GCF_900116555.1 - 17 region(s)

Download region SVG

Location: 1 - 18,819 nt. (total: 18,819 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BM394_RS13470: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: methyltransferase

BM394_RS13490: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: protease

BM394_RS13505: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

BM394_RS13495: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.80	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001210.5	0.41	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001779.5	0.41	ribosomal	siamycin	Streptomyces nodosus
BGC0002700.2	0.41	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.40	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000626.3	0.40	ribosomal	thuricin	Bacillus thuringiensis
BGC0000496.5	0.40	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.80	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001210.5	0.41	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001779.5	0.41	ribosomal	siamycin	Streptomyces nodosus
BGC0002700.2	0.41	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.40	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000626.3	0.40	ribosomal	thuricin	Bacillus thuringiensis
BGC0000496.5	0.40	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

BM394_RS13495: T1TS + T1TS

Domain 1 (3 - 329): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (338 - 711): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

Additional weak hits (1):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.80 out of 26.85

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_FPAT01000010.1 - Region 1 - NRPS,arylpolyene

Download region SVG

Location: 60,405 - 142,487 nt. (total: 82,083 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase reductase

BM394_RS17140: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

BM394_RS17275: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BM394_RS17325: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Transferases: kinase

BM394_RS17105: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: deaminase

BM394_RS17240: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: cyclase lyase

BM394_RS17315: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

BM394_RS17320: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

BM394_RS17165: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BM394_RS17180: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BM394_RS17215: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BM394_RS17225: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BM394_RS17245: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

BM394_RS17260: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BM394_RS17265: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002192.3	0.50	PKS	FR901512	fungal sp. No.14919
BGC0001273.3	0.50	PKS	asperlactone	Aspergillus ochraceus
BGC0001254.3	0.47	PKS	ACT-Toxin II	Alternaria alternata
BGC0002075.3	0.44	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.40	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.40	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.40	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.39	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000426.5	0.39	NRPS	sevadicin	Paenibacillus larvae
BGC0002286.3	0.39	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000426.5	0.71	NRPS	sevadicin	Paenibacillus larvae
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001133.4	0.70	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

Additional weak hits (10):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.09 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.63 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.72 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.77 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.98 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.92 out of 20.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.96 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.26 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.76 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.89 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 60404 - 142487:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ala - D-Ser) + (D-Leu - Val - X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 60404 - 101559:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ala - D-Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 78437 - 142487:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ala - D-Ser) + (D-Leu - Val - X - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BM394_RS17165: X

AMP-binding (41..463): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NMLLFGGNHN-LVNLYAGAVSSWGATETGPAATS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

BM394_RS17260: Ala - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (466..861): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFEGSAVLAGEANIYGPTEATVYATA
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1979..2383): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWELHFICSGEHNLYGPTEASVDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

BM394_RS17265: Leu - Val - X - X

Search NORINE for peptide: strict or relaxed

AMP-binding (462..856): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FTESFDASVLEMLIIVGGDRNAYGPTEITVAATI
Nearest Stachelhaus code(s):: Leu DALLIGAVAK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1992..2385): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDGSFDASTYEVWLWTGGDGDGYGPTETTTFATR
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3042..3458): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISVWQAEVMVTGEVNAYGPTECSDDVTH
Nearest Stachelhaus code(s):: Dpr DIWEMTADDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4115..4509): X

nrpys: bMe-Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YFGSFDLSVTAVKGLLGGEFNMYGPTETTVNCTE
Nearest Stachelhaus code(s):: bMe-Asp DLTKLGMVNK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_FPAT01000004.1 - Region 1 - RRE-containing

Download region SVG

Location: 162,484 - 182,684 nt. (total: 20,201 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxidoreductase

BM394_RS09115: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

BM394_RS09175: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: methyltransferase

BM394_RS09120: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: phosphatase

BM394_RS09125: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Isomerases: isomerase

