GCF_900155685.1 - 16 region(s)

Download region SVG

Location: 165,109 - 239,164 nt. (total: 74,056 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: reductase

CZ379_RS01010: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

CZ379_RS01015: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Isomerases: isomerase

CZ379_RS01035: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

CZ379_RS01030: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

CZ379_RS01040: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CZ379_RS01045: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CZ379_RS01050: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CZ379_RS01055: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

CZ379_RS01100: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.71	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.71	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.51 out of 29.38

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.03 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.06 out of 28.19

Confidence: medium

Additional weak hits (14):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.08 out of 39.62

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 24.04 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.21 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.18 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.34 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.86 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.42 out of 29.25

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.37 out of 20.47

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.28 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.81 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.58 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.30 out of 32.74

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.63 out of 26.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 165108 - 239164:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Thr) + (X) + (X - X - D-Ile) + (Ile - X - X - Val)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CZ379_RS01040: X

AMP-binding (111..541): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NGIMGGLLTNHGWALNVGQVPAYGMTEFSGSLCF
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

CZ379_RS01045: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (42..444): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNDHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

CZ379_RS01050: X - X - X - Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (291..688): X

nrpys: Leu, Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TNNSFDGSTYEGFMFFGGEANGYGPTETTVFAST
Nearest Stachelhaus code(s):: Val DGFFVGGVFK (82% 8Å match); Leu DGYIIGGVFK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1342..1751): X

nrpys: Leu, Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TNNSFDGSTYEGFMFFGGEANGYGPTETTVFAAT
Nearest Stachelhaus code(s):: Val DGFFVGGVFK (82% 8Å match); Leu DGYIIGGVFK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2415..2809): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TNNSFDGSTYESLAIFGGEINAYGPTETTVIAAT
Nearest Stachelhaus code(s):: D-Ala DATLIGAVIK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (3469..3874): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: TNNSFDGSTYEGFMFVGGEVSAYGPTETTVYATT
Nearest Stachelhaus code(s):: Ile DGYFLGVVYK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

CZ379_RS01055: Ile - X - X - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (467..859): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TNNSFDGAVFDGFMLFGGELHMYGPTETTVFATC
Nearest Stachelhaus code(s):: Ile DGFFLGVVFK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1530..1928): X

nrpys: Leu, Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TNNSFDASTLEGFMFFGGEVHAYGPTETTVFATT
Nearest Stachelhaus code(s):: Leu or Ile DALFMGATFK (79% 8Å match); Arg DALFFGLVDK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2588..3009): X

nrpys: Leu, Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TNNSFDGSTYEGFMFFGGEANGYGPTETTVFATT
Nearest Stachelhaus code(s):: Val DGFFVGGVFK (85% 8Å match); Leu DGYIIGGVFK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (3666..4087): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TNNSFDGSTYEGFMFFGGEANSYGPTETTVFATT
Nearest Stachelhaus code(s):: Val DGYFLGVVFK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

TFBS definitions

Regulator	Description
FuR variant 1	Ferric Uptake Regulator
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor

NZ_LT732547.1 - Region 2 - NRPS,transAT-PKS

Download region SVG

Location: 403,724 - 480,296 nt. (total: 76,573 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

CZ379_RS01825: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: acylase aminotransferase kinase

CZ379_RS01855: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

CZ379_RS01885: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CZ379_RS01910: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: cyclase

CZ379_RS01835: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase synthase

CZ379_RS01890: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CZ379_RS01895: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CZ379_RS01900: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

CZ379_RS01925: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.85	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.81	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.77	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.77	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.75	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0000402.4	0.73	NRPS	paenilarvin A, paenilarvin B, paenilarvin C	Paenibacillus larvae subsp. larvae DSM 25430
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	0.72	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000402.4	0.69	NRPS	paenilarvin A, paenilarvin B, paenilarvin C	Paenibacillus larvae subsp. larvae DSM 25430
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	0.69	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.22 out of 18.57

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.06 out of 26.85

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.84 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.50 out of 29.38

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.86 out of 18.57

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.15 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.77 out of 28.19

Confidence: medium

Additional weak hits (20):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.54 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.54 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.84 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.94 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.02 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.09 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.65 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.02 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.52 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.61 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.06 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.11 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.22 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.88 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.54 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 403723 - 480296:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - mal - Gly - D-Asp) + (Dab - D-Dab) + (Val - Leu - Val)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CZ379_RS01885: mal

PKS_AT (7..293): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 90.6
inactive: 35.3
Methoxymalonyl-CoA: 31.0
Methylmalonyl-CoA: 25.4
Propionyl-CoA: 22.2
Isobutyryl-CoA: 10.3
fatty_acid: 8.7
2-Methylbutyryl-CoA: 8.1
CHC-CoA: 6.5
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

CZ379_RS01890: fatty_acid - Gly - Asp

Search NORINE for peptide: strict or relaxed

CAL_domain (36..482): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 332.7
NH2: 27.7
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (3260..3654): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDIFVLEVQIMLGGEYNMYGPTETTVWSCV
Nearest Stachelhaus code(s):: Gly DILQMGMVWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4320..4723): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YWFSFDLCYTAPKAVLGGELNHYGPTEATIGCIA
Nearest Stachelhaus code(s):: Asp DLTKVGHIGK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

