Pseudomonas syringae
BGC0000056.3	0.36	PKS	esperamicin	Actinomadura verrucosospora

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000041.3	0.61	PKS	oronofacic acid	Pseudomonas syringae
BGC0000056.3	0.50	PKS	esperamicin	Actinomadura verrucosospora

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 25.31

Confidence: medium

Additional weak hits (13):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.60 out of 30.22

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.92 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.15 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.55 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.74 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.96 out of 32.74

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.61 out of 29.65

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.71 out of 29.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.52 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.50 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 15, location 1132519 - 1184439:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal)
Non-colinear ordering:: CPH93_RS04395 + CPH93_RS04390

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CPH93_RS04395: mal

PKS_AT (644..856): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 7.9
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

CPH93_RS04400: mal

PKS_AT (1291..1580): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 54.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 85.3
Methoxymalonyl-CoA: 42.0
Propionyl-CoA: 36.0
Methylmalonyl-CoA: 35.1
Ethylmalonyl-CoA: 19.8
trans-1,2-CPDA: 16.3
inactive: 13.5
2-Methylbutyryl-CoA: 11.6
fatty_acid: 7.2
CHC-CoA: 3.1
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_LT907981.1 - Region 10 - terpene

Download region SVG

Location: 1,270,946 - 1,297,648 nt. (total: 26,703 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CPH93_RS04960: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

CPH93_RS04895: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

CPH93_RS04965: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Ligases: synthase synthetase

CPH93_RS04900: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

CPH93_RS04920: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.71	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0001361.3	0.50	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.50	terpene	sodorifen	Serratia plymuthica
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.71	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0001361.3	0.50	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.50	terpene	sodorifen	Serratia plymuthica
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

CPH93_RS04915: T2TS

Domain 1 (29 - 662): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

CPH93_RS04920: PT_FPPS_like

Domain 1 (58 - 352): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

CPH93_RS04930: PT_phytoene_like

Domain 1 (17 - 300): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

CPH93_RS04935: PT_phytoene_like

Domain 1 (6 - 286): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (8):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.42 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.55 out of 26.12

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.98 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.82 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.21 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_LT907981.1 - Region 11 - NI-siderophore

Download region SVG

Location: 1,579,898 - 1,611,251 nt. (total: 31,354 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

CPH93_RS06215: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

CPH93_RS06315: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Lyases: decarboxylase

CPH93_RS06280: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.62	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000947.5	0.51	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000944.5	0.51	other (non-nrp siderophore)	staphyloferrin A	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0000942.4	0.47	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001972.4	0.44	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000943.5	0.43	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002471.3	0.43	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0001701.4	0.38	ribosomal	nisin O	Blautia obeum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.62	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000947.5	0.51	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000944.5	0.51	other (non-nrp siderophore)	staphyloferrin A	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0000942.4	0.47	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001972.4	0.44	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000943.5	0.43	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002471.3	0.43	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0001701.4	0.38	ribosomal	nisin O	Blautia obeum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.48 out of 20.97

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 25.31

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.93 out of 30.25

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.38 out of 23.79

Confidence: medium

Additional weak hits (10):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.09 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.33 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.95 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.12 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.30 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.55 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.81 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.06 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
ColR	Phenol-responsive regulator
IolR	Regulator of the inositol catabolism

NZ_LT907981.1 - Region 12 - T2PKS,lassopeptide

Download region SVG

Location: 1,656,398 - 1,728,931 nt. (total: 72,534 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

CPH93_RS06535: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CPH93_RS06550: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

CPH93_RS06670: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CPH93_RS06710: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CPH93_RS06730: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CPH93_RS06790: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CPH93_RS06800: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CPH93_RS06810: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CPH93_RS06825: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

CPH93_RS06835: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

CPH93_RS06845: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CPH93_RS06860: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase halogenase methyltransferase

CPH93_RS06795: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

CPH93_RS06805: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

CPH93_RS06815: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

CPH93_RS06830: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

CPH93_RS06850: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
MITE: MITE0000024Halogenation (identity: 70.70%)
smcogs: SMCOG1119: halogenase

CPH93_RS06865: methyltransferase

smcogs: SMCOG1089: methyltransferase

CPH93_RS37225: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: back translocase glucosidase hydrolase

CPH93_RS06590: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

CPH93_RS06615: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

CPH93_RS06720: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

CPH93_RS06750: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: cyclase dehydratase

CPH93_RS06520: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

CPH93_RS06680: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

CPH93_RS06705: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Ligases: synthase

CPH93_RS06690: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CPH93_RS06695: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

CPH93_RS06630: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000242.5	0.76	PKS	lysolipin I	Streptomyces tendae
BGC0000234.5	0.61	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000231.5	0.60	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.56	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000275.4	0.55	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001723.5	0.53	PKS	oviedomycin	Streptomyces antibioticus
BGC0001513.3	0.51	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000217.5	0.48	PKS	daunorubicin	Streptomyces sp.
BGC0002608.2	0.47	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0000215.5	0.47	PKS	curamycin	Streptomyces cyaneus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002608.2	0.77	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0000242.5	0.77	PKS	lysolipin I	Streptomyces tendae
BGC0000234.5	0.64	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000231.5	0.64	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0002285.2	0.62	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001197.5	0.61	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001513.3	0.58	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001723.5	0.58	PKS	oviedomycin	Streptomyces antibioticus
BGC0001512.5	0.58	PKS	BE-24566B	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

Lasso peptide predictions

Lassopeptide(s) for CPH93_RS35700

CPH93_RS35700

Leader:

MEQTTKPVYSAPVVLDAGDVAEVTL

Full core:

GTNNFDTADDTQYKNA

Putative macrolactam:

GTNNFDTAD

antiSMASH-DB 4.0 matches for CPH93_RS35700

100.0%

NZ_AP019620.1and 8 others:

NZ_CP019458.1 Lassopeptides: BV401_RS42770_lassopeptideNZ_CP029823.1 Lassopeptides: DNK48_RS31710_lassopeptideNZ_CP054916.1 Lassopeptides: HUT19_RS28470_lassopeptideNZ_CP084681.1 Lassopeptides: KI385_RS02505_lassopeptideNZ_JANCLX010000011.1 Lassopeptides: NMK44_RS19060_lassopeptideNZ_LT907981.1 Lassopeptides: CPH93_RS35700_lassopeptideNZ_NNBP01000024.1 Lassopeptides: CG747_RS46950_lassopeptideNZ_VSKT01000018.1 Lassopeptides: allorf_84246_84536_lassopeptide

Lassopeptides: GYK45_RS31700_lassopeptide

1

GTNNFDTADDTQYKNA

16

GTNNFDTADDTQYKNA

1

GTNNFDTADDTQYKNA

16

93.8%

NZ_CP045178.1and 1 other:

NZ_NDXL01000001.1 Lassopeptides: B7024_RS40605_lassopeptide

Lassopeptides: GBW32_RS37240_lassopeptide

1

GTNNFDTADDTQYKNA

16

GTNNFDTADDT+YKNA

1

GTNNFDTADDTEYKNA

16

93.8%

NZ_CP058556.1and 1 other:

NZ_NDXL01000001.1 Lassopeptides: B7024_RS41330_lassopeptide

Lassopeptides: HXS80_RS05610_lassopeptide

1

GTNNFDTADDTQYKNA

16

GT NFDTADDTQYKNA

1

GTQNFDTADDTQYKNA

16

with 17 more sequence matches

Only the first 10 are displayed here.