BM394_RS09145: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

BM394_RS09180: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.56	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000249.5	0.43	PKS	nogalamycin	Streptomyces nogalater
BGC0002128.3	0.43	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0000913.3	0.41	other (other)	MK-8	Enterobacter cloacae
BGC0000597.4	0.40	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000243.4	0.38	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0000595.3	0.38	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001335.5	0.37	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0001227.3	0.37	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001334.5	0.37	other (other)	caldoniamide A, cladoniamide B, cladoniamide C7, cladoniamide D, cladoniamide E, cladoniamide F, cladoniamide G	Streptomyces uncialis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.56	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000249.5	0.43	PKS	nogalamycin	Streptomyces nogalater
BGC0002128.3	0.43	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0000913.3	0.41	other (other)	MK-8	Enterobacter cloacae
BGC0000597.4	0.40	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000243.4	0.38	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0000595.3	0.38	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001335.5	0.37	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0001227.3	0.37	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001334.5	0.37	other (other)	caldoniamide A, cladoniamide B, cladoniamide C7, cladoniamide D, cladoniamide E, cladoniamide F, cladoniamide G	Streptomyces uncialis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (3):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.08 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.59 out of 20.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.01 out of 36.53

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 9 - 64; Score: 40.5

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_FPAT01000004.1 - Region 2 - NI-siderophore

Download region SVG

Location: 415,392 - 437,633 nt. (total: 22,242 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

BM394_RS10350: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

BM394_RS10385: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Hydrolases: hydrolase

BM394_RS10345: hydrolase

smcogs: SMCOG1179: hydrolase

Lyases: decarboxylase

BM394_RS10380: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.82	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.76	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.72	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000940.5	0.65	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.65	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002690.2	0.61	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0001531.5	0.54	other (other)	bisucaberin B	Tenacibaculum mesophilum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.82	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.76	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.72	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000940.5	0.65	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.65	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002690.2	0.61	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0001531.5	0.54	other (other)	bisucaberin B	Tenacibaculum mesophilum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

Additional weak hits (9):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.72 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.74 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.86 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.69 out of 36.53

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.50 out of 31.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.97 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein

NZ_FPAT01000008.1 - Region 1 - terpene-precursor

Download region SVG

Location: 149,852 - 170,973 nt. (total: 21,122 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

BM394_RS15565: acyltransferase

smcogs: SMCOG1141: acyltransferase

Ligases: synthetase

BM394_RS15535: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus
BGC0001456.3	0.34	terpene	isorenieratene	Streptomyces argillaceus
BGC0001910.4	0.33	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001483.4	0.33	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000664.5	0.33	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000936.5	0.32	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1
BGC0000633.3	0.32	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.32	terpene	isorenieratene	Streptomyces collinus Tu 365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus
BGC0001456.3	0.34	terpene	isorenieratene	Streptomyces argillaceus
BGC0001910.4	0.33	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001483.4	0.33	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000664.5	0.33	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000936.5	0.32	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1
BGC0000633.3	0.32	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.32	terpene	isorenieratene	Streptomyces collinus Tu 365

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BM394_RS15535: PT_FPPS_like

Domain 1 (53 - 352): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.64 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.33 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.46 out of 24.78

Confidence: medium

Additional weak hits (12):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.82 out of 28.14

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.34 out of 29.51

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.79 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.18 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.38 out of 26.85

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.10 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.21 out of 20.01

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response

NZ_FPAT01000011.1 - Region 1 - terpene

Download region SVG

Location: 90,941 - 136,078 nt. (total: 45,138 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BM394_RS18105: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BM394_RS18165: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

BM394_RS18185: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase transketolase

BM394_RS18055: transketolase

smcogs: SMCOG1204: transketolase

BM394_RS18170: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: dehydratase

BM394_RS18200: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase synthetase

BM394_RS18080: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

BM394_RS18190: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.64	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000663.5	0.60	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000649.3	0.59	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000645.3	0.57	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000633.3	0.54	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.54	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000643.3	0.50	terpene	carotenoid	Brevundimonas vesicularis
BGC0001456.3	0.50	terpene	isorenieratene	Streptomyces argillaceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.64	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000663.5	0.60	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000649.3	0.59	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000645.3	0.57	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000633.3	0.54	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.54	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000643.3	0.50	terpene	carotenoid	Brevundimonas vesicularis
BGC0001456.3	0.50	terpene	isorenieratene	Streptomyces argillaceus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

