GCF_900116235.1 - 12 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_FPAA01000013.1 (Marininema halotolerans)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	terpene,NRPS	19,975	70,237

NZ_FPAA01000006.1 (Marininema halotolerans)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	betalactone	166,923	192,011

NZ_FPAA01000004.1 (Marininema halotolerans)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	NI-siderophore	1	22,010	Medium	schizokinen	NRPS:Type IV

NZ_FPAA01000003.1 (Marininema halotolerans)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	azole-containing-RiPP	206,711	230,265

NZ_FPAA01000005.1 (Marininema halotolerans)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	T3PKS	141,984	183,042

NZ_FPAA01000011.1 (Marininema halotolerans)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	terpene-precursor	86,140	107,036

NZ_FPAA01000002.1 (Marininema halotolerans)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	T3PKS,transAT-PKS,PKS-like	43,062	151,197	Low	aurantinin B/aurantinin C/aurantinin D	PKS
Region 15.2	NRPS,T1PKS	213,775	277,358	Medium	zwittermicin A	NRPS:Type I+PKS
Region 15.3	RiPP-like	308,220	319,071
Region 15.4	NRPS,T1PKS,RRE-containing	353,547	423,599	Low	paenilamicin/paenilamicin A2/paenilamicin B1/paenilamicin B2	NRPS:Type I+PKS

NZ_FPAA01000014.1 (Marininema halotolerans)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	ectoine	36,809	47,192	Medium	ectoine	other:other

NZ_FPAA01000016.1 (Marininema halotolerans)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	lanthipeptide-class-i	28,677	55,104	Low	paenicidin A	ribosomal:RiPP:Lanthipeptide

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	terpene,NRPS	19,975	70,237
Region 6.1	betalactone	166,923	192,011
Region 8.1	NI-siderophore	1	22,010	Medium	schizokinen	NRPS:Type IV
Region 11.1	azole-containing-RiPP	206,711	230,265
Region 12.1	T3PKS	141,984	183,042
Region 13.1	terpene-precursor	86,140	107,036
Region 15.1	T3PKS,transAT-PKS,PKS-like	43,062	151,197	Low	aurantinin B/aurantinin C/aurantinin D	PKS
Region 15.2	NRPS,T1PKS	213,775	277,358	Medium	zwittermicin A	NRPS:Type I+PKS
Region 15.3	RiPP-like	308,220	319,071
Region 15.4	NRPS,T1PKS,RRE-containing	353,547	423,599	Low	paenilamicin/paenilamicin A2/paenilamicin B1/paenilamicin B2	NRPS:Type I+PKS
Region 19.1	ectoine	36,809	47,192	Medium	ectoine	other:other
Region 21.1	lanthipeptide-class-i	28,677	55,104	Low	paenicidin A	ribosomal:RiPP:Lanthipeptide

No secondary metabolite regions were found in these records:: NZ_FPAA01000024.1 (Marininema halotolerans); NZ_FPAA01000009.1 (Marininema halotolerans); NZ_FPAA01000012.1 (Marininema halotolerans); NZ_FPAA01000023.1 (Marininema halotolerans); NZ_FPAA01000007.1 (Marininema halotolerans); NZ_FPAA01000022.1 (Marininema halotolerans); NZ_FPAA01000008.1 (Marininema halotolerans); NZ_FPAA01000019.1 (Marininema halotolerans); NZ_FPAA01000017.1 (Marininema halotolerans); NZ_FPAA01000001.1 (Marininema halotolerans); NZ_FPAA01000010.1 (Marininema halotolerans); NZ_FPAA01000015.1 (Marininema halotolerans); NZ_FPAA01000018.1 (Marininema halotolerans); NZ_FPAA01000020.1 (Marininema halotolerans); NZ_FPAA01000021.1 (Marininema halotolerans)

Compact view

NZ_FPAA01000013.1 - Region 1 - NRPS,terpene

Download region GenBank file

Download region SVG

Location: 19,975 - 70,237 nt. (total: 50,263 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase synthase