CZ379_RS01895: Dab - Dab

Search NORINE for peptide: strict or relaxed

AMP-binding (468..874): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: HAEAFDISVWQGEVLITGEVNAYGPAEASDDICQ
Nearest Stachelhaus code(s):: Dab DIWELTADDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1521..1931): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAEAFDISVWQGEVLITGEVNAYGPAEAADDVSQ
Nearest Stachelhaus code(s):: Dab DIWELTADDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

CZ379_RS01900: Val - Leu - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (503..909): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTGFDACTFEGWLIVGGDINGYGPTENTTFSCC
Nearest Stachelhaus code(s):: Val DAFWIGGTFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1557..1994): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: MWYAFDASVWEPFLITGGDVNNYGPTENTIVTSA
Nearest Stachelhaus code(s):: Leu DAWFLGNIVK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2639..3032): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTAFDVSVFDGWLIVGGDVNGYGPTENTSFSCC
Nearest Stachelhaus code(s):: Ala or Val DVFWIGGTFK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
FuR variant 1	Ferric Uptake Regulator
RpoN	Regulator of nitrogen assimilation and virulence
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_LT732548.1 - Region 1 - NRPS-like

Download region SVG

Location: 3,210 - 47,004 nt. (total: 43,795 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Isomerases: isomerase

CZ379_RS04160: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

CZ379_RS04155: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

CZ379_RS04165: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

CZ379_RS04220: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.60	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.59	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.60	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.59	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.07 out of 27.78

Confidence: medium

Additional weak hits (7):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 26.71 out of 30.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.68 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.48 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.99 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.41 out of 21.55

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.26 out of 27.18

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.88 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 3209 - 47004:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CZ379_RS04220: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (246..675): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LATSFDASVYDSILVIGGEVNAYGPTEATVVTTV
Nearest Stachelhaus code(s):: Leu DAWIVGAIVK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria

NZ_LT732548.1 - Region 2 - RiPP-like

Download region SVG

Location: 968,162 - 984,017 nt. (total: 15,856 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

CZ379_RS08860: hydrolase

smcogs: SMCOG1179: hydrolase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000617.5	0.49	ribosomal	coagulin	Bacillus coagulans
BGC0000558.5	0.49	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0002579.2	0.48	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0000624.3	0.46	ribosomal	salivaricin CRL1328 α peptide, salivaricin CRL1328 β peptide	Lactobacillus salivarius
BGC0000619.3	0.45	ribosomal	gassericin T	Lactobacillus gasseri
BGC0001602.3	0.45	ribosomal	gassericin-T	Lactobacillus gasseri
BGC0001388.3	0.45	ribosomal	gassericin E	Lactobacillus gasseri
BGC0001862.4	0.45	ribosomal	pallidocin	Aeribacillus pallidus
BGC0002577.2	0.44	ribosomal	lactococcin G	Lactococcus lactis
BGC0001863.4	0.43	ribosomal, terpene	bacillicn CER074	Bacillus mycoides

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000617.5	0.49	ribosomal	coagulin	Bacillus coagulans
BGC0000558.5	0.49	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0002579.2	0.48	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0000624.3	0.46	ribosomal	salivaricin CRL1328 α peptide, salivaricin CRL1328 β peptide	Lactobacillus salivarius
BGC0000619.3	0.45	ribosomal	gassericin T	Lactobacillus gasseri
BGC0001602.3	0.45	ribosomal	gassericin-T	Lactobacillus gasseri
BGC0001388.3	0.45	ribosomal	gassericin E	Lactobacillus gasseri
BGC0001862.4	0.45	ribosomal	pallidocin	Aeribacillus pallidus
BGC0002577.2	0.44	ribosomal	lactococcin G	Lactococcus lactis
BGC0001863.4	0.43	ribosomal, terpene	bacillicn CER074	Bacillus mycoides

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.58 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.22 out of 28.19

Confidence: medium

Additional weak hits (3):

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.23 out of 20.47

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.54 out of 29.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_LT732548.1 - Region 3 - proteusin

Download region SVG

Location: 1,307,223 - 1,327,468 nt. (total: 20,246 nt) Show pHMM detection rules used

proteusin: (PoyD or TIGR03793)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase phosphotransferase

CZ379_RS10465: Glucose-specific phosphotransferase enzyme IIA

smcogs: SMCOG1145: Glucose-specific phosphotransferase enzyme IIA

CZ379_RS10490: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000905.5	0.29	other (other)	heme D1	Heliobacillus mobilis
BGC0002713.2	0.29	NRPS	mevalagmapeptide A, mevalagmapeptide B, mevalagmapeptide C, mevalagmapeptide D	Photorhabdus laumondii subsp. laumondii
BGC0002122.2	0.22	NRPS	gramicidin S	Aneurinibacillus migulanus
BGC0001875.4	0.21	PKS	nargenicin A1	Nocardia arthritidis AUSMDU00012717 Unclassified.
BGC0002024.3	0.20	PKS	nargenicin A1, nargenicin A1	Nocardia argentinensis
BGC0001851.4	0.19	PKS	komodoquinone B	Streptomyces erythrochromogenes
BGC0001558.5	0.19	PKS	cosmomycin C	Streptomyces sp. CNT302
BGC0001074.5	0.19	PKS, saccharide	cosmomycin D	Streptomyces olindensis
BGC0001568.5	0.19	PKS	cytorhodin	Streptomyces sp. SCSIO 1666
BGC0002532.3	0.19	NRPS, PKS	anachelin	Anabaena cylindrica PCC 7122