BM394_RS23785: PT_phytoene_like

Domain 1 (14 - 238): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

BM394_RS23790: PT_phytoene_like

Domain 1 (13 - 289): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

BM394_RS18080: PT_FPPS_like

Domain 1 (50 - 334): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

BM394_RS18085: T2TS

Domain 1 (10 - 631): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

BM394_RS18180: PT_phytoene_like

Domain 1 (16 - 317): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.05 out of 20.97

Confidence: medium

Additional weak hits (9):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.27 out of 25.88

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.62 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.29 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.05 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.67 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A

NZ_FPAT01000006.1 - Region 1 - linaridin

Download region SVG

Location: 234,773 - 256,188 nt. (total: 21,416 nt) Show pHMM detection rules used

linaridin: (cypemycin or cypI)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BM394_RS13300: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Translocases: transport

BM394_RS13310: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001735.5	0.36	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0002138.2	0.36	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0000679.5	0.31	terpene	diazepinomicin	Micromonospora sp. M42
BGC0002381.3	0.30	PKS, other (other)	tambjamine BE-18591	Streptomyces albus subsp. albus
BGC0001335.5	0.29	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0001797.3	0.27	ribosomal	telomestatin	Streptomyces anulatus
BGC0001330.5	0.26	NRPS, PKS	BE-43547A1, BE-43547A2, BE-43547B1, BE-43547B2, BE-43547B3, BE-43547C1, BE-43547C2	Micromonospora sp. RV43
BGC0001848.4	0.24	other (other)	diazaquinomycin H, diazaquinomycin J	Micromonospora sp. B006
BGC0001828.5	0.24	PKS	griseochelin	Streptomyces griseus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001735.5	0.36	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0002138.2	0.36	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0000679.5	0.31	terpene	diazepinomicin	Micromonospora sp. M42
BGC0002381.3	0.30	PKS, other (other)	tambjamine BE-18591	Streptomyces albus subsp. albus
BGC0001335.5	0.29	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0001797.3	0.27	ribosomal	telomestatin	Streptomyces anulatus
BGC0001330.5	0.26	NRPS, PKS	BE-43547A1, BE-43547A2, BE-43547B1, BE-43547B2, BE-43547B3, BE-43547C1, BE-43547C2	Micromonospora sp. RV43
BGC0001848.4	0.24	other (other)	diazaquinomycin H, diazaquinomycin J	Micromonospora sp. B006
BGC0001828.5	0.24	PKS	griseochelin	Streptomyces griseus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

Additional weak hits (7):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.16 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.97 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.97 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.35 out of 26.06

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.26 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.97 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_FPAT01000002.1 - Region 1 - ectoine

Download region SVG

Location: 96,061 - 106,453 nt. (total: 10,393 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

BM394_RS03965: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000853.3	0.65	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.64	other (ectoine)	ectoine	Streptomyces sp.
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000852.5	0.57	other (other)	ectoine	Sporosarcina pasteurii
BGC0000856.3	0.55	other (other)	ectoine	Methylophaga thalassica
BGC0000854.3	0.55	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000853.3	0.65	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.64	other (ectoine)	ectoine	Streptomyces sp.
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000852.5	0.57	other (other)	ectoine	Sporosarcina pasteurii
BGC0000856.3	0.55	other (other)	ectoine	Methylophaga thalassica
BGC0000854.3	0.55	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.84 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.65 out of 24.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.23 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_FPAT01000002.1 - Region 2 - NI-siderophore,lassopeptide

Download region SVG

Location: 311,003 - 355,515 nt. (total: 44,513 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BM394_RS04900: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

BM394_RS04905: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BM394_RS04910: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

BM394_RS04925: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: glycosyltransferase