CHX35_RS14955: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CHX35_RS15035: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.33	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002164.2	0.33	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.33	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.33	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.33	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.32	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.31	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.31	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.30	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.30	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

CHX35_RS14870: T2TS

Domain 1 (8 - 623): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.09 out of 27.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.98 out of 18.16

Confidence: strong

Additional weak hits (6):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.65 out of 32.74

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.44 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.34 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.33 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.02 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.26 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 19974 - 70237:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 26160 - 70237:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CHX35_RS14955: Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (14..401): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWMTFDASVWEAQFFVGGEVNLYGPTEATIDTTY
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria

NZ_FPAA01000006.1 - Region 1 - betalactone

Download region GenBank file

Download region SVG

Location: 166,923 - 192,011 nt. (total: 25,089 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase

CHX35_RS09705: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Ligases: ligase synthase

CHX35_RS09720: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

CHX35_RS09735: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002405.2	0.46	saccharide	mid-chain acyl sugars	Solanum lycopersicum
BGC0001475.4	0.43	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0001859.4	0.41	other (phosphonate)	fosfomycin	Pseudomonas syringae
BGC0001289.5	0.41	ribosomal	penisin	Paenibacillus ehimensis
BGC0000904.5	0.40	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0001928.2	0.38	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000597.4	0.37	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000595.3	0.37	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002711.2	0.37	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0002017.3	0.37	NRPS	potensibactin	Nocardiopsis potens DSM 45234

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002405.2	0.46	saccharide	mid-chain acyl sugars	Solanum lycopersicum
BGC0001475.4	0.43	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0001859.4	0.41	other (phosphonate)	fosfomycin	Pseudomonas syringae
BGC0001289.5	0.41	ribosomal	penisin	Paenibacillus ehimensis
BGC0000904.5	0.40	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0001928.2	0.38	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000597.4	0.37	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000595.3	0.37	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002711.2	0.37	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0002017.3	0.37	NRPS	potensibactin	Nocardiopsis potens DSM 45234

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.58 out of 20.97

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.73 out of 27.78

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.24 out of 18.16

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.42 out of 23.43

Confidence: medium

Additional weak hits (7):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.38 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.23 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.28 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.56 out of 26.06

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.45 out of 27.04

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.25 out of 29.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.67 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
BldD	Development and antibiotic global regulator
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MexT	Global virulence regulator
ToxT	Regulator of MSHA biosynthesis

NZ_FPAA01000004.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 1 - 22,010 nt. (total: 22,010 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

CHX35_RS05900: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: aminotransferase

CHX35_RS05920: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: decarboxylase

CHX35_RS05915: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.68	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002633.2	0.67	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002683.2	0.66	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002469.2	0.63	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001478.5	0.62	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002692.2	0.60	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000941.3	0.60	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.59	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001713.5	0.59	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0001453.5	0.59	other (other)	desferrioxamine	Streptomyces argillaceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.68	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002633.2	0.67	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002683.2	0.66	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002469.2	0.63	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001478.5	0.62	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002692.2	0.60	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000941.3	0.60	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.59	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001713.5	0.59	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0001453.5	0.59	other (other)	desferrioxamine	Streptomyces argillaceus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 28.84 out of 29.38

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.42 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.11 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.36 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.26 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 28.19

Confidence: medium

Additional weak hits (11):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.10 out of 29.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 25.40 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.38 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.00 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.11 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.34 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.98 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.47 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.60 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.88 out of 32.74

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.25 out of 29.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_FPAA01000003.1 - Region 1 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 206,711 - 230,265 nt. (total: 23,555 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000567.3	0.47	ribosomal	trifolitoxin	Rhizobium leguminosarum
BGC0002013.4	0.46	ribosomal	curacozole	Streptomyces curacoi
BGC0001146.5	0.45	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000607.5	0.43	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0000569.5	0.41	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001145.5	0.40	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000606.5	0.39	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0000603.5	0.39	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0001640.3	0.38	ribosomal	kocurin	Kocuria rosea
BGC0000605.5	0.38	ribosomal	GE37468	Streptomyces sp. ATCC 55365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000567.3	0.47	ribosomal	trifolitoxin	Rhizobium leguminosarum
BGC0002013.4	0.46	ribosomal	curacozole	Streptomyces curacoi
BGC0001146.5	0.45	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000607.5	0.43	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0000569.5	0.41	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001145.5	0.40	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000606.5	0.39	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0000603.5	0.39	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0001640.3	0.38	ribosomal	kocurin	Kocuria rosea
BGC0000605.5	0.38	ribosomal	GE37468	Streptomyces sp. ATCC 55365