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000905.5	0.29	other (other)	heme D1	Heliobacillus mobilis
BGC0002713.2	0.29	NRPS	mevalagmapeptide A, mevalagmapeptide B, mevalagmapeptide C, mevalagmapeptide D	Photorhabdus laumondii subsp. laumondii
BGC0002122.2	0.22	NRPS	gramicidin S	Aneurinibacillus migulanus
BGC0001875.4	0.21	PKS	nargenicin A1	Nocardia arthritidis AUSMDU00012717 Unclassified.
BGC0002024.3	0.20	PKS	nargenicin A1, nargenicin A1	Nocardia argentinensis
BGC0001851.4	0.19	PKS	komodoquinone B	Streptomyces erythrochromogenes
BGC0001558.5	0.19	PKS	cosmomycin C	Streptomyces sp. CNT302
BGC0001074.5	0.19	PKS, saccharide	cosmomycin D	Streptomyces olindensis
BGC0001568.5	0.19	PKS	cytorhodin	Streptomyces sp. SCSIO 1666
BGC0002532.3	0.19	NRPS, PKS	anachelin	Anabaena cylindrica PCC 7122

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 20.32 out of 20.97

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 21.84 out of 21.84

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.61 out of 24.78

Confidence: medium

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 24.68 out of 28.14

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.38 out of 28.19

Confidence: medium

Additional weak hits (5):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.38 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.66 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.02 out of 29.65

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 28.02 out of 39.62

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
LexA variant 2	Repressor of DNA damage response
MexT	Global virulence regulator
PerR	Peroxide regulator
ZuR variant 1	Zinc-responsive repressor

NZ_LT732548.1 - Region 4 - NRPS

Download region SVG

Location: 1,770,720 - 1,813,878 nt. (total: 43,159 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

CZ379_RS12485: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transport transporter

CZ379_RS12445: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

CZ379_RS12495: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

CZ379_RS12535: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.54 out of 18.46

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.83 out of 26.06

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.85 out of 20.97

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.38 out of 26.06

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.16 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.57 out of 28.19

Confidence: medium

Additional weak hits (6):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.37 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.07 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.30 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.08 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.06 out of 33.14

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.61 out of 30.11

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 1770719 - 1813878:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ile)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CZ379_RS12485: Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (469..864): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LGASFDGSTFDNFMFFGGEYHIYGPTECTVYAAY
Nearest Stachelhaus code(s):: Ile DGFFFGVVYK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_LT732548.1 - Region 5 - NRPS

Download region SVG

Location: 1,830,936 - 1,899,358 nt. (total: 68,423 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase glycosyltransferase

CZ379_RS12785: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CZ379_RS12790: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase

CZ379_RS12800: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

CZ379_RS12810: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase synthase

CZ379_RS12755: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CZ379_RS12760: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CZ379_RS12770: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CZ379_RS12775: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CZ379_RS12795: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000426.5	0.66	NRPS	sevadicin	Paenibacillus larvae
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000426.5	0.66	NRPS	sevadicin	Paenibacillus larvae
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.35 out of 20.97

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.34 out of 24.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.39 out of 24.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.13 out of 26.06

Confidence: medium

Additional weak hits (4):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.73 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.25 out of 30.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.53 out of 33.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 1830935 - 1899358:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (X) + (mal) + (mal) + (Ser - Asn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CZ379_RS12755: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (463..855): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGEFNEYGPTEATVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

CZ379_RS12760: X

AMP-binding (457..845): X

nrpys: Orn, Lys, Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YSYSFDLFIEQLTCISGGDYNGYGPTEATIGATF
Nearest Stachelhaus code(s):: Asp DLTKIGHIGK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

CZ379_RS12785: mal

PKS_AT (4..286): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 68.5
Methoxymalonyl-CoA: 26.5
inactive: 20.7
Methylmalonyl-CoA: 18.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

CZ379_RS12795: Ser - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (428..819): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWITFDVSLIELHFFSSGELNLYGPTEAAVDVSY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1460..1848): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATVDLTVTSAKLIVGGEYNEYGPTESTVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes

NZ_LT732548.1 - Region 6 - terpene-precursor

Download region SVG

Location: 2,402,126 - 2,423,028 nt. (total: 20,903 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase

CZ379_RS15020: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

CZ379_RS15060: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

CZ379_RS15065: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001594.3	0.37	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000666.5	0.36	terpene	xiamycin A	Streptomyces sp. SCSIO 02999

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001594.3	0.37	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000666.5	0.36	terpene	xiamycin A	Streptomyces sp. SCSIO 02999

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

CZ379_RS15060: PT_FPPS_like

Domain 1 (35 - 299): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 23.25 out of 25.31