BM394_RS05050: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase

BM394_RS04890: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

BM394_RS04930: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002053.3	0.39	ribosomal	ulleungdin	Streptomyces sp.
BGC0001779.5	0.37	ribosomal	siamycin	Streptomyces nodosus
BGC0001655.3	0.35	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0002307.3	0.34	ribosomal	humidimycin	Streptomyces humidus
BGC0002015.4	0.33	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001920.4	0.32	ribosomal	siamycin I	Streptomyces sp.
BGC0001674.5	0.32	ribosomal	MS-271	Streptomyces mirabilis
BGC0001660.3	0.30	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001539.4	0.29	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001579.4	0.29	ribosomal	duramycin	Streptomyces cinnamoneus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002053.3	0.71	ribosomal	ulleungdin	Streptomyces sp.
BGC0001539.4	0.63	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001507.3	0.61	ribosomal	anantin C	Streptomyces olindensis
BGC0001493.5	0.60	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001506.5	0.60	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001779.5	0.59	ribosomal	siamycin	Streptomyces nodosus
BGC0001548.4	0.59	ribosomal	citrulassin A	Streptomyces albulus
BGC0001552.3	0.58	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001550.3	0.57	ribosomal	citrulassin D	Streptomyces katrae
BGC0001549.3	0.57	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.52 out of 25.88

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.30 out of 28.19

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.41 out of 27.04

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (11):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.14 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.44 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.16 out of 20.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.55 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.53 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.26 out of 32.74

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.93 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.90 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.94 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.82 out of 35.63

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 83; Score: 65.4

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DasR	N-acetylglucosamine dependent repressor
PsrA	Oleic acid responsive regulator
ZuR variant 1	Zinc-responsive repressor

NZ_FPAT01000002.1 - Region 3 - amglyccycl

Download region SVG

Location: 525,073 - 546,302 nt. (total: 21,230 nt) Show pHMM detection rules used

amglyccycl: (DOIS or ValA or salQ or strH or strK1 or strK2 or NeoL or SpcFG or SpcDK_glyc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BM394_RS05925: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

BM394_RS05930: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BM394_RS05945: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

BM394_RS05950: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: acyltransferase glycosyltransferase transferase

BM394_RS05885: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

BM394_RS05890: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

BM394_RS05905: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

BM394_RS05955: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Hydrolases: hydrolase

BM394_RS05940: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: synthase

BM394_RS05915: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000701.5	0.54	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0000723.5	0.47	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus
BGC0000722.5	0.46	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. jinggangensis
BGC0001586.3	0.44	saccharide	EPS273	Pseudomonas stutzeri
BGC0000795.3	0.44	saccharide	S-layer glycan	Aneurinibacillus thermoaerophilus
BGC0001412.3	0.43	saccharide	polysaccharide C	Bacteroides fragilis
BGC0000790.3	0.43	saccharide	O-antigen	Escherichia coli
BGC0002302.2	0.42	saccharide	glucorhamnan	[Ruminococcus] gnavus ATCC 29149
BGC0000791.3	0.42	saccharide	O-antigen	Cronobacter sakazakii
BGC0000794.5	0.42	saccharide	S-layer glycan	Geobacillus stearothermophilus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000701.5	0.54	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0000723.5	0.47	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus
BGC0000722.5	0.46	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. jinggangensis
BGC0001586.3	0.44	saccharide	EPS273	Pseudomonas stutzeri
BGC0000795.3	0.44	saccharide	S-layer glycan	Aneurinibacillus thermoaerophilus
BGC0001412.3	0.43	saccharide	polysaccharide C	Bacteroides fragilis
BGC0000790.3	0.43	saccharide	O-antigen	Escherichia coli
BGC0002302.2	0.42	saccharide	glucorhamnan	[Ruminococcus] gnavus ATCC 29149
BGC0000791.3	0.42	saccharide	O-antigen	Cronobacter sakazakii
BGC0000794.5	0.42	saccharide	S-layer glycan	Geobacillus stearothermophilus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.81 out of 18.57

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.20 out of 19.26

Confidence: medium

Additional weak hits (11):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.01 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.07 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.43 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.30 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.76 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.14 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.35 out of 39.62

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.56 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
ToxT	Regulator of MSHA biosynthesis