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.86 out of 21.84

Confidence: medium

Additional weak hits (2):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.83 out of 29.51

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Heterocycloanthracin_C_RRE; Location: 0 - 100; Score: 136.5; RRE type: Thiopeptide_F_RRE; Location: 7 - 86; Score: 39.6

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
ToxT	Regulator of MSHA biosynthesis

Core peptide predictions

No core peptides found.

NZ_FPAA01000005.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 141,984 - 183,042 nt. (total: 41,059 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

CHX35_RS08155: isoprenylcysteine carboxyl methyltransferase

smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Hydrolases: hydrolase

CHX35_RS08205: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Ligases: synthase

CHX35_RS08080: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

CHX35_RS08150: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.69	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.54	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001962.3	0.51	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0002403.2	0.49	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0002656.2	0.45	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002332.2	0.45	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0002567.2	0.44	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0002488.3	0.43	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0000234.5	0.42	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002487.3	0.42	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.69	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.54	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001962.3	0.51	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0002403.2	0.49	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0002656.2	0.45	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002332.2	0.45	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0002567.2	0.44	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0002488.3	0.43	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0000234.5	0.42	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002487.3	0.42	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.25 out of 18.46

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.93 out of 27.78

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.24 out of 30.25

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.94 out of 23.79

Confidence: medium

Additional weak hits (7):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.21 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.18 out of 29.25

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.54 out of 29.51

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.85 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.77 out of 33.14

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.53 out of 32.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.08 out of 28.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence

NZ_FPAA01000011.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 86,140 - 107,036 nt. (total: 20,897 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase

CHX35_RS14220: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

CHX35_RS14175: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

CHX35_RS14185: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000641.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000638.3	0.38	terpene	carotenoid	Pantoea ananatis
BGC0000640.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000665.5	0.37	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000641.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000638.3	0.38	terpene	carotenoid	Pantoea ananatis
BGC0000640.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000665.5	0.37	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

CHX35_RS14185: PT_FPPS_like

Domain 1 (33 - 297): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.65 out of 27.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_FPAA01000002.1 - Region 1 - PKS-like,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 43,062 - 151,197 nt. (total: 108,136 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CHX35_RS02910: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CHX35_RS02955: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase methyltransferase

CHX35_RS02925: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CHX35_RS02930: methyltransferase

smcogs: SMCOG1089: methyltransferase

CHX35_RS02940: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CHX35_RS02950: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

CHX35_RS02935: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

CHX35_RS02965: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

CHX35_RS03010: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: hydratase

CHX35_RS02885: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

CHX35_RS02890: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

CHX35_RS02895: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: synthase

CHX35_RS02900: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

CHX35_RS02905: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CHX35_RS02915: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CHX35_RS02975: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000205.3	0.63	PKS	bryostatin	Candidatus Endobugula sertula
BGC0000255.5	0.62	PKS	pederin	Uncultured bacterium
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000107.3	0.56	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001275.3	0.56	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.54	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002084.4	0.46	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.46	ribosomal	biarylitide YFH	Planomonospora sp. ID107089

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000107.3	0.64	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.64	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.86 out of 21.84

Confidence: medium

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 23.09 out of 26.12

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.28 out of 27.78

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.51 out of 27.78

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.79 out of 32.93

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.69 out of 26.06

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 22.47 out of 25.31

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.35 out of 26.06

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 24.10 out of 29.25

Confidence: medium

Additional weak hits (9):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.95 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.44 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.78 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.54 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.42 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.68 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.51 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.53 out of 33.73