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.10 out of 23.79

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.33 out of 18.16

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.92 out of 24.78

Confidence: medium

Additional weak hits (5):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.61 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.15 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.95 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.88 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.78 out of 29.38

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response

NZ_LT732548.1 - Region 7 - cyclic-lactone-autoinducer

Download region SVG

Location: 2,676,661 - 2,697,301 nt. (total: 20,641 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000043.5	0.36	PKS	curacin A	Moorea producens 19L
BGC0002509.3	0.31	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0002026.3	0.31	NRPS, PKS	thaxteramide A1, thaxteramide A2, thaxteramide B1, thaxteramide B2	Jahnella sp. MSr9139
BGC0002713.2	0.29	NRPS	mevalagmapeptide A, mevalagmapeptide B, mevalagmapeptide C, mevalagmapeptide D	Photorhabdus laumondii subsp. laumondii
BGC0000668.5	0.26	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0002044.2	0.25	NRPS	empedopeptin	Massilia sp. YMA4
BGC0000997.4	0.24	NRPS, PKS	glidobactin, glidobactin B, glidobactin C	[Polyangium] brachysporum
BGC0002296.2	0.19	NRPS, PKS	vatiamide A, vatiamide B, vatiamide C, vatiamide D, vatiamide E, vatiamide F	Moorena producens ASI16Jul14-2
BGC0001558.5	0.19	PKS	cosmomycin C	Streptomyces sp. CNT302

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000043.5	0.36	PKS	curacin A	Moorea producens 19L
BGC0002509.3	0.31	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0002026.3	0.31	NRPS, PKS	thaxteramide A1, thaxteramide A2, thaxteramide B1, thaxteramide B2	Jahnella sp. MSr9139
BGC0002713.2	0.29	NRPS	mevalagmapeptide A, mevalagmapeptide B, mevalagmapeptide C, mevalagmapeptide D	Photorhabdus laumondii subsp. laumondii
BGC0000668.5	0.26	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0002044.2	0.25	NRPS	empedopeptin	Massilia sp. YMA4
BGC0000997.4	0.24	NRPS, PKS	glidobactin, glidobactin B, glidobactin C	[Polyangium] brachysporum
BGC0002296.2	0.19	NRPS, PKS	vatiamide A, vatiamide B, vatiamide C, vatiamide D, vatiamide E, vatiamide F	Moorena producens ASI16Jul14-2
BGC0001558.5	0.19	PKS	cosmomycin C	Streptomyces sp. CNT302

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.51 out of 23.79

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.06 out of 27.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.84 out of 24.78

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.89 out of 18.16

Confidence: strong

Additional weak hits (4):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.05 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.81 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 25.40 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response

NZ_LT732548.1 - Region 8 - lassopeptide

Download region SVG

Location: 2,772,086 - 2,794,541 nt. (total: 22,456 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

CZ379_RS16830: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002289.2	0.50	ribosomal	Leepeptin	Streptomyces leeuwenhoekii
BGC0000513.3	0.50	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000571.3	0.49	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002064.2	0.45	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0002575.2	0.43	ribosomal	cochonodin I	Streptococcus suis
BGC0000412.5	0.42	NRPS	pyochelin	Pseudomonas aeruginosa PAO1
BGC0002116.3	0.42	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002289.2	0.50	ribosomal	Leepeptin	Streptomyces leeuwenhoekii
BGC0000513.3	0.50	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000571.3	0.49	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002064.2	0.45	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0002575.2	0.43	ribosomal	cochonodin I	Streptococcus suis
BGC0000412.5	0.42	NRPS	pyochelin	Pseudomonas aeruginosa PAO1
BGC0002116.3	0.42	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 29.23 out of 36.54

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.30 out of 28.19

Confidence: medium

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 83; Score: 58.1

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
HgtR	Hydrogen-dependent regulator
ZuR variant 1	Zinc-responsive repressor

NZ_LT732548.1 - Region 9 - transAT-PKS

Download region SVG

Location: 2,884,362 - 3,007,641 nt. (total: 123,280 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CZ379_RS17390: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CZ379_RS17445: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CZ379_RS17460: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CZ379_RS17495: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase kinase methyltransferase

CZ379_RS17420: methyltransferase

smcogs: SMCOG1089: methyltransferase

CZ379_RS17430: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CZ379_RS17485: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CZ379_RS17490: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: hydrolase phosphatase

CZ379_RS17415: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

CZ379_RS17435: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

CZ379_RS17480: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Ligases: synthase

CZ379_RS17440: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CZ379_RS17450: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CZ379_RS17455: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CZ379_RS17470: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000174.5	0.59	PKS	bryostatin	Candidatus Endobugula sertula
BGC0001383.3	0.55	PKS	macrolactin H, macrolactin B, macrolactin 1c, macrolactin E	Jeotgalibacillus marinus
BGC0000181.5	0.54	PKS	macrolactin H	Bacillus velezensis FZB42
BGC0000173.5	0.51	PKS	isobongkrekic acid, bongkrekic acid	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000174.5	0.59	PKS	bryostatin	Candidatus Endobugula sertula
BGC0001383.3	0.55	PKS	macrolactin H, macrolactin B, macrolactin 1c, macrolactin E	Jeotgalibacillus marinus
BGC0000181.5	0.54	PKS	macrolactin H	Bacillus velezensis FZB42
BGC0000173.5	0.51	PKS	isobongkrekic acid, bongkrekic acid	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.55 out of 27.78