NZ_FPAT01000005.1 - Region 1 - T1PKS

Download region SVG

Location: 20,623 - 67,144 nt. (total: 46,522 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BM394_RS10705: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acetyltransferase aminotransferase glycosyltransferase methyltransferase transferase

BM394_RS10550: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

BM394_RS10625: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

BM394_RS10645: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

BM394_RS10660: methyltransferase

smcogs: SMCOG1089: methyltransferase

BM394_RS10665: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Lyases: cyclase

BM394_RS10575: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase synthase

BM394_RS10630: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BM394_RS10635: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.52 out of 23.79

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 25.31

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.48 out of 23.79

Confidence: medium

Additional weak hits (24):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.65 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.36 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.95 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.56 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.49 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.52 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.27 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.08 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.79 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.14 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.82 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.83 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.66 out of 23.43

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.14 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.40 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.54 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.47 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.52 out of 27.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.21 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 20622 - 67144:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BM394_RS10630: mmal

PKS_AT (617..901): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; Methylmalonyl-CoA: 62.5%; Propionyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 94.8
Malonyl-CoA: 83.3
Methoxymalonyl-CoA: 82.1
Ethylmalonyl-CoA: 76.1
Propionyl-CoA: 57.7
trans-1,2-CPDA: 56.7
fatty_acid: 56.5
Acetyl-CoA: 46.0
Isobutyryl-CoA: 45.8
2-Methylbutyryl-CoA: 43.6
CHC-CoA: 34.7
Benzoyl-CoA: 33.1
inactive: 21.7
3-Methylbutyryl-CoA: 11.4

BM394_RS10635: Acetyl-CoA

CAL_domain (53..493): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 45.6
AHBA: 23.1
fatty_acid: 22.7
shikimic_acid: 17.1
NH2: 10.4

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism

NZ_FPAT01000001.1 - Region 1 - terpene

Download region SVG

Location: 26,380 - 51,131 nt. (total: 24,752 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BM394_RS00215: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: glycosyltransferase

BM394_RS00210: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Lyases: cyclase

BM394_RS00165: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthetase

BM394_RS00175: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.76	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000657.5	0.58	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001526.4	0.41	other (other)	bartoloside E, bartoloside F, bartoloside G, bartoloside H, bartoloside I, bartoloside J, bartoloside K	Synechocystis salina LEGE 06099
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000644.3	0.37	terpene	carotenoid	Dietzia sp. CQ4
BGC0000665.5	0.36	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000636.3	0.34	terpene	carotenoid	Brevibacterium linens
BGC0000663.5	0.34	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000653.5	0.34	terpene	pentalenolactone	Streptomyces arenae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.76	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000657.5	0.58	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001526.4	0.41	other (other)	bartoloside E, bartoloside F, bartoloside G, bartoloside H, bartoloside I, bartoloside J, bartoloside K	Synechocystis salina LEGE 06099
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000644.3	0.37	terpene	carotenoid	Dietzia sp. CQ4
BGC0000665.5	0.36	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000636.3	0.34	terpene	carotenoid	Brevibacterium linens
BGC0000663.5	0.34	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000653.5	0.34	terpene	pentalenolactone	Streptomyces arenae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BM394_RS00165: T1TS + T1TS

Domain 1 (2 - 330): Type 1 terpene synthase

Subtype: unknown

Domain 2 (391 - 686): Type 1 terpene synthase

Subtype: unknown

BM394_RS00175: PT_FPPS_like

Domain 1 (57 - 342): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.25 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.85 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.45 out of 28.19

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.74 out of 27.18

Confidence: medium

Additional weak hits (11):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.70 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.94 out of 23.43

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.41 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.20 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.33 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.77 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.14 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.39 out of 39.62

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.51 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.60 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.86 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
NrdR	Represses ribonucleotide reductase encoding genes
ZuR variant 1	Zinc-responsive repressor

NZ_FPAT01000001.1 - Region 2 - terpene

Download region SVG

Location: 145,969 - 168,645 nt. (total: 22,677 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BM394_RS00760: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Lyases: cyclase