93.8%

NZ_VEHK01000011.1:

Lassopeptides: FS984_RS26875_lassopeptide

1

GTNNFDTADDTQYKNA

16

GT NFDTADDTQYKNA

1

GTENFDTADDTQYKNA

16

87.5%

NZ_CP118575.1:

Lassopeptides: PV796_RS40100_lassopeptide

1

GTNNFDTADDTQYKNA

16

GTNNFD ADDT+YKNA

1

GTNNFDHADDTEYKNA

16

87.5%

NZ_LWLE01000015.1:

Lassopeptides: A6A29_RS44175_lassopeptide

1

GTNNFDTADDTQYKNA

16

GT FDTADDTQYKNA

1

GTQTFDTADDTQYKNA

16

87.5%

NZ_SMSN01000051.1:

Lassopeptides: E2C11_RS23985_lassopeptide

1

GTNNFDTADDTQYKNA

16

GTN FDTADDT+YKNA

1

GTNTFDTADDTEYKNA

16

87.5%

NZ_VEHK01000001.1:

Lassopeptides: FS984_RS39240_lassopeptide

1

GTNNFDTADDTQYKNA

16

GTN+FDTADDT+YKNA

1

GTNSFDTADDTEYKNA

16

81.2%

NZ_CP042266.1:

Lassopeptides: FQU76_RS10490_lassopeptide

1

GTNNFDTADDTQYKNA

16

GT FDTADDT+YKNA

1

GTETFDTADDTEYKNA

16

75.0%

NZ_CP031455.1:

Lassopeptides: allorf_0788132_0788335_lassopeptide

1

GTNNFDTADDTQYKN

15

GTN FDTADDT+YK+

1

GTNTFDTADDTEYKD

15

75.0%

NZ_JABBGE010000005.1:

Lassopeptides: HHL19_RS16445_lassopeptide

1

GTNNFDTADDTQYKN

15

GT +FDTADDTQYK+

1

GTQSFDTADDTQYKH

15

68.8%

NZ_BMNG01000026.1and 1 other:

NZ_LT907981.1 Lassopeptides: CPH93_RS35415_lassopeptide

Lassopeptides: IEY91_RS39205_lassopeptide

1

GTNNFDTADDTQYKN

15

GT FDTADDT+YK+

1

GTQPFDTADDTEYKH

15

64.7%

NZ_BMUT01000019.1and 2 others:

NZ_JACHJF010000007.1 Lassopeptides: FHS36_RS14205_lassopeptideNZ_WPBY01000022.1 Lassopeptides: GO001_RS23565_lassopeptide

Lassopeptides: IE241_RS30965_lassopeptide

1

GTNNFDTADDTQYKNA

16

G NFDT DDTQYK

1

GNQNFDTVDDTQYKQG

16

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

Additional weak hits (13):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.76 out of 32.74

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.26 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.90 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.75 out of 36.54

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.74 out of 30.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.04 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.99 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.90 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.99 out of 27.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.44 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.41 out of 35.63

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

RREFinder

Type II PKS

TFBS Finder

Core peptide predictions

CPH93_RS35700 - Class II: Cleavage pHMM score: 1.40; RODEO score: 21; Monoisotopic mass: 1755.7 Da; Molecular weight: 1756.7 Da; Number of bridges: 0

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 83; Score: 49.0

Type II PKS gene cluster prediction details

Cluster section:: 1656397 to 1728931
Starter unit(s):: malonamyl-CoA (Score: 979.0; E-value: 0)
Malonyl elongations:: 11|12 (Score: 684.5; E-value: 9.1e-209)
Product class(es):: pentangular polyphenol
Product molecular weight(s):: malonamyl-CoA_11: 831 Da
malonamyl-CoA_12: 873 Da

CPH93_RS06655: OXY (Score: 22.6; E-value: 1.1e-07)
CPH93_RS06670: KR C19 (Score: 420.9; E-value: 3.7e-129)
CPH93_RS06680: CYC C9-C14 (Score: 230.2; E-value: 1.8e-71)
CPH93_RS06685: ACP (Score: 97.9; E-value: 6.1e-31)
CPH93_RS06690: CLF 11|12 (Score: 684.5; E-value: 9.1e-209)
CPH93_RS06695: KS (Score: 746.4; E-value: 1.8e-227)
CPH93_RS06700: CYC C5-C18 (Score: 216.2; E-value: 2.8e-67)
CPH93_RS06705: CYC C4-C21/C2-C23|C2-C19 (Score: 174.8; E-value: 9.2e-55)
CPH93_RS06710: KR (Score: 114.2; E-value: 1.9e-35)
CPH93_RS06720: AMID (Score: 1024.2; E-value: 0.0); AMID CAM34350.1_Lysolipin_malonamyl-CoA (Score: 979.0; E-value: 0.0)
CPH93_RS06775: OXY (Score: 45.6; E-value: 1.1e-14)
CPH93_RS06795: MET C11O (Score: 492.0; E-value: 1.8e-150)
CPH93_RS06805: MET C13O|C17O (Score: 482.2; E-value: 1.6e-147)
CPH93_RS06810: OXY (Score: 327.6; E-value: 3.4e-100)
CPH93_RS06815: MET C13O|C17O (Score: 475.5; E-value: 1.8e-145)
CPH93_RS06830: MET C13O|C17O (Score: 440.9; E-value: 5.6e-135)
CPH93_RS06845: KR C11 (Score: 431.0; E-value: 2.9e-132)
CPH93_RS06850: HAL (Score: 666.4; E-value: 4.7e-203)
CPH93_RS06860: KR (Score: 173.8; E-value: 1.2e-53)
CPH93_RS06865: MET (Score: 69.5; E-value: 6.3e-22)
CPH93_RS37225: GT (Score: 354.7; E-value: 1.9e-108)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT907981.1 - Region 13 - RiPP-like

Download region SVG

Location: 1,809,529 - 1,820,906 nt. (total: 11,378 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001267.3	0.29	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0002387.2	0.27	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002788.2	0.24	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001377.5	0.24	PKS	uncialamycin	Streptomyces uncialis
BGC0001060.5	0.22	PKS	dynemicin A	Micromonospora chersina
BGC0000221.5	0.21	PKS	erdacin	uncultured soil bacterium V167
BGC0001984.3	0.20	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0001293.5	0.20	PKS	cyclizidine	Streptomyces sp. NCIB 11649
BGC0000241.5	0.19	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.18	PKS	nenestatin	Micromonospora echinospora

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001267.3	0.29	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0002387.2	0.27	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002788.2	0.24	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001377.5	0.24	PKS	uncialamycin	Streptomyces uncialis
BGC0001060.5	0.22	PKS	dynemicin A	Micromonospora chersina
BGC0000221.5	0.21	PKS	erdacin	uncultured soil bacterium V167
BGC0001984.3	0.20	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0001293.5	0.20	PKS	cyclizidine	Streptomyces sp. NCIB 11649
BGC0000241.5	0.19	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.18	PKS	nenestatin	Micromonospora echinospora

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.77 out of 29.72

Confidence: medium

Additional weak hits (1):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.79 out of 30.97

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

NZ_LT907981.1 - Region 14 - butyrolactone

Download region SVG

Location: 1,880,308 - 1,891,285 nt. (total: 10,978 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CPH93_RS07500: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CPH93_RS07515: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Hydrolases: hydrolase

CPH93_RS07490: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: hydratase

CPH93_RS07520: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.68	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.63	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.44	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001302.5	0.37	other (other)	lomofungin	Streptomyces lomondensis
BGC0001726.4	0.36	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0000996.5	0.36	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001304.3	0.36	PKS	aflavarin	Aspergillus flavus NRRL3357
BGC0000999.4	0.36	NRPS, PKS	heat-stable antifungal factor	Lysobacter enzymogenes

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.68	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.63	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.44	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001302.5	0.37	other (other)	lomofungin	Streptomyces lomondensis
BGC0001726.4	0.36	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0000996.5	0.36	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001304.3	0.36	PKS	aflavarin	Aspergillus flavus NRRL3357
BGC0000999.4	0.36	NRPS, PKS	heat-stable antifungal factor	Lysobacter enzymogenes

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 20.97 out of 30.22

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.44 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_LT907981.1 - Region 15 - HR-T2PKS,lassopeptide

Download region SVG

Location: 1,891,724 - 1,933,922 nt. (total: 42,199 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CPH93_RS07615: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase aminotransferase carbamoyltransferase methyltransferase

CPH93_RS07535: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

CPH93_RS07655: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

CPH93_RS07690: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

CPH93_RS07695: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase

CPH93_RS07580: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Isomerases: isomerase

CPH93_RS07665: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

CPH93_RS07640: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CPH93_RS07660: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001550.3	1.26	ribosomal	citrulassin D	Streptomyces katrae
BGC0001552.3	1.21	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	1.18	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	1.07	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001548.4	0.94	ribosomal	citrulassin A	Streptomyces albulus
BGC0000575.5	0.56	ribosomal	lariatin	Rhodococcus jostii
BGC0001889.2	0.54	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001655.3	0.53	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0001506.5	0.51	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001539.4	0.51	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001550.3	0.85	ribosomal	citrulassin D	Streptomyces katrae
BGC0001552.3	0.84	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.84	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.81	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001548.4	0.77	ribosomal	citrulassin A	Streptomyces albulus
BGC0000575.5	0.61	ribosomal	lariatin	Rhodococcus jostii
BGC0001889.2	0.61	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001506.5	0.59	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001539.4	0.59	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001781.4	0.59	ribosomal	sphaericin	Planomonospora sphaerica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (7):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.59 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.30 out of 31.73

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.22 out of 25.88

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.26 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.41 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

NRPS/PKS substrates

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

NRPS/PKS substrate predictions

CPH93_RS07660: X

AMP-binding (48..384): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ERYLWGL-VGGHLGMTAGGSQCYGMTETGMITMD
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 83; Score: 78.4