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.13 out of 20.97

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.88 out of 20.97

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.66 out of 27.78

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.92 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.61 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

Additional weak hits (10):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.37 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.05 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.72 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.81 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.64 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.78 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.45 out of 26.06

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.36 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 9, location 2884361 - 3007641:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal) + (mal - ohmal - ohmal - mal - mal - mal) + (ccmal - ccmal - Me-Me-ohmal) + (ccmal) + (ohmal - ccmal)
Non-colinear ordering:: CZ379_RS17435 + CZ379_RS17445 + CZ379_RS17450 + CZ379_RS17455 + CZ379_RS17470

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CZ379_RS17430: mal - mal

PKS_AT (12..295): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 27.1
inactive: 25.3
Methoxymalonyl-CoA: 12.0
Propionyl-CoA: 11.6
Isobutyryl-CoA: 9.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Methylmalonyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (338..615): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 87.3
inactive: 32.3
Methoxymalonyl-CoA: 24.4
Isobutyryl-CoA: 18.4
Methylmalonyl-CoA: 16.7
Propionyl-CoA: 9.8
fatty_acid: 9.2
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

CZ379_RS17485: mal

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 117.0
Methylmalonyl-CoA: 47.2
inactive: 45.4
Methoxymalonyl-CoA: 44.7
Propionyl-CoA: 33.0
Ethylmalonyl-CoA: 20.5
2-Methylbutyryl-CoA: 19.0
CHC-CoA: 15.6
fatty_acid: 14.4
trans-1,2-CPDA: 9.6
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_LT732548.1 - Region 10 - lanthipeptide-class-i

BGC0000535.4 (ADJ56352.1):

Download region SVG

Location: 3,427,360 - 3,453,752 nt. (total: 26,393 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

CZ379_RS19490: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

CZ379_RS19500: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000515.4	0.64	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000541.5	0.61	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.61	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000556.5	0.61	ribosomal	streptin	Streptococcus pyogenes
BGC0000538.3	0.60	ribosomal	nisin Z	Lactococcus lactis
BGC0001289.5	0.60	ribosomal	penisin	Paenibacillus ehimensis
BGC0000506.4	0.58	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000537.3	0.57	ribosomal	nisin U	Streptococcus uberis
BGC0001789.3	0.57	ribosomal	suicin 90-1330	Streptococcus suis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000515.4	0.64	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000541.5	0.61	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.61	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000556.5	0.61	ribosomal	streptin	Streptococcus pyogenes
BGC0000538.3	0.60	ribosomal	nisin Z	Lactococcus lactis
BGC0001289.5	0.60	ribosomal	penisin	Paenibacillus ehimensis
BGC0000506.4	0.58	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000537.3	0.57	ribosomal	nisin U	Streptococcus uberis
BGC0001789.3	0.57	ribosomal	suicin 90-1330	Streptococcus suis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for CZ379_RS19500

CZ379_RS19505

Leader:

MAKLDDFELDVQIKTSVSKVEPQ

Core:

ITSKSLCTPGCITGVLMCFTKGCEISHSCVKC

Core with dehydrations:

IDhbDhaKDhaLCysDhbPGCysIDhbGVLMCysFDhbKGCysEIDhaHDhaCysVKCys

antiSMASH-DB 4.0 matches for CZ379_RS19505

100.0%

NZ_LT732548.1:

Lanthipeptides: CZ379_RS19505_lanthipeptide

1

ITSKSLCTPGCITGVLMCFTKGCEISHSCVKC

32

ITSKSLCTPGCITGVLMCFTKGCEISHSCVKC

1

ITSKSLCTPGCITGVLMCFTKGCEISHSCVKC

32

96.9%

NZ_AULX01000006.1:

Lanthipeptides: H583_RS0100280_lanthipeptide

1

ITSKSLCTPGCITGVLMCFTKGCEISHSCVKC

32

ITSKSLCTPGCITGVLMCFTKGCEISHSC+KC

1

ITSKSLCTPGCITGVLMCFTKGCEISHSCIKC

32

69.7%

NZ_CP014140.1:

Lanthipeptides: ACH33_RS18880_lanthipeptide

1

ITSKSLCTPGCITGVLMCFTKGCEIS-HSCVKC

32

+TSKSLCTPGCITGVLMC T+ +S +SC+KC

1

VTSKSLCTPGCITGVLMCLTQNSCVSCNSCIKC

33

with 102 more sequence matches

Only the first 10 are displayed here.