BM394_RS00735: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthetase

BM394_RS00730: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002707.2	0.49	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002309.2	0.48	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002283.2	0.43	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.43	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0001911.3	0.42	terpene	raimonol	Streptomyces anulatus
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0001910.4	0.41	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000542.3	0.39	ribosomal	paenicidin B	Paenibacillus terrae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002707.2	0.49	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002309.2	0.48	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002283.2	0.43	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.43	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0001911.3	0.42	terpene	raimonol	Streptomyces anulatus
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0001910.4	0.41	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000542.3	0.39	ribosomal	paenicidin B	Paenibacillus terrae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BM394_RS00730: PT_FPPS_like

Domain 1 (66 - 372): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

BM394_RS00735: T1TS

Domain 1 (5 - 315): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 22.78 out of 26.33

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.30 out of 20.97

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

Additional weak hits (4):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.92 out of 30.22

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.29 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.36 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
RpoN	Regulator of nitrogen assimilation and virulence

NZ_FPAT01000001.1 - Region 3 - butyrolactone

Download region SVG

Location: 174,257 - 185,216 nt. (total: 10,960 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BM394_RS00820: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: glycosyltransferase

BM394_RS00835: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.61	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000849.4	0.58	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002578.2	0.43	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000277.5	0.37	PKS	urdamycin	Streptomyces fradiae
BGC0001302.5	0.34	other (other)	lomofungin	Streptomyces lomondensis
BGC0001726.4	0.32	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0002434.2	0.32	NRPS, PKS	clifednamide D, clifednamide E, clifednamide F, clifednamide G, clifednamide H, clifednamide I, clifednamide J	Kitasatospora sp.
BGC0000666.5	0.32	terpene	xiamycin A	Streptomyces sp. SCSIO 02999

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.61	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000849.4	0.58	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002578.2	0.43	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000277.5	0.37	PKS	urdamycin	Streptomyces fradiae
BGC0001302.5	0.34	other (other)	lomofungin	Streptomyces lomondensis
BGC0001726.4	0.32	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0002434.2	0.32	NRPS, PKS	clifednamide D, clifednamide E, clifednamide F, clifednamide G, clifednamide H, clifednamide I, clifednamide J	Kitasatospora sp.
BGC0000666.5	0.32	terpene	xiamycin A	Streptomyces sp. SCSIO 02999

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (3):

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.99 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.59 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.52 out of 29.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_FPAT01000001.1 - Region 4 - NRPS-like,RiPP-like,T1PKS,butyrolactone,terpene

Download region SVG

Location: 463,289 - 562,007 nt. (total: 98,719 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
butyrolactone: AfsA
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase synthase

BM394_RS02060: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

BM394_RS02110: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BM394_RS02120: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BM394_RS02175: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

BM394_RS02210: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

BM394_RS02245: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

BM394_RS02300: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

BM394_RS02330: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BM394_RS02335: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

BM394_RS02350: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

BM394_RS02355: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

BM394_RS02370: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BM394_RS02395: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Hydrolases: synthase

BM394_RS02060: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Lyases: cyclase

BM394_RS02085: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase synthetase

BM394_RS02075: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

BM394_RS02125: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

BM394_RS02220: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BM394_RS02325: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BM394_RS02345: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

BM394_RS02190: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

BM394_RS02340: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000204.5	0.63	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0001181.4	0.54	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000678.5	0.48	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000056.3	0.48	PKS	esperamicin	Actinomadura verrucosospora
BGC0000195.5	0.48	PKS	alnumycin A, alnumycin B, alnumycin C, alnumycin P, prealnumycin, thalnumycin A, thalnumycin B, K1115A, 1,6-dihydro-8-propylanthraquinone	Streptomyces sp. CM020
BGC0001622.5	0.47	PKS	isatropolone A, isotropolone B, isotropolone C	Streptomyces sp.
BGC0001078.5	0.46	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988
BGC0000224.4	0.46	PKS	fredericamycin A	Streptomyces griseus
BGC0000225.5	0.45	PKS	frenolicin B	Streptomyces roseofulvus
BGC0000194.5	0.44	PKS	actinorhodin	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000056.3	0.66	PKS	esperamicin	Actinomadura verrucosospora
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