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_LT907981.1 - Region 16 - crocagin

Download region SVG

Location: 1,939,493 - 1,967,807 nt. (total: 28,315 nt) Show pHMM detection rules used

crocagin: (PhyH and Carbam_trans_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: reductase

CPH93_RS07835: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Transferases: methyltransferase

CPH93_RS07815: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: ligase

CPH93_RS07875: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000820.5	0.48	other (other)	physostigmine	Streptomyces griseofuscus
BGC0001488.3	0.45	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0002659.2	0.45	ribosomal	TvgA-RiPP	Halomonas anticariensis FP35 = DSM 16096
BGC0000188.5	0.43	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000662.5	0.42	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000719.5	0.41	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0001050.5	0.40	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0000720.3	0.40	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0002071.2	0.40	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000820.5	0.48	other (other)	physostigmine	Streptomyces griseofuscus
BGC0001488.3	0.45	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0002659.2	0.45	ribosomal	TvgA-RiPP	Halomonas anticariensis FP35 = DSM 16096
BGC0000188.5	0.43	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000662.5	0.42	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000719.5	0.41	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0001050.5	0.40	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0000720.3	0.40	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0002071.2	0.40	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.56 out of 23.79

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.45 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.17 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.51 out of 24.78

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (6):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.21 out of 20.01

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.62 out of 18.57

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.70 out of 32.74

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.40 out of 26.12

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.47 out of 36.54

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.87 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
OsdR	Development and stress management regulator

NZ_LT907981.1 - Region 17 - NI-siderophore

Download region SVG

Location: 2,084,530 - 2,117,221 nt. (total: 32,692 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

CPH93_RS08365: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

CPH93_RS08410: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

CPH93_RS08355: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.55	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002470.2	0.51	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0001531.5	0.51	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.55	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002470.2	0.51	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0001531.5	0.51	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.40 out of 20.97

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.70 out of 29.51

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.60 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

Additional weak hits (9):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.68 out of 20.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.85 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.42 out of 27.18

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 23.43

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.06 out of 29.25

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.18 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
DosR	Hypoxia stress response regulator
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NZ_LT907981.1 - Region 18 - triceptide

Download region SVG

Location: 2,651,679 - 2,673,238 nt. (total: 21,560 nt) Show pHMM detection rules used

triceptide: ((cds(PF04055 and (TIGR04085 or SPASM)) and triceptide_precursor) or triceptide_rSAM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002316.2	0.39	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000043.5	0.37	PKS	curacin A	Moorea producens 19L
BGC0000515.4	0.33	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000506.4	0.32	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000556.5	0.32	ribosomal	streptin	Streptococcus pyogenes
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000536.3	0.31	ribosomal	nisin Q	Lactococcus lactis
BGC0000535.4	0.31	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0000559.4	0.31	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000537.3	0.31	ribosomal	nisin U	Streptococcus uberis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002316.2	0.39	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000043.5	0.37	PKS	curacin A	Moorea producens 19L
BGC0000515.4	0.33	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000506.4	0.32	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000556.5	0.32	ribosomal	streptin	Streptococcus pyogenes
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000536.3	0.31	ribosomal	nisin Q	Lactococcus lactis
BGC0000535.4	0.31	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0000559.4	0.31	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000537.3	0.31	ribosomal	nisin U	Streptococcus uberis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.13 out of 26.85

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.77 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.13 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.17 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LT907981.1 - Region 19 - linaridin

Download region SVG

Location: 3,549,767 - 3,570,658 nt. (total: 20,892 nt) Show pHMM detection rules used

linaridin: (cypemycin or cypI)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CPH93_RS14900: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

CPH93_RS14895: methyltransferase

smcogs: SMCOG1248: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001188.3	0.62	ribosomal	legonaridin	Streptomyces sp. CT34
BGC0002319.3	0.48	ribosomal	salinipeptin A, salinipeptin B, salinipeptin C, salinipeptin D	Streptomyces sp.
BGC0001735.5	0.47	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000582.4	0.47	ribosomal	cypemycin	Streptomyces sp. OH-4156
BGC0000583.5	0.44	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000571.3	0.42	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002312.2	0.42	ribosomal	ubonodin	Burkholderia ubonensis
BGC0001229.4	0.42	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001188.3	0.62	ribosomal	legonaridin	Streptomyces sp. CT34
BGC0002319.3	0.48	ribosomal	salinipeptin A, salinipeptin B, salinipeptin C, salinipeptin D	Streptomyces sp.
BGC0001735.5	0.47	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000582.4	0.47	ribosomal	cypemycin	Streptomyces sp. OH-4156
BGC0000583.5	0.44	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000571.3	0.42	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002312.2	0.42	ribosomal	ubonodin	Burkholderia ubonensis
BGC0001229.4	0.42	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

Additional weak hits (10):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.86 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.07 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.39 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.10 out of 23.43

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.63 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.33 out of 28.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.60 out of 30.98

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.60 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT907981.1 - Region 20 - lassopeptide

Download region SVG

Location: 3,637,117 - 3,659,735 nt. (total: 22,619 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

CPH93_RS15335: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001539.4	0.52	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001634.3	0.48	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001645.3	0.48	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0002318.2	0.44	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0000578.3	0.40	ribosomal	SRO15-2005	Streptomyces filamentosus NRRL 15998
BGC0000565.5	0.34	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001707.5	0.30	ribosomal	nosiheptide	Streptomyces sp.
BGC0000957.5	0.26	NRPS, PKS	mycotrienin I	Streptomyces sp. XZQH13
BGC0000806.5	0.25	saccharide	phosphonoglycans	Glycomyces sp. NRRL B-16210
BGC0000700.5	0.25	saccharide	istamycin	Streptomyces tenjimariensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001539.4	0.52	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001634.3	0.48	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001645.3	0.48	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0002318.2	0.44	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0000578.3	0.40	ribosomal	SRO15-2005	Streptomyces filamentosus NRRL 15998
BGC0000565.5	0.34	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001707.5	0.30	ribosomal	nosiheptide	Streptomyces sp.
BGC0000957.5	0.26	NRPS, PKS	mycotrienin I	Streptomyces sp. XZQH13
BGC0000806.5	0.25	saccharide	phosphonoglycans	Glycomyces sp. NRRL B-16210
BGC0000700.5	0.25	saccharide	istamycin	Streptomyces tenjimariensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.21 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.88 out of 20.97

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (5):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.31 out of 26.85

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.74 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.39 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.39 out of 28.19

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 83; Score: 41.1

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CcpA	Catabolite control protein A

NZ_LT907981.1 - Region 21 - lassopeptide

BGC0002289.2 (CQR60041.1):

Download region SVG

Location: 3,713,989 - 3,736,506 nt. (total: 22,518 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

CPH93_RS15665: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Translocases: permease

CPH93_RS15715: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002053.3	0.82	ribosomal	ulleungdin	Streptomyces sp.
BGC0002074.2	0.81	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001507.3	0.73	ribosomal	anantin C	Streptomyces olindensis
BGC0001307.3	0.65	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0001493.5	0.62	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001506.5	0.62	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001552.3	0.62	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002318.2	0.60	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0001539.4	0.60	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002053.3	0.82	ribosomal	ulleungdin	Streptomyces sp.
BGC0002074.2	0.81	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001507.3	0.73	ribosomal	anantin C	Streptomyces olindensis
BGC0001307.3	0.65	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0001493.5	0.62	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001506.5	0.62	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001552.3	0.62	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002318.2	0.60	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0001539.4	0.60	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for CPH93_RS35425

CPH93_RS35425

Leader:

MTEQSEQTPTEYIPPMLVEVGEFTEDTL

Full core:

GNWHGTSPDWFFNYYW

Putative macrolactam:

GNWHGTSPD

antiSMASH-DB 4.0 matches for CPH93_RS35425

100.0%

NZ_CP072931.1and 3 others:

NZ_CP082945.1 Lassopeptides: K7396_RS10945_lassopeptideNZ_CP104317.1 Lassopeptides: NW605_RS09530_lassopeptideNZ_LT907981.1 Lassopeptides: CPH93_RS35425_lassopeptide

Lassopeptides: SU9_RS18360_lassopeptide

1

GNWHGTSPDWFFNYYW

16

GNWHGTSPDWFFNYYW

1

GNWHGTSPDWFFNYYW

16

56.2%

NZ_FOAZ01000040.1and 1 other:

NZ_JADPRT010000002.1 Lassopeptides: I2501_RS04910_lassopeptide

Lassopeptides: BMY61_RS45675_lassopeptide

5

GTSPDWFFNYYW

16

GT PDWFFN W

4

GTVPDWFFNMNW

15

MIBiG 4.0 matches for CPH93_RS35425

16.7%

Lasso peptide: Leepeptin

9

DWFFNY

14

+W F+Y

11

NWHFDY

16

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.16 out of 20.97

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.05 out of 19.26

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.83 out of 26.06

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.08 out of 18.57

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

CPH93_RS35425 - Class II: Cleavage pHMM score: 4.50; RODEO score: 20; Monoisotopic mass: 2057.8 Da; Molecular weight: 2059.1 Da; Number of bridges: 0

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 0 - 81; Score: 85.8; RRE type: Lasso_Fused_RRE; Location: 0 - 59; Score: 29.9

TFBS definitions

Regulator	Description

NZ_LT907981.1 - Region 22 - terpene

Download region SVG

Location: 3,743,167 - 3,765,410 nt. (total: 22,244 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase methyltransferase

CPH93_RS15825: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

CPH93_RS15830: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: amidase

CPH93_RS15780: amidase

smcogs: SMCOG1105: amidase

Lyases: cyclase

CPH93_RS15800: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.83	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002382.3	0.42	ribosomal	grimoviridin	Grimontia marina
BGC0000842.5	0.42	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000905.5	0.40	other (other)	heme D1	Heliobacillus mobilis
BGC0000906.3	0.40	other (other)	heme D1	Heliophilum fasciatum
BGC0002633.2	0.39	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002683.2	0.38	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002535.2	0.37	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0001151.5	0.36	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0000720.3	0.36	saccharide	tobramycin	Streptoalloteichus tenebrarius

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.83	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002382.3	0.42	ribosomal	grimoviridin	Grimontia marina
BGC0000842.5	0.42	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000905.5	0.40	other (other)	heme D1	Heliobacillus mobilis
BGC0000906.3	0.40	other (other)	heme D1	Heliophilum fasciatum
BGC0002633.2	0.39	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002683.2	0.38	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002535.2	0.37	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0001151.5	0.36	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0000720.3	0.36	saccharide	tobramycin	Streptoalloteichus tenebrarius

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

CPH93_RS15800: T1TS + T1TS

Domain 1 (1 - 327): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (345 - 709): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.56 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.48 out of 24.78

Confidence: medium

Additional weak hits (6):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.18 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.24 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.99 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.02 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response

NZ_LT907981.1 - Region 23 - azole-containing-RiPP,terpene

BGC0002130.3 (QKI29070.1):

Download region SVG

Location: 4,171,898 - 4,220,142 nt. (total: 48,245 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CPH93_RS17850: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

CPH93_RS17910: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CPH93_RS17930: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CPH93_RS35450: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase

CPH93_RS17830: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: dehalogenase esterase hydrolase

CPH93_RS17805: putative esterase

smcogs: SMCOG1104: putative esterase

CPH93_RS17835: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

CPH93_RS17840: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: dehydratase

CPH93_RS17880: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

CPH93_RS17920: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Ligases: ligase

CPH93_RS17915: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000611.5	0.96	ribosomal	siomycin A	Streptomyces sioyaensis
BGC0000614.5	0.83	ribosomal	thiostrepton	Streptomyces laurentii
BGC0001474.4	0.53	ribosomal	thiopeptin	Streptomyces tateyamensis
BGC0001471.5	0.52	ribosomal	saalfelduracin	Amycolatopsis saalfeldensis
BGC0002584.2	0.35	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001896.4	0.33	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0000885.3	0.31	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001206.5	0.30	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000846.5	0.30	other (other)	tabtoxin	Pseudomonas syringae
BGC0001880.3	0.30	ribosomal	scytodecamide	Scytonema sp. UIC 10036

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000611.5	0.88	ribosomal	siomycin A	Streptomyces sioyaensis
BGC0000614.5	0.84	ribosomal	thiostrepton	Streptomyces laurentii
BGC0001474.4	0.69	ribosomal	thiopeptin	Streptomyces tateyamensis
BGC0001471.5	0.69	ribosomal	saalfelduracin	Amycolatopsis saalfeldensis
BGC0001145.5	0.54	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002584.2	0.54	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001472.5	0.53	ribosomal	berninamycin A	Streptomyces bernensis
BGC0000603.5	0.52	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0002311.3	0.52	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0001640.3	0.51	ribosomal	kocurin	Kocuria rosea

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

CPH93_RS17825: PT_phytoene_like

Domain 1 (18 - 258): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.81 out of 23.79

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.23 out of 29.72

Confidence: medium

Additional weak hits (11):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.71 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.12 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.94 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.80 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.46 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.65 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.58 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.01 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

(Thi)azol(in)e containing peptide predictions

(Thi)azol(in)e containing peptide(s)

CPH93_RS17865

Leader:

MSTAAIVGQEIGVEGLTGLDVDALEISEYMDETLLDGEDLSVTM

Core:

VSSASCTTCICTCSCSS

Core with dehydrations:

VDhaDhaADhaCysDhbDhbCysICysDhbCysDhaCysDhaDha

antiSMASH-DB 4.0 matches for CPH93_RS17865

100.0%

NZ_LT907981.1:

Thiopeptides: CPH93_RS17865_thiopeptide

1

VSSASCTTCICTCSCSS

17

VSSASCTTCICTCSCSS

1

VSSASCTTCICTCSCSS

17

70.6%

NZ_LT907981.1:

Thiopeptides: CPH93_RS17870_thiopeptide

2

SSASCTTCICTCSCSS

17

SS SCTTCIC+ CSS

1

SSVSCTTCICSGRCSS

16

47.1%

NZ_QQBC01000004.1:

Thiopeptides: DFR76_RS13815_thiopeptide

5

SCTTCICTCSC

15

SCT+C+C CSC

1

SCTSCVCICSC

11

with 10 more sequence matches

42.9%

NZ_CP036100.1and 1 other:

NZ_CP072062.1 Lanthipeptides: J5V93_RS29680_lanthipeptide

Lanthipeptides: EXW47_RS29590_lanthipeptide

1

VSSASCTT--CICTCSCSS

17

VS A C T CICT SCS+

8

VSRAVCKTGTCICTTSCSN

26

42.9%

NZ_MOOT01000054.1and 1 other:

NZ_MOOT01000054.1 Lanthipeptides: BK765_RS17680_lanthipeptide

Lanthipeptides: BK765_RS17685_lanthipeptide

1

VSSASCTT--CICTCSCSS

17

VS A C T CICT SCS+

8

VSKAVCKTGTCICTTSCSN

26

42.9%

NZ_QNRN01000010.1:

Lanthipeptides: DET63_RS17955_lanthipeptide

1

VSSASCTT--CICTCSCSS

17

VS A C T CICT SCS+

8

VSKAICKTGTCICTTSCSN

26

40.0%

NZ_CP023711.1and 11 others:

NZ_CP034141.1 Lanthipeptides: EGM68_RS25880_lanthipeptideNZ_CP040829.1 Lanthipeptides: FGY93_RS26165_lanthipeptideNZ_CP049598.1 Lanthipeptides: G7L40_RS03920_lanthipeptideNZ_CP071875.1 Lanthipeptides: J4I02_RS05145_lanthipeptideNZ_CP086373.1 Lanthipeptides: LMH85_RS04795_lanthipeptideNZ_CP092831.1 Lanthipeptides: MLD56_RS04795_lanthipeptideNZ_CP102865.1 Lanthipeptides: NWS42_RS17805_lanthipeptideNZ_JAFJXZ010000012.1 Lanthipeptides: JYU28_RS03620_lanthipeptideNZ_JAKVDC010000009.1 Lanthipeptides: MKN04_RS18550_lanthipeptideNZ_JWJJ01000002.1 Lanthipeptides: U707_RS25810_lanthipeptideNZ_POVT01000017.1 Lanthipeptides: C1T20_RS25545_lanthipeptide

Lanthipeptides: CPY53_RS19275_lanthipeptide

1

VSSASCTT--CICTCSCSS

17

VS A C T CICT SCS+

10

VSKAVCKTLTCICTGSCSN

28

39.3%

NZ_KB976165.1and 1 other:

NZ_MOOT01000054.1 Lanthipeptides: BK765_RS17675_lanthipeptide

Lanthipeptides: ICC_RS37095_lanthipeptide

1

VSSASCT--TCICTCSCSS

17

VS A C TC+CT SCS+

8

VSRAPCKSGTCLCTTSCSN

26

30.8%

NZ_CP036100.1and 5 others:

NZ_CP036100.1 Lanthipeptides: EXW47_RS29575_lanthipeptideNZ_CP036100.1 Lanthipeptides: EXW47_RS29570_lanthipeptideNZ_CP072062.1 Lanthipeptides: J5V93_RS29670_lanthipeptideNZ_CP072062.1 Lanthipeptides: J5V93_RS29665_lanthipeptideNZ_CP072062.1 Lanthipeptides: J5V93_RS29660_lanthipeptide

Lanthipeptides: EXW47_RS29580_lanthipeptide

8

TCICTCSCSS

17

TCICT SCS+

15

TCICTTSCSN

24

30.8%

NZ_KB976165.1and 1 other:

NZ_MOOT01000054.1 Lanthipeptides: BK765_RS17665_lanthipeptide

Lanthipeptides: ICC_RS25590_lanthipeptide

8

TCICTCSCSS

17

TCICT SCS+

15

TCICTISCSN

24

26.7%

NZ_CP034587.1:

Lanthipeptides: EKH77_RS16870_lanthipeptide

2

SSASCTTCICTCSC

15

S+A CTT +CT C

13

SAAGCTTSVCTQGC

26

26.7%

NZ_NDXL01000003.1:

Lanthipeptides: B7024_RS31125_lanthipeptide

1

VSSASCTTCICTCSC

15

V++A CTT +CT C

12

VTAAGCTTSVCTQGC

26

18.9%

NZ_KB913021.1:

Lanthipeptides: NATTI_RS0124330_lanthipeptide

1

VSSASCT-TCICTCSCS

16

+S A T TCICTC C+

34

ISEAKYTFTCICTCKCT

50

MIBiG 4.0 matches for CPH93_RS17865

21.7%

Lanthipeptide: cacaoidin

2

SSASCT

7

SSA CT

1

SSAPCT

6

21.6%

BGC0001229.4 (SBI_06989):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

1

VSSASCTTCICTCSC

15

VS+A C T CT C

23

VSAAFCPTTKCTSRC

37

11.8%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

12

TCSCS

16

TC CS

25

TCHCS

29

CPH93_RS17870

Leader:

MSTVAAVGQDVGVEGLTGLDAGALEISETRTRRCSTARAAVTLI

Core:

SSVSCTTCICSGRCSS

Core with dehydrations:

DhaDhaVDhaCysDhbDhbCysICysDhaGRCysDhaDha

antiSMASH-DB 4.0 matches for CPH93_RS17870

100.0%

NZ_LT907981.1:

Thiopeptides: CPH93_RS17870_thiopeptide

1

SSVSCTTCICSGRCSS

16

SSVSCTTCICSGRCSS

1

SSVSCTTCICSGRCSS

16

23.3%

NZ_CP023711.1and 11 others:

NZ_CP034141.1 Lanthipeptides: EGM68_RS25880_lanthipeptideNZ_CP040829.1 Lanthipeptides: FGY93_RS26165_lanthipeptideNZ_CP049598.1 Lanthipeptides: G7L40_RS03920_lanthipeptideNZ_CP071875.1 Lanthipeptides: J4I02_RS05145_lanthipeptideNZ_CP086373.1 Lanthipeptides: LMH85_RS04795_lanthipeptideNZ_CP092831.1 Lanthipeptides: MLD56_RS04795_lanthipeptideNZ_CP102865.1 Lanthipeptides: NWS42_RS17805_lanthipeptideNZ_JAFJXZ010000012.1 Lanthipeptides: JYU28_RS03620_lanthipeptideNZ_JAKVDC010000009.1 Lanthipeptides: MKN04_RS18550_lanthipeptideNZ_JWJJ01000002.1 Lanthipeptides: U707_RS25810_lanthipeptideNZ_POVT01000017.1 Lanthipeptides: C1T20_RS25545_lanthipeptide

Lanthipeptides: CPY53_RS19275_lanthipeptide

7

TCICSGRCSS

16

TCIC+G CS+

19

TCICTGSCSN

28

18.8%

NZ_KZ859514.1and 1 other:

NZ_KZ859514.1 Lanthipeptides: DPQ64_RS19150_lanthipeptide

Lanthipeptides: DPQ64_RS19155_lanthipeptide

2

SVSCT-TCICSGRCS

15

S+SCT +C+CSG C+

28

SLSCTDSCLCSGDCN

42

with 1 more sequence matches

14.0%

NZ_CP064030.1:

Lanthipeptides: ISN74_RS08625_lanthipeptide

9

ICSGRCSS

16

+CSGRC S

25

VCSGRCGS

32

MIBiG 4.0 matches for CPH93_RS17870

18.2%

BGC0000563.4 (AEA03263.1):

Lanthipeptide: venezuelin

7

TCICSG

12

TC C G

2

TCECVG

7

16.2%

BGC0001229.4 (SBI_06989):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

1

SSVSCTTCICSGRC

14

S+ C T C+ RC

24

SAAFCPTTKCTSRC

37

15.4%

BGC0002110.3 (QKV49894.1):

Lanthipeptide: birimositide

5

CTTCICSGRC

14

C T C+ +C

17

CPTTKCTSKC

26

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Types:

Type I: Featuring genes encoding indolic acid side ring (series e)
Type II: Featuring the gene coding for quinaldic acid moiety formation (series a, b, and c)
Type III: No genes for synthesizing L-Trp derivatives (series d)

RREFinder

Terpene

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 0 - 83; Score: 99.0; RRE type: Heterocycloanthracin_C_RRE; Location: 3 - 56; Score: 30.6

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C

Core peptide predictions

CPH93_RS17865

Putative Type II

Cleavage pHMM score: 21.40

RODEO score: 33

Monoisotopic mass: 1641.6 Da

Molecular weight: 1642.9 Da

Predicted peptide features:
Central ring: piperidine; second macrocycle containing a quinaldic acid moiety

Macrocycle: 26-member

Considering maturation reactions

Monoisotopic mass: 1629.4 Da

Molecular weight: 1630.7 Da

Alternative weights: (assuming N unmodified Ser/Thr residues); 1660.9 Da N = 1; 1678.9 Da N = 2; 1696.9 Da N = 3; 1715.0 Da N = 4; 1733.0 Da N = 5; 1751.0 Da N = 6; 1769.0 Da N = 7; 1787.0 Da N = 8; 1805.1 Da N = 9

CPH93_RS17870

Putative Type II

Cleavage pHMM score: 9.20

RODEO score: 30

Monoisotopic mass: 1579.6 Da

Molecular weight: 1580.8 Da

Predicted peptide features:
Central ring: piperidine; second macrocycle containing a quinaldic acid moiety

Considering maturation reactions

Monoisotopic mass: 1605.5 Da

Molecular weight: 1606.6 Da

Alternative weights: (assuming N unmodified Ser/Thr residues); 1598.8 Da N = 1; 1616.8 Da N = 2; 1634.8 Da N = 3; 1652.9 Da N = 4; 1670.9 Da N = 5; 1688.9 Da N = 6; 1706.9 Da N = 7; 1724.9 Da N = 8

NZ_LT907981.1 - Region 24 - T1PKS

Download region SVG

Location: 5,236,629 - 5,282,976 nt. (total: 46,348 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

CPH93_RS22605: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CPH93_RS22655: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CPH93_RS22665: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Hydrolases: esterase hydrolase

CPH93_RS22530: putative esterase

smcogs: SMCOG1104: putative esterase

CPH93_RS22560: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase

CPH93_RS22600: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: permease

CPH93_RS22675: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.15 out of 23.79

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.17 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.86 out of 18.57

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.31 out of 23.79

Confidence: medium

Additional weak hits (16):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.49 out of 27.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.37 out of 27.04

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 27.04

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.49 out of 36.54

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.53 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.91 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.84 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.97 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.29 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.84 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.87 out of 24.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.41 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.19 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.34 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.43 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 35, location 5236628 - 5282976:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CPH93_RS22605: mmal

PKS_AT (550..843): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Malonyl-CoA: 70.8%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 148.5
Ethylmalonyl-CoA: 134.9
Methoxymalonyl-CoA: 120.8
Malonyl-CoA: 102.4
Propionyl-CoA: 83.2
Isobutyryl-CoA: 78.3
2-Methylbutyryl-CoA: 77.3
trans-1,2-CPDA: 75.8
Acetyl-CoA: 57.2
CHC-CoA: 44.4
fatty_acid: 42.9
inactive: 29.2
Benzoyl-CoA: 20.0
3-Methylbutyryl-CoA: 18.7

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT907981.1 - Region 25 - butyrolactone

Download region SVG

Location: 5,289,292 - 5,300,227 nt. (total: 10,936 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CPH93_RS22730: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CPH93_RS22745: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