66.7%

NC_006510.1and 4 others:

NZ_CP018058.1 Lanthipeptides: GT3921_RS18655_lanthipeptideNZ_CP025074.1 Lanthipeptides: CWI35_RS08795_lanthipeptideNZ_CP027303.2 Lanthipeptides: C1N76_RS05790_lanthipeptideNZ_CP038860.1 Lanthipeptides: E5Z46_RS04660_lanthipeptide

Lanthipeptides: GK_RS18085_lanthipeptide

1

ITSKSLCTPGCITGVLMCFTKGCEIS-HSCVKC

32

ITSKSLCTPGCITG+LMC T+ +S +SC++C

1

ITSKSLCTPGCITGILMCLTQNSCVSCNSCIRC

33

66.7%

NC_009328.1and 5 others:

NZ_CP014749.1 Lanthipeptides: A0V43_RS19510_lanthipeptideNZ_CP014749.1 Lanthipeptides: A0V43_RS19510_lanthipeptideNZ_CP017690.1 Lanthipeptides: GTID1_RS08690_lanthipeptideNZ_CP017694.1 Lanthipeptides: GD3902_RS07590_lanthipeptideNZ_PIJH01000004.1 Lanthipeptides: CV632_RS11810_lanthipeptide

Lanthipeptides: GTNG_RS18005_lanthipeptide

1

ITSKSLCTPGCITGVLMCFTKGCEIS-HSCVKC

32

+TSKSLCTPGCITGVLMC T+ +S +SC++C

1

VTSKSLCTPGCITGVLMCLTQNSCVSCNSCIRC

33

66.7%

NZ_CP023704.1:

Lanthipeptides: CQJ30_RS18315_lanthipeptide

1

ITSKSLCTPGCITGVLMCFTKGCEIS-HSCVKC

32

+TSKSLCTPGCITG+LMC T+ +S +SC+KC

1

VTSKSLCTPGCITGILMCLTQNSCVSCNSCIKC

33

62.5%

NZ_GG667191.1and 1 other:

NZ_GG667191.1 Lanthipeptides: HMPREF0298_RS11685_lanthipeptide

Lanthipeptides: HMPREF0298_RS11685_lanthipeptide

1

ITSKSLCTPGCITGVLMC--FTKGCEIS

26

ITSKSLCTPGCITG +MC TKGC +

1

ITSKSLCTPGCITGWMMCNTVTKGCSFT

28

58.8%

NZ_JALGRO010000002.1:

Lanthipeptides: MT346_RS01980_lanthipeptide

1

ITSKSLCTPGCITGVLMCFTK----GCEISHS

28

ITS SLCTPGC TG CFT GC IS S

1

ITSFSLCTPGCPTGGFACFTAACTGGCTISSS

32

58.8%

NZ_KE951497.1:

Lanthipeptides: allorf_8519_8683_lanthipeptide

1

ITSKSLCTPGCITGVLMCF----TKGCEISHSC

29

ITSK LCTPGC TG + CF T GC IS +C

1

ITSKFLCTPGCPTGGIACFTTQCTNGCSISVAC

33

58.8%

NZ_SNVW01000005.1:

Lanthipeptides: EDF64_RS09155_lanthipeptide

1

ITSKSLCTPGCITGVLMCFTK----GCEISHS

28

ITS SLCTPGC TG CFT GC IS S

1

ITSVSLCTPGCPTGGFACFTAACTGGCTISSS

32

57.6%

NZ_CP085954.1:

Lanthipeptides: LK411_RS13585_lanthipeptide

1

ITSKSLCTPGCITGVLMCFTKGCEISHSCV

30

ITSKSLCTPGC TG L CFT+ C+ ++ C

1

ITSKSLCTPGCPTGALGCFTQNCDPTNGCT

30

55.9%

NZ_CP009913.1and 1 other:

NZ_CP009913.1 Lanthipeptides: SSAL8618_RS00810_lanthipeptide

Lanthipeptides: SSAL8618_RS00815_lanthipeptide

1

ITSKSLCTPGCITGVLMCFTKGCEIS

26

ITS SLCTPGCITGVLM GC I

1

ITSYSLCTPGCITGVLM----GCHIQ

22

53.1%

NZ_CP021903.1and 20 others:

NZ_CP023409.1 Lanthipeptides: Bateq7PJ16_RS18530_lanthipeptideNZ_CP026036.1 Lanthipeptides: C2H93_RS15000_lanthipeptideNZ_CP028218.1 Lanthipeptides: C7M30_RS14555_lanthipeptideNZ_CP035167.1 Lanthipeptides: EQJ08_RS17140_lanthipeptideNZ_CP035226.1 Lanthipeptides: EQW70_RS18175_lanthipeptideNZ_CP045006.1 Lanthipeptides: F9B13_RS03875_lanthipeptideNZ_CP076083.1 Lanthipeptides: KFF76_RS16710_lanthipeptideNZ_CP079759.1 Lanthipeptides: KXZ66_RS17780_lanthipeptideNZ_CP080508.1 Lanthipeptides: K0V03_RS06525_lanthipeptideNZ_CP089148.1 Lanthipeptides: LRO88_RS19055_lanthipeptideNZ_JALAUA010000003.1 Lanthipeptides: MOD32_RS04985_lanthipeptideNZ_JALAVX010000009.1 Lanthipeptides: MOE40_RS09385_lanthipeptideNZ_JAMYDW010000007.1 Lanthipeptides: NHM07_RS16180_lanthipeptideNZ_JAQOXM010000001.1 Lanthipeptides: PO770_RS03875_lanthipeptideNZ_NJRD01000003.1 Lanthipeptides: CE053_RS07200_lanthipeptideNZ_NJRE01000008.1 Lanthipeptides: CE047_RS18435_lanthipeptideNZ_SORJ01000001.1 Lanthipeptides: BJ795_RS01490_lanthipeptideNZ_VFNF01000001.1 Lanthipeptides: FB592_RS01525_lanthipeptideNZ_VIOH01000001.1 Lanthipeptides: FLN47_RS03850_lanthipeptideNZ_VLJL01000012.1 Lanthipeptides: L604_RS09425_lanthipeptide