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.52 out of 30.11

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 43061 - 151197:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - ohmal - mal - mal - ccmal) + (mal - mal) + (ccmal) + (Me-ccmal - ccmal - ccmal - Me-mal) + (ohmal - mal)
Non-colinear ordering:: CHX35_RS02925 + CHX35_RS17960 + CHX35_RS02915 + CHX35_RS02910 + CHX35_RS02905

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 44423 - 145572:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - ohmal - mal - mal - ccmal) + (mal - mal) + (ccmal) + (Me-ccmal - ccmal - ccmal - Me-mal) + (ohmal - mal)
Non-colinear ordering:: CHX35_RS02925 + CHX35_RS17960 + CHX35_RS02915 + CHX35_RS02910 + CHX35_RS02905

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 109898 - 151197:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - ohmal - mal - mal - ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CHX35_RS02940: mal

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 89.8
inactive: 29.3
Methoxymalonyl-CoA: 26.6
Methylmalonyl-CoA: 15.2
Propionyl-CoA: 11.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

CHX35_RS02950: mal

PKS_AT (8..292): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 62.2
inactive: 48.3
Methoxymalonyl-CoA: 22.5
Methylmalonyl-CoA: 17.3
Isobutyryl-CoA: 17.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 3	Repressor of DNA damage response
LuxO	Repressor of luminescence
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes
SypG	Regulator of biofilm formation and host colonization
ToxT	Regulator of MSHA biosynthesis

NZ_FPAA01000002.1 - Region 2 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 213,775 - 277,358 nt. (total: 63,584 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

CHX35_RS03430: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

CHX35_RS03455: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CHX35_RS03465: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

CHX35_RS03480: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CHX35_RS03505: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: acylase carbamoyltransferase

CHX35_RS03410: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

CHX35_RS03470: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: deaminase phosphatase

CHX35_RS03425: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

CHX35_RS03495: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Ligases: ligase synthase

CHX35_RS03435: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CHX35_RS03440: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CHX35_RS03445: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CHX35_RS03450: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CHX35_RS03500: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.90	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.84	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.81	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.77	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.72	NRPS	AbT1	Aureobasidium pullulans
BGC0002071.2	0.72	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.69	NRPS	AbT1	Aureobasidium pullulans
BGC0002071.2	0.69	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.31 out of 23.79

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.28 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.07 out of 18.16

Confidence: strong

Additional weak hits (6):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.60 out of 32.93

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.98 out of 27.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.26 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.91 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.69 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.59 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 213774 - 277358:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - ohmal) + (ohmal - X) + (Ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CHX35_RS03435: X - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (275..659): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FGMSFDASIQLGDGIIAGETNAYGPTEATVNASS
Nearest Stachelhaus code(s):: Dpr DAQDLAVVNK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1303..1700): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDVSVPEGNFLLSGEDNLYGPTEATVFTTR
Nearest Stachelhaus code(s):: Ala DVPNFALVFK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

CHX35_RS03440: mal

PKS_AT (1949..2242): mal

ATSignature: 2-Rhyd-Malonyl-CoA

Top 3 matches:: 2-Rhyd-Malonyl-CoA: 83.3%; Malonyl-CoA: 58.3%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 105.5
inactive: 68.3
Methoxymalonyl-CoA: 55.6
Methylmalonyl-CoA: 46.6
Propionyl-CoA: 38.3
Ethylmalonyl-CoA: 27.8
Isobutyryl-CoA: 20.2
fatty_acid: 16.7
Acetyl-CoA: 16.0
CHC-CoA: 14.2
2-Methylbutyryl-CoA: 11.2
Benzoyl-CoA: 11.1
3-Methylbutyryl-CoA: 9.7
trans-1,2-CPDA: 0.0

CHX35_RS03445: X - mal

AMP-binding (446..850): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LHHHFDMSVWEGNQTFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Ser DMWNTGLVHK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

PKS_AT (1558..1854): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 147.5
inactive: 105.4
Methoxymalonyl-CoA: 53.9
Methylmalonyl-CoA: 34.8
Propionyl-CoA: 24.9
Isobutyryl-CoA: 14.7
Ethylmalonyl-CoA: 12.8
Acetyl-CoA: 10.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