CPH93_RS22720: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001723.5	0.46	PKS	oviedomycin	Streptomyces antibioticus
BGC0000231.5	0.45	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.44	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002711.2	0.43	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000275.4	0.43	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000219.4	0.42	PKS, saccharide	elloramycin	Streptomyces olivaceus
BGC0000272.3	0.42	PKS	spore pigment	Streptomyces collinus
BGC0002510.2	0.42	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0001366.5	0.41	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001723.5	0.46	PKS	oviedomycin	Streptomyces antibioticus
BGC0000231.5	0.45	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.44	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002711.2	0.43	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000275.4	0.43	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000219.4	0.42	PKS, saccharide	elloramycin	Streptomyces olivaceus
BGC0000272.3	0.42	PKS	spore pigment	Streptomyces collinus
BGC0002510.2	0.42	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0001366.5	0.41	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.39 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LT907981.1 - Region 26 - ectoine

Download region SVG

Location: 6,216,600 - 6,227,016 nt. (total: 10,417 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

CPH93_RS26775: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: aminotransferase methyltransferase

CPH93_RS26760: methyltransferase

smcogs: SMCOG1089: methyltransferase

CPH93_RS26770: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

CPH93_RS26790: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.92	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0000856.3	0.72	other (other)	ectoine	Methylophaga thalassica
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.92	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0000856.3	0.72	other (other)	ectoine	Methylophaga thalassica
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT907981.1 - Region 27 - NI-siderophore

Download region SVG

Location: 6,306,873 - 6,336,678 nt. (total: 29,806 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

CPH93_RS27260: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Lyases: decarboxylase

CPH93_RS27265: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.87	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.80	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000941.3	0.80	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000940.5	0.72	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.72	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002073.3	0.60	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002690.2	0.54	other (other)	FW0622	Verrucosispora sp. FIM060022

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.87	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.80	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000941.3	0.80	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000940.5	0.72	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.72	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002073.3	0.60	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002690.2	0.54	other (other)	FW0622	Verrucosispora sp. FIM060022

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 25.31

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.03 out of 36.53

Confidence: medium

Additional weak hits (25):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.97 out of 31.73

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.93 out of 19.26

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.25 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.44 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.19 out of 30.98

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.23 out of 27.04

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.92 out of 27.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.27 out of 32.74

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.22 out of 39.62

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.67 out of 31.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.08 out of 32.93

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.92 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.67 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.10 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.03 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.96 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.46 out of 39.62

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.29 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.63 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.51 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.67 out of 26.85

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor

NZ_LT907981.1 - Region 28 - T1PKS,hglE-KS

Download region SVG

Location: 6,895,471 - 6,946,967 nt. (total: 51,497 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase

CPH93_RS29905: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase

CPH93_RS29870: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

CPH93_RS29900: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

CPH93_RS29975: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: synthase

CPH93_RS29885: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CPH93_RS29890: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.58	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.58	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.53	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.51	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.51	PKS	FR901512	fungal sp. No.14919
BGC0000041.3	0.49	PKS	oronofacic acid	Pseudomonas syringae
BGC0000863.3	0.42	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.62	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.59	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0000041.3	0.58	PKS	oronofacic acid	Pseudomonas syringae
BGC0000863.3	0.54	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 26.63 out of 29.51

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.70 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.56 out of 23.79

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.86 out of 18.57

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.55 out of 30.22

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.91 out of 23.79

Confidence: medium

Additional weak hits (18):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.15 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.89 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.40 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.57 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.14 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.90 out of 20.01

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.45 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.87 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.65 out of 32.93

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.12 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.37 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 25.75

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.96 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.13 out of 35.63

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.25 out of 27.18

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.57 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 39, location 6895470 - 6946967:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (pk)
Non-colinear ordering:: CPH93_RS29890 + CPH93_RS29895

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 40, location 6895470 - 6942412:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (pk)
Non-colinear ordering:: CPH93_RS29890 + CPH93_RS29895

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 41, location 6902413 - 6946967:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (pk)
Non-colinear ordering:: CPH93_RS29890 + CPH93_RS29895

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CPH93_RS29885: mal

PKS_AT (1232..1523): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 75.2
Methoxymalonyl-CoA: 35.0
Methylmalonyl-CoA: 31.7
inactive: 31.4
Propionyl-CoA: 24.7
CHC-CoA: 17.6
Ethylmalonyl-CoA: 17.0
trans-1,2-CPDA: 13.4
2-Methylbutyryl-CoA: 10.4
fatty_acid: 9.3
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

CPH93_RS29890: pk

PKS_AT (630..831): pk

ATSignature: (unknown)

No matches above 50%

minowa: Propionyl-CoA

Prediction, score:

Propionyl-CoA: 10.6
inactive: 7.0
Malonyl-CoA: 5.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT907981.1 - Region 29 - NI-siderophore

Download region SVG

Location: 7,084,158 - 7,117,027 nt. (total: 32,870 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CPH93_RS30765: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Lyases: decarboxylase lyase

CPH93_RS30705: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

CPH93_RS30725: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.77	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.70	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.63	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000947.5	0.58	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002073.3	0.58	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002682.2	0.55	other (other)	aerobactin	Vibrio mimicus
BGC0001870.3	0.55	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002681.3	0.50	other (other)	rhizoferrin	Francisella tularensis subsp. tularensis SCHU S4
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.77	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.70	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.63	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000947.5	0.58	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002073.3	0.58	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002682.2	0.55	other (other)	aerobactin	Vibrio mimicus
BGC0001870.3	0.55	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002681.3	0.50	other (other)	rhizoferrin	Francisella tularensis subsp. tularensis SCHU S4
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.35 out of 23.79

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

Additional weak hits (8):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.12 out of 29.25

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.04 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.86 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.26 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism

NZ_LT907981.1 - Region 30 - T2PKS

Download region SVG

Location: 7,235,314 - 7,307,829 nt. (total: 72,516 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase synthase

CPH93_RS31345: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

CPH93_RS31360: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CPH93_RS31365: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CPH93_RS31380: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

CPH93_RS31475: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

CPH93_RS37060: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Transferases: aminotransferase glycosyltransferase methyltransferase transferase

CPH93_RS31280: aminotransferase

smcogs: SMCOG1019: aminotransferase

CPH93_RS31295: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

CPH93_RS31450: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

CPH93_RS31485: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase synthase

CPH93_RS31310: isochorismatase

smcogs: SMCOG1027: isochorismatase

CPH93_RS31545: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

CPH93_RS37060: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Lyases: cyclase hydratase

CPH93_RS31385: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

CPH93_RS31440: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

CPH93_RS31445: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Isomerases: mutase

CPH93_RS31525: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

CPH93_RS31300: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CPH93_RS31425: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CPH93_RS31430: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.76	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.73	PKS	spore pigment	Streptomyces avermitilis
BGC0000215.5	0.69	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.63	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.61	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000234.5	0.61	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.60	PKS	oviedomycin	Streptomyces antibioticus
BGC0002277.2	0.59	NRPS	atromentin	Suillus grevillei
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.76	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.73	PKS	spore pigment	Streptomyces avermitilis
BGC0000215.5	0.69	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.63	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.61	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000234.5	0.61	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.60	PKS	oviedomycin	Streptomyces antibioticus
BGC0002277.2	0.59	NRPS	atromentin	Suillus grevillei
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.89 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.25 out of 24.78

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (19):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.60 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.55 out of 28.14

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.74 out of 27.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.83 out of 26.85

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.52 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.70 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.63 out of 30.22

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.61 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.58 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.77 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.15 out of 29.65

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.05 out of 27.18

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.74 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

CPH93_RS31300: X

AMP-binding (12..389): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TALLHGLILG-GFGVSGSAIERYGMTETLMNTSV
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (44% 8Å match)
Stachelhaus code match:: 60% (weak)

Type II PKS gene cluster prediction details

Cluster section:: 7235313 to 7307829
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

CPH93_RS31360: KR (Score: 178.3; E-value: 5.2e-55)
CPH93_RS31365: KR (Score: 153.2; E-value: 2.3e-47)
CPH93_RS31420: CYC C5-C18 (Score: 214.3; E-value: 1.1e-66)
CPH93_RS31425: KS (Score: 727.9; E-value: 7.6e-222)
CPH93_RS31430: CLF (Score: 547.2; E-value: 5e-167)
CPH93_RS31435: ACP (Score: 64.6; E-value: 1.5e-20)
CPH93_RS31440: CYC C9-C14 (Score: 244.5; E-value: 7.6e-76)
CPH93_RS31445: CYC C4-C21/C2-C23|C2-C19 (Score: 157.0; E-value: 3e-49)
CPH93_RS31450: MET C6|C8 (Score: 529.5; E-value: 6.4e-162)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C
OsdR	Development and stress management regulator