Lanthipeptides: CD007_RS17065_lanthipeptide

3

SKSLCTPGCITGVLM-CFTK----GCEISH

27

S+SLCTPGC+TGVL CF + C+IS

3

SESLCTPGCVTGVLQTCFLQTITCNCKISK

32

MIBiG 4.0 matches for CZ379_RS19505

41.2%

Lanthipeptide: nisin A

1

ITSKSLCTPGCITGVLM

17

ITS SLCTPGC TG LM

1

ITSISLCTPGCKTGALM

17

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.07 out of 18.46

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.01 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.24 out of 26.06

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.85 out of 23.79

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.67 out of 26.06

Confidence: medium

Additional weak hits (4):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 25.82 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.50 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.80 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.67 out of 29.65

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

CZ379_RS19505 - Class I

Cleavage pHMM score: 10.20

RODEO score: 28

Monoisotopic mass: 3204.6 Da

Molecular weight: 3206.9 Da

Number of bridges: 6

Alternative weights: (assuming N unmodified Ser/Thr residues); 3224.9 Da N = 1; 3242.9 Da N = 2

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 155 - 241; Score: 54.4

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence

NZ_LT732548.1 - Region 11 - NRP-metallophore,NRPS,lanthipeptide-class-iii

Download region SVG

Location: 3,513,335 - 3,586,215 nt. (total: 72,881 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CZ379_RS19965: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

CZ379_RS19840: methyltransferase

smcogs: SMCOG1089: methyltransferase

CZ379_RS19995: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: hydrolase

CZ379_RS19950: isochorismatase

smcogs: SMCOG1027: isochorismatase

CZ379_RS19990: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

CZ379_RS20035: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Isomerases: isomerase

CZ379_RS19960: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

CZ379_RS19945: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CZ379_RS19955: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000401.5	1.03	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001185.5	1.01	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	0.97	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0000343.5	0.85	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.74	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000401.5	0.79	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001185.5	0.79	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	0.78	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0000343.5	0.74	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002695.2	0.69	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.79 out of 23.79

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 26.51 out of 32.74

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.16 out of 28.19

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 25.31

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.23 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.22 out of 29.38

Confidence: medium

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 28.01 out of 32.74

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.99 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.30 out of 28.19

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.59 out of 32.93

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.35 out of 24.78

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.75 out of 23.05

Confidence: medium

Additional weak hits (18):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.05 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.07 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.56 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.09 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.05 out of 32.74

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.28 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.54 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.73 out of 30.97

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.23 out of 29.51

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.20 out of 36.54

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.87 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.59 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.64 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.61 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.25 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 11, location 3513334 - 3586215:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala - Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 12, location 3513334 - 3565509:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala - Thr)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CZ379_RS19945: Ala - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (465..867): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LDMTFDISVLELQAISGGENNQYGPTETTIYSTA
Nearest Stachelhaus code(s):: Ala DILQIGQIYK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1538..1954): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQIFGGEINMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

CZ379_RS19955: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..474): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SLSLYPLSSPGGALQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVVNK (97% 8Å match); diOH-Bz or Sal PLPAQGVVNK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor
FuR variant 1	Ferric Uptake Regulator
FuR variant 2	Ferric Uptake Regulator
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
LexA variant 3	Repressor of DNA damage response
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_LT732548.1 - Region 12 - RiPP-like

Download region SVG

Location: 3,781,672 - 3,793,606 nt. (total: 11,935 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000527.5	0.36	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001146.5	0.34	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001173.5	0.33	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000569.5	0.33	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0000607.5	0.32	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001145.5	0.32	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002026.3	0.31	NRPS, PKS	thaxteramide A1, thaxteramide A2, thaxteramide B1, thaxteramide B2	Jahnella sp. MSr9139
BGC0000483.5	0.30	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000603.5	0.30	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000557.5	0.30	ribosomal	streptococcin A-FF22	Streptococcus pyogenes

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000527.5	0.36	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001146.5	0.34	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001173.5	0.33	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000569.5	0.33	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0000607.5	0.32	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001145.5	0.32	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002026.3	0.31	NRPS, PKS	thaxteramide A1, thaxteramide A2, thaxteramide B1, thaxteramide B2	Jahnella sp. MSr9139
BGC0000483.5	0.30	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000603.5	0.30	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000557.5	0.30	ribosomal	streptococcin A-FF22	Streptococcus pyogenes

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.90 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.02 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.06 out of 28.19

Confidence: medium

Additional weak hits (1):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.21 out of 30.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ZuR variant 1	Zinc-responsive repressor

NZ_LT732548.1 - Region 13 - terpene-precursor

Download region SVG

Location: 4,410,046 - 4,432,430 nt. (total: 22,385 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

CZ379_RS24235: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Ligases: synthetase