CHX35_RS03450: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (8..412): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFVSGETNLYGPTEATIDVTA
Nearest Stachelhaus code(s):: Ser DVWHFSLIDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

CHX35_RS03470: mal

PKS_AT (6..287): mal

ATSignature: 2-Rhyd-Malonyl-CoA, Malonyl-CoA

Top 3 matches:: 2-Rhyd-Malonyl-CoA: 58.3%; Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 50.9
inactive: 35.0
Methoxymalonyl-CoA: 25.2
Propionyl-CoA: 6.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Methylmalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_FPAA01000002.1 - Region 3 - RiPP-like

Download region GenBank file

Download region SVG

Location: 308,220 - 319,071 nt. (total: 10,852 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

CHX35_RS03715: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000846.5	0.42	other (other)	tabtoxin	Pseudomonas syringae
BGC0001880.3	0.41	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000885.3	0.40	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001545.3	0.36	NRPS	chrysogine	Fusarium graminearum PH-1
BGC0001374.5	0.33	other (other)	thienodolin	Streptomyces albogriseolus
BGC0001007.5	0.31	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001739.3	0.30	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0000254.5	0.29	PKS	oxytetracycline	Streptomyces rimosus
BGC0002471.3	0.29	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0000295.5	0.29	NRPS	acinetoferrin	Acinetobacter haemolyticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000846.5	0.42	other (other)	tabtoxin	Pseudomonas syringae
BGC0001880.3	0.41	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000885.3	0.40	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001545.3	0.36	NRPS	chrysogine	Fusarium graminearum PH-1
BGC0001374.5	0.33	other (other)	thienodolin	Streptomyces albogriseolus
BGC0001007.5	0.31	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001739.3	0.30	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0000254.5	0.29	PKS	oxytetracycline	Streptomyces rimosus
BGC0002471.3	0.29	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0000295.5	0.29	NRPS	acinetoferrin	Acinetobacter haemolyticus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.65 out of 29.38

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.42 out of 28.19

Confidence: medium

Additional weak hits (7):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.51 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.86 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.73 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.87 out of 28.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
FuR variant 1	Ferric Uptake Regulator
MexT	Global virulence regulator
ZuR variant 1	Zinc-responsive repressor

NZ_FPAA01000002.1 - Region 4 - NRPS,RRE-containing,T1PKS

Download region GenBank file

Download region SVG

Location: 353,547 - 423,599 nt. (total: 70,053 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

CHX35_RS03980: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: deacetylase esterase hydrolase phosphatase

CHX35_RS04030: thioesterase

smcogs: SMCOG1004: thioesterase

CHX35_RS04045: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

CHX35_RS04065: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

CHX35_RS04070: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

CHX35_RS04075: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

CHX35_RS04080: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Ligases: ligase synthase

CHX35_RS04005: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CHX35_RS04015: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CHX35_RS04020: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CHX35_RS04025: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transport

CHX35_RS04105: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.82	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002286.3	0.79	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.77	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.77	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.76	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002164.2	0.70	NRPS	peramine	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.80 out of 18.16

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.59 out of 30.25

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.33 out of 27.55

Confidence: medium

Additional weak hits (3):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.74 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.59 out of 29.38

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.21 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 353546 - 423599:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (mal) + (D-Asn) + (D-X - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CHX35_RS04005: X - X - X

AMP-binding (473..867): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWFSVDPSLEDGNFISGSEYNNYGPTETTVDALS
Nearest Stachelhaus code(s):: Lys or Arg DPEDIGGVEK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1991..2403): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HDMSFDISLEQSNLVVGGELNAYGPAETAMTSTL
Nearest Stachelhaus code(s):: Arg DVENVGAVTK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (3048..3452): X

nrpys: OH-Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YWFSFDLGYTASKLVLGGELNHYGPTEATVGVIA
Nearest Stachelhaus code(s):: OH-Asp DLTKVGHVGK (68% 8Å match); Asp DLTKVGHVGK (65% 8Å match)
Stachelhaus code match:: 100% (strong)

CHX35_RS04015: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (466..861): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSPKVIVGGEFNEYGPTEATVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

CHX35_RS04020: mal

PKS_AT (527..821): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 161.8
inactive: 107.7
Methoxymalonyl-CoA: 46.1
Methylmalonyl-CoA: 34.4
fatty_acid: 18.8
Propionyl-CoA: 14.4
Isobutyryl-CoA: 13.9
Benzoyl-CoA: 12.8
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

CHX35_RS04025: X - X

AMP-binding (269..669): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWYAFDTAHKNANCFVGGEINTYGPTECTDITTF
Nearest Stachelhaus code(s):: Hse DLKNVGSDVK (62% 8Å match); bLys DTENVGTAVK (44% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1311..1704): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QGLAFDVSVQQLGAMVAGEINLYGPTEATVYATS
Nearest Stachelhaus code(s):: Ala DVFSVALVYK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 0 - 89; Score: 62.7

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
ColR	Phenol-responsive regulator
GnfM	Regulator of nitrogen-fixation genes
ToxT	Regulator of MSHA biosynthesis

NZ_FPAA01000014.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 36,809 - 47,192 nt. (total: 10,384 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

CHX35_RS15320: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000858.3	0.73	other (other)	ectoine	Methylobacter marinus
BGC0000852.5	0.72	other (other)	ectoine	Sporosarcina pasteurii
BGC0002052.3	0.69	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.68	other (other)	ectoine	Streptomyces anulatus
BGC0000859.3	0.67	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.56	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000858.3	0.73	other (other)	ectoine	Methylobacter marinus
BGC0000852.5	0.72	other (other)	ectoine	Sporosarcina pasteurii
BGC0002052.3	0.69	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.68	other (other)	ectoine	Streptomyces anulatus
BGC0000859.3	0.67	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.56	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.34 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.85 out of 28.19

Confidence: medium

Additional weak hits (1):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
ZuR variant 1	Zinc-responsive repressor

NZ_FPAA01000016.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 28,677 - 55,104 nt. (total: 26,428 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

CHX35_RS16005: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase dehydratase

CHX35_RS15970: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

CHX35_RS15980: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Translocases: transport

CHX35_RS16025: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000542.3	0.61	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001289.5	0.60	ribosomal	penisin	Paenibacillus ehimensis
BGC0000538.3	0.58	ribosomal	nisin Z	Lactococcus lactis
BGC0000508.3	0.57	ribosomal	epidermin	Staphylococcus epidermidis
BGC0000541.5	0.56	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0002635.2	0.56	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001618.3	0.55	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0002668.2	0.54	ribosomal	cesin A	Clostridium estertheticum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000542.3	0.61	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001289.5	0.60	ribosomal	penisin	Paenibacillus ehimensis
BGC0000538.3	0.58	ribosomal	nisin Z	Lactococcus lactis
BGC0000508.3	0.57	ribosomal	epidermin	Staphylococcus epidermidis
BGC0000541.5	0.56	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0002635.2	0.56	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001618.3	0.55	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0002668.2	0.54	ribosomal	cesin A	Clostridium estertheticum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for CHX35_RS15980

CHX35_RS15985

Leader:

MAENKKDQFDLDVQVNKSKGEVDPQ

CHX35_RS15990

Leader:

MAENKKDQFDLDVQVNKSKGEVDPQ

CHX35_RS15995

Leader:

MAENKKDQFDLDVQVNKSKGEVDPQ

CHX35_RS16000

Leader:

MAENKKDQFDLDVQVNKSKGEVDPQ

Shared core:

ITSVSLCTPGCGDTGSFNSYCC

Core with dehydrations:

IDhbDhaVDhaLCysDhbPGCysGDDhbGDhaFNDhaYCysCys

antiSMASH-DB 4.0 matches for CHX35_RS15985

100.0%

NZ_FPAA01000016.1and 3 others:

NZ_FPAA01000016.1 Lanthipeptides: CHX35_RS15995_lanthipeptideNZ_FPAA01000016.1 Lanthipeptides: CHX35_RS15990