NZ_LT907981.1 - Region 31 - RiPP-like

Download region SVG

Location: 7,324,050 - 7,334,277 nt. (total: 10,228 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000518.3	0.42	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000484.5	0.39	ribosomal	glycocin F	Lactobacillus plantarum
BGC0000504.5	0.39	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.5	0.38	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000518.3	0.42	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000484.5	0.39	ribosomal	glycocin F	Lactobacillus plantarum
BGC0000504.5	0.39	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.5	0.38	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.76 out of 29.38

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.87 out of 20.01

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.07 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.98 out of 29.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LT907981.1 - Region 32 - hydrogen-cyanide

Download region SVG

Location: 7,435,880 - 7,448,860 nt. (total: 12,981 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

CPH93_RS32180: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CPH93_RS32185: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CPH93_RS32200: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

CPH93_RS32210: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Hydrolases: peptidase

CPH93_RS32230: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: hydratase

CPH93_RS32175: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000888.5	0.44	other (other)	bacilysin	Bacillus sp. CS93
BGC0000231.5	0.44	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000218.5	0.42	PKS	doxorubicin	Streptomyces peucetius
BGC0002218.2	0.41	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000217.5	0.41	PKS	daunorubicin	Streptomyces sp.
BGC0000234.5	0.40	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002161.2	0.39	PKS	scytalone, T3HN	Pestalotiopsis fici W106-1
BGC0000384.6	0.38	NRPS	lyngbyatoxin	Lyngbya majuscula

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000888.5	0.44	other (other)	bacilysin	Bacillus sp. CS93
BGC0000231.5	0.44	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000218.5	0.42	PKS	doxorubicin	Streptomyces peucetius
BGC0002218.2	0.41	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000217.5	0.41	PKS	daunorubicin	Streptomyces sp.
BGC0000234.5	0.40	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002161.2	0.39	PKS	scytalone, T3HN	Pestalotiopsis fici W106-1
BGC0000384.6	0.38	NRPS	lyngbyatoxin	Lyngbya majuscula

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (13):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.89 out of 25.88

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.96 out of 25.88

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.58 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.04 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.31 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.96 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.45 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.68 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.02 out of 23.43

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.29 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LT907981.1 - Region 33 - T3PKS

Download region SVG

Location: 7,480,060 - 7,521,124 nt. (total: 41,065 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CPH93_RS32435: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CPH93_RS32525: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: aminotransferase

CPH93_RS32390: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: synthase

CPH93_RS32430: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.85	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.72	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.67	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.61	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000844.5	0.48	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000281.3	0.47	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001485.4	0.45	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.85	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.72	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.67	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.61	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000844.5	0.48	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000281.3	0.47	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001485.4	0.45	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.96 out of 29.72

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.63 out of 18.46

Confidence: medium

Additional weak hits (13):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.75 out of 27.04

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 30.11

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.28 out of 27.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.78 out of 39.62

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.03 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 20.06 out of 31.73

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.48 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.24 out of 26.12

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.00 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.22 out of 28.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT907981.1 - Region 34 - RiPP-like

Download region SVG

Location: 7,544,116 - 7,556,047 nt. (total: 11,932 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

CPH93_RS32630: methyltransferase

smcogs: SMCOG1248: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.42	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000468.5	0.40	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.40	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.40	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.38	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000598.5	0.35	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001334.5	0.33	other (other)	caldoniamide A, cladoniamide B, cladoniamide C7, cladoniamide D, cladoniamide E, cladoniamide F, cladoniamide G	Streptomyces uncialis
BGC0000633.3	0.32	terpene	carotenoid	Streptomyces avermitilis
BGC0001753.3	0.30	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.42	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000468.5	0.40	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.40	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.40	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.38	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000598.5	0.35	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001334.5	0.33	other (other)	caldoniamide A, cladoniamide B, cladoniamide C7, cladoniamide D, cladoniamide E, cladoniamide F, cladoniamide G	Streptomyces uncialis
BGC0000633.3	0.32	terpene	carotenoid	Streptomyces avermitilis
BGC0001753.3	0.30	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.43 out of 27.18

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.76 out of 26.85

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LT907981.1 - Region 35 - NRPS,NRPS-like

Download region SVG

Location: 7,565,485 - 7,666,430 nt. (total: 100,946 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

CPH93_RS32760: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CPH93_RS32790: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CPH93_RS32795: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acetyltransferase glycosyltransferase

CPH93_RS32685: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CPH93_RS32785: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

CPH93_RS32810: Glycosylation

MITE: MITE0000033Glycosylation (identity: 61.10%)
smcogs: SMCOG1102: glycosyltransferase

Hydrolases: esterase hydrolase

CPH93_RS32765: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

CPH93_RS32840: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

CPH93_RS32860: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

CPH93_RS32750: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

CPH93_RS32770: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CPH93_RS32775: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CPH93_RS32815: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

CPH93_RS32845: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CPH93_RS32850: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CPH93_RS32855: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CPH93_RS32865: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.74	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.54	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.54	NRPS	epichloenin A	Epichloe festucae
BGC0002071.2	0.47	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.80 out of 23.43

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.45 out of 28.19

Confidence: medium

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 22.40

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.50 out of 26.85

Confidence: medium

Additional weak hits (16):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.55 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.76 out of 29.38

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.31 out of 29.51

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.88 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.46 out of 32.74

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.84 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.04 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.62 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.52 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.56 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.27 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.69 out of 30.98

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.81 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 48, location 7565484 - 7666430:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - D-Ala - D-Val - D-Ala - Leu) + (D-Orn - Thr - D-Orn - Val - D-Leu) + (Asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 49, location 7565484 - 7644186:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - D-Ala - D-Val - D-Ala - Leu) + (D-Orn - Thr - D-Orn - Val - D-Leu) + (Asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 50, location 7623367 - 7666430:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Orn - Thr - D-Orn - Val - D-Leu) + (Asn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CPH93_RS32770: Leu - Ala - Val - Ala - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (40..422): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAASFDAAVLEILIIVGAEINSYGPTEATVVASW
Nearest Stachelhaus code(s):: Leu DALLIGAVVK (79% 8Å match); Leu or 3OH-Leu DALLIGAVVK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1079..1480): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFECSGVLAGEANIYGPTEATVYATA
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2592..2996): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDAATYEVWLWTGGEVDGYGPTETTTFATR
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4114..4514): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFECSAVLAGEMNIYGPTEATVYATA
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5633..6018): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAEAFDASVLEMLLIVGADINSYGPTETTVVATW
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (74% 8Å match); Leu DALLIGAVVK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

CPH93_RS32775: Orn - Thr - Orn - Val - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (519..906): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGHAFDTSLEGLDLMLGGEYNFYGPTECTVDALA
Nearest Stachelhaus code(s):: Orn DTEDMGFVDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2041..2453): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LRTHFDFSVWEGNQIFGGEVNMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3112..3503): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDHGFDTSWEGMDVMVGGEYNVYGPTECTVDAVY
Nearest Stachelhaus code(s):: Orn DTEDMGYVDK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4621..5002): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDSSFDAATFEAWLWTGGDVDGYGPTETTTFATS
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (5658..6039): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAAAFDASYLEILIIVGAEINSYGPTEATVVATW
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (68% 8Å match); Leu DALLIGAVVK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

CPH93_RS32855: X

AMP-binding (19..464): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGIL----LYGDFAVSGGAHTTYGATEALPISSL
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

CPH93_RS32865: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (420..810): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATFDLTGTTAKLVVGGEVNEYGPTEATIGCIV
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (82% 8Å match); Asp DLTKVGHIGK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
HypR	L-hydroxyproline utilization repressor
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_LT907981.1 - Region 36 - transAT-PKS

Download region SVG

Location: 7,666,570 - 7,752,414 nt. (total: 85,845 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CPH93_RS33045: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CPH93_RS33050: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CPH93_RS33065: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CPH93_RS33075: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase methyltransferase

CPH93_RS33060: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CPH93_RS33070: methyltransferase

smcogs: SMCOG1089: methyltransferase

CPH93_RS35955: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

CPH93_RS33040: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: decarboxylase dehydratase