CZ379_RS24205: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000643.3	0.35	terpene	carotenoid	Brevundimonas vesicularis
BGC0001456.3	0.33	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.31	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000452.5	0.29	NRPS	tyrocidine	Brevibacillus brevis NBRC 100599
BGC0000649.3	0.29	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000222.5	0.24	PKS	FD-594	Streptomyces sp. TA-0256
BGC0000864.3	0.22	other (other)	eicosapentaenoic acid-like compound	Moritella marina ATCC 15381
BGC0000106.5	0.21	PKS	naphthomycin A	Streptomyces sp. CS

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000643.3	0.35	terpene	carotenoid	Brevundimonas vesicularis
BGC0001456.3	0.33	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.31	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000452.5	0.29	NRPS	tyrocidine	Brevibacillus brevis NBRC 100599
BGC0000649.3	0.29	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000222.5	0.24	PKS	FD-594	Streptomyces sp. TA-0256
BGC0000864.3	0.22	other (other)	eicosapentaenoic acid-like compound	Moritella marina ATCC 15381
BGC0000106.5	0.21	PKS	naphthomycin A	Streptomyces sp. CS

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

CZ379_RS24205: PT_FPPS_like

Domain 1 (535 - 758): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

Additional weak hits (1):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 25.75

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_LT732548.1 - Region 14 - NRPS,T1PKS

Download region SVG

Location: 4,461,665 - 4,543,001 nt. (total: 81,337 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CZ379_RS24515: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CZ379_RS24530: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Hydrolases: esterase hydrolase phosphatase

CZ379_RS24475: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

CZ379_RS24525: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

CZ379_RS24535: thioesterase

smcogs: SMCOG1004: thioesterase

CZ379_RS24540: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase synthase

CZ379_RS24490: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CZ379_RS24495: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CZ379_RS24500: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CZ379_RS24505: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CZ379_RS24510: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CZ379_RS24545: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

CZ379_RS24575: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001876.2	0.73	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328
BGC0000426.5	0.72	NRPS	sevadicin	Paenibacillus larvae
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0001250.4	0.70	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.70	NRPS	epichloenin A	Epichloe festucae
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001876.2	0.69	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328
BGC0000426.5	0.69	NRPS	sevadicin	Paenibacillus larvae
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001250.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.14 out of 20.97

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.75 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.36 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.13 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.44 out of 28.19

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.20 out of 20.01

Confidence: medium

Additional weak hits (10):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.75 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.77 out of 31.73

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.54 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.96 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.29 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.56 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.13 out of 25.88

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.11 out of 28.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 16, location 4461664 - 4543001:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (Leu - ohmal - Leu) + (ohmal) + (pk - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CZ379_RS24490: mal

PKS_AT (535..821): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 159.2
inactive: 93.9
Methoxymalonyl-CoA: 59.2
Methylmalonyl-CoA: 57.0
Propionyl-CoA: 42.4
Isobutyryl-CoA: 30.7
Ethylmalonyl-CoA: 26.6
2-Methylbutyryl-CoA: 24.4
Benzoyl-CoA: 14.4
fatty_acid: 13.9
CHC-CoA: 12.7
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

CZ379_RS24495: pk - mal

PKS_AT (534..797): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 42.8
Malonyl-CoA: 40.4
Methoxymalonyl-CoA: 19.2
Methylmalonyl-CoA: 17.9
Propionyl-CoA: 10.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (1531..1828): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 167.7
inactive: 122.4
Methoxymalonyl-CoA: 70.0
Methylmalonyl-CoA: 59.0
Propionyl-CoA: 34.6
Ethylmalonyl-CoA: 25.2
2-Methylbutyryl-CoA: 23.0
Benzoyl-CoA: 17.8
CHC-CoA: 16.9
fatty_acid: 10.8
Isobutyryl-CoA: 10.6
trans-1,2-CPDA: 9.9
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

CZ379_RS24500: mal

PKS_AT (538..834): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 153.6
inactive: 81.3
Methoxymalonyl-CoA: 62.3
Methylmalonyl-CoA: 49.8
Propionyl-CoA: 33.4
Ethylmalonyl-CoA: 21.6
2-Methylbutyryl-CoA: 19.7
Isobutyryl-CoA: 19.3
CHC-CoA: 16.4
trans-1,2-CPDA: 11.6
fatty_acid: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

CZ379_RS24505: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (278..663): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDASVWEPFLLTGGEFNNYGPTENTVVTTF
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

CZ379_RS24510: Leu - mal

Search NORINE for peptide: strict or relaxed

AMP-binding (479..873): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNTGFDALTFEGLLVVGGDWNAYGPTENTVISTC
Nearest Stachelhaus code(s):: Leu DALLVGAVAK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

PKS_AT (1614..1906): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%; Ethylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 128.5
inactive: 77.6
Methoxymalonyl-CoA: 66.3
Methylmalonyl-CoA: 57.4
Isobutyryl-CoA: 50.5
Ethylmalonyl-CoA: 33.4
Propionyl-CoA: 30.7
CHC-CoA: 28.8
fatty_acid: 12.8
Benzoyl-CoA: 11.8
3-Methylbutyryl-CoA: 10.9
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

CZ379_RS24545: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (456..850): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGEYNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)