BM394_RS02075: PT_FPPS_like

Domain 1 (62 - 346): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

BM394_RS02085: T1TS + T1TS

Domain 1 (2 - 335): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (336 - 714): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.74 out of 23.79

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.54 out of 24.78

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.89 out of 23.43

Confidence: medium

Additional weak hits (28):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.20 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.44 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.46 out of 27.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.84 out of 28.14

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.86 out of 30.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.94 out of 33.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.69 out of 20.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.02 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.20 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.01 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.92 out of 23.43

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.37 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.46 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.68 out of 39.62

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.29 out of 26.85

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.60 out of 30.22

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.26 out of 18.57

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.86 out of 30.22

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.64 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.38 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.04 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.47 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.05 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 463288 - 562007:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpg)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 520240 - 562007:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpg)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BM394_RS02220: mal

PKS_AT (619..849): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 67.7
Methoxymalonyl-CoA: 45.2
Methylmalonyl-CoA: 41.7
Propionyl-CoA: 31.2
inactive: 26.8
Isobutyryl-CoA: 24.9
Ethylmalonyl-CoA: 19.9
fatty_acid: 16.9
trans-1,2-CPDA: 12.9
CHC-CoA: 10.1
Benzoyl-CoA: 7.7
2-Methylbutyryl-CoA: 7.2
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BM394_RS02325: Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (9..405): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRAFNVSTYEVHLLTGGDRCMYGATELTLFSTH
Nearest Stachelhaus code(s):: Hpg NVYHLGMLFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C

NZ_FPAT01000001.1 - Region 5 - NRPS-like,betalactone,hglE-KS

Download region SVG

Location: 599,451 - 681,015 nt. (total: 81,565 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BM394_RS02605: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BM394_RS02645: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

BM394_RS02740: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BM394_RS02765: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase methyltransferase

BM394_RS02615: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BM394_RS02860: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deacetylase esterase hydrolase

BM394_RS02725: thioesterase

smcogs: SMCOG1004: thioesterase

BM394_RS02755: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

BM394_RS02800: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Lyases: cyclase dehydratase

BM394_RS02630: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

BM394_RS02705: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase synthase

BM394_RS02620: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BM394_RS02750: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BM394_RS02760: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BM394_RS02775: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

BM394_RS02835: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

BM394_RS02840: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Translocases: permease

BM394_RS02730: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.62	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.58	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.57	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.54	NRPS	AbT1	Aureobasidium pullulans
BGC0001250.4	0.52	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.52	NRPS	epichloenin A	Epichloe festucae
BGC0000342.4	0.51	NRPS	enniatin	Fusarium equiseti
BGC0002171.2	0.50	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (23):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.15 out of 32.74

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.25 out of 30.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.13 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.90 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.23 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.18 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.71 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.42 out of 36.54

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.91 out of 32.93

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.40 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.00 out of 26.85

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.23 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.28 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.55 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.12 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.41 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.47 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 10, location 599450 - 681015:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Asp)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 11, location 599450 - 644139:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 12, location 639314 - 681015:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asp)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BM394_RS02620: mal

PKS_AT (563..847): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 93.3
Methoxymalonyl-CoA: 31.2
Methylmalonyl-CoA: 27.9
inactive: 27.1
Propionyl-CoA: 21.5
2-Methylbutyryl-CoA: 12.0
fatty_acid: 10.9
CHC-CoA: 10.2
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BM394_RS02750: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (22..376): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LCRAYDGWWFDKLLYSGGEINLYGPAEATFATHK
Nearest Stachelhaus code(s):: Leu DGFLLGLVYK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

BM394_RS02760: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (7..390): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VYHAFDGCITEWKTINGGGHNAYGTTETTVCNFL
Nearest Stachelhaus code(s):: Asp DLTKIGAVNK (47% 8Å match); OH-Asp or OMe-Asp DLTKIGAVNK (44% 8Å match)
Stachelhaus code match:: 80% (moderate)

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_FPAT01000001.1 - Region 6 - terpene