CPH93_RS33010: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

CPH93_RS33125: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

CPH93_RS33055: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000177.5	0.89	PKS	iso-migrastatin, migrastatin, dorrigocin A, dorrigocin B, 13-epi-dorrigocin A	Streptomyces platensis subsp. rosaceus
BGC0000083.5	0.72	PKS	lactimidomycin, 8,9-dihydrolactimidomycin, 8-hydroxy-8,9-dihydrolactidomycin, 17-hydroxy-8-desmethoxy-isomigrastatin	Streptomyces amphibiosporus
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000177.5	0.89	PKS	iso-migrastatin, migrastatin, dorrigocin A, dorrigocin B, 13-epi-dorrigocin A	Streptomyces platensis subsp. rosaceus
BGC0000083.5	0.72	PKS	lactimidomycin, 8,9-dihydrolactimidomycin, 8-hydroxy-8,9-dihydrolactidomycin, 17-hydroxy-8-desmethoxy-isomigrastatin	Streptomyces amphibiosporus
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (22):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.46 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.08 out of 27.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.51 out of 39.62

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.05 out of 32.74

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.50 out of 26.33

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.13 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.82 out of 20.01

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.24 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.24 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.10 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.36 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.05 out of 32.74

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.69 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.83 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.33 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.68 out of 24.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.91 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.77 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.26 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 51, location 7666569 - 7752414:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - mal - ohmal) + (mal - Me-ccmal - Me-ohmal - mal - ccmal - mal) + (ccmal)
Non-colinear ordering:: CPH93_RS33045 + CPH93_RS33050 + CPH93_RS33055

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CPH93_RS35955: mal

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 115.3
inactive: 40.9
Methoxymalonyl-CoA: 36.3
Methylmalonyl-CoA: 30.6
Propionyl-CoA: 20.6
Isobutyryl-CoA: 13.7
Ethylmalonyl-CoA: 12.8
2-Methylbutyryl-CoA: 11.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

CPH93_RS33060: mal

PKS_AT (4..279): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 125.8
inactive: 55.9
Methoxymalonyl-CoA: 36.4
Methylmalonyl-CoA: 35.0
Propionyl-CoA: 28.1
Isobutyryl-CoA: 27.4
2-Methylbutyryl-CoA: 22.6
CHC-CoA: 20.6
Ethylmalonyl-CoA: 10.6
Benzoyl-CoA: 7.9
trans-1,2-CPDA: 6.8
fatty_acid: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_LT907981.1 - Region 37 - T1PKS

Download region SVG

Location: 8,086,666 - 8,177,506 nt. (total: 90,841 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

CPH93_RS34855: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CPH93_RS34880: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

CPH93_RS34885: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CPH93_RS34890: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CPH93_RS34905: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CPH93_RS34930: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CPH93_RS34945: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CPH93_RS34950: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: acylase aminotransferase

CPH93_RS34900: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CPH93_RS34910: aminotransferase

smcogs: SMCOG1019: aminotransferase

CPH93_RS34965: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase

CPH93_RS34985: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

CPH93_RS34895: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CPH93_RS34955: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CPH93_RS34960: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CPH93_RS34970: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CPH93_RS34975: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000123.5	0.86	PKS	phoslactomycin B	Streptomyces sp. HK803
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.69	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000123.5	0.86	PKS	phoslactomycin B	Streptomyces sp. HK803
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.69	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.29 out of 23.79

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.35 out of 27.18

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

Additional weak hits (22):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.67 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.26 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.42 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.83 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.56 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.33 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.28 out of 23.43

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.26 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.20 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.02 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.47 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.45 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.87 out of 20.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 52, location 8086665 - 8177506:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (pk - ccmal) + (ccmal - ohmal) + (ohemal) + (ccmal) + (ohemal) + (ohmal)
Non-colinear ordering:: CPH93_RS34905 + CPH93_RS34900 + CPH93_RS34975 + CPH93_RS34970 + CPH93_RS34965 + CPH93_RS34960

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CPH93_RS34895: X

AMP-binding (466..896): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AMESHTGFLYGLQAVATGACGAFGTTETCLAALS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

CPH93_RS34900: mal - mal

PKS_AT (560..831): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 189.4
inactive: 97.4
Methoxymalonyl-CoA: 81.6
Methylmalonyl-CoA: 79.1
Propionyl-CoA: 49.6
Ethylmalonyl-CoA: 46.8
CHC-CoA: 35.7
2-Methylbutyryl-CoA: 34.2
Isobutyryl-CoA: 27.9
trans-1,2-CPDA: 27.8
Benzoyl-CoA: 24.6
Acetyl-CoA: 24.1
fatty_acid: 17.6
3-Methylbutyryl-CoA: 8.8

PKS_AT (2304..2574): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.4
inactive: 89.2
Methylmalonyl-CoA: 76.1
Methoxymalonyl-CoA: 76.1
Propionyl-CoA: 47.5
Ethylmalonyl-CoA: 46.4
CHC-CoA: 42.1
2-Methylbutyryl-CoA: 38.2
trans-1,2-CPDA: 33.4
Acetyl-CoA: 32.2
Benzoyl-CoA: 31.7
Isobutyryl-CoA: 21.7
fatty_acid: 20.3
3-Methylbutyryl-CoA: 11.4

CPH93_RS34905: pk - mal

PKS_AT (238..531): pk

ATSignature: CHC-CoA

Top 3 matches:: CHC-CoA: 100.0%; Propionyl-CoA: 66.7%; Methylmalonyl-CoA: 66.7%

minowa: CHC-CoA

Prediction, score:

CHC-CoA: 259.3
Methylmalonyl-CoA: 143.7
Ethylmalonyl-CoA: 131.5
2-Methylbutyryl-CoA: 116.6
Methoxymalonyl-CoA: 116.3
Propionyl-CoA: 100.0
trans-1,2-CPDA: 99.5
Malonyl-CoA: 63.2
Isobutyryl-CoA: 53.6
Benzoyl-CoA: 41.7
fatty_acid: 25.5
Acetyl-CoA: 24.4
inactive: 15.2
3-Methylbutyryl-CoA: 11.4

PKS_AT (1225..1497): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.8
Methoxymalonyl-CoA: 84.1
Methylmalonyl-CoA: 81.5
inactive: 80.8
Ethylmalonyl-CoA: 52.9
Propionyl-CoA: 45.7
CHC-CoA: 43.1
Isobutyryl-CoA: 41.9
2-Methylbutyryl-CoA: 38.2
Acetyl-CoA: 36.7
trans-1,2-CPDA: 34.2
Benzoyl-CoA: 33.4
fatty_acid: 22.2
3-Methylbutyryl-CoA: 14.2

CPH93_RS34960: mal

PKS_AT (561..833): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 186.7
inactive: 87.8
Methylmalonyl-CoA: 81.0
Methoxymalonyl-CoA: 78.9
Ethylmalonyl-CoA: 54.1
Propionyl-CoA: 46.1
2-Methylbutyryl-CoA: 41.3
CHC-CoA: 38.2
trans-1,2-CPDA: 34.5
Acetyl-CoA: 31.0
Benzoyl-CoA: 30.2
fatty_acid: 24.9
Isobutyryl-CoA: 21.1
3-Methylbutyryl-CoA: 12.8

CPH93_RS34965: emal

PKS_AT (597..894): emal

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 100.0%; Methylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 234.5
Methylmalonyl-CoA: 178.3
Methoxymalonyl-CoA: 154.9
trans-1,2-CPDA: 120.1
2-Methylbutyryl-CoA: 115.2
CHC-CoA: 106.8
Propionyl-CoA: 103.9
Malonyl-CoA: 84.8
Benzoyl-CoA: 80.2
Isobutyryl-CoA: 74.4
Acetyl-CoA: 53.1
3-Methylbutyryl-CoA: 31.5
fatty_acid: 25.7
inactive: 25.0

CPH93_RS34970: mal

PKS_AT (566..866): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 184.6
inactive: 107.5
Methoxymalonyl-CoA: 50.3
Methylmalonyl-CoA: 39.2
Propionyl-CoA: 34.5
Acetyl-CoA: 19.2
Isobutyryl-CoA: 17.4
Benzoyl-CoA: 16.7
2-Methylbutyryl-CoA: 14.5
fatty_acid: 13.3
Ethylmalonyl-CoA: 11.5
trans-1,2-CPDA: 8.7
CHC-CoA: 2.1
3-Methylbutyryl-CoA: 0.0

CPH93_RS34975: emal

PKS_AT (529..827): emal

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 100.0%; Methylmalonyl-CoA: 79.2%; Malonyl-CoA: 75.0%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 233.8
Methylmalonyl-CoA: 191.6
Methoxymalonyl-CoA: 153.4
trans-1,2-CPDA: 119.5
2-Methylbutyryl-CoA: 114.0
Propionyl-CoA: 94.5
CHC-CoA: 90.2
Malonyl-CoA: 88.7
Isobutyryl-CoA: 76.1
Benzoyl-CoA: 61.6
Acetyl-CoA: 44.8
inactive: 31.3
3-Methylbutyryl-CoA: 26.7
fatty_acid: 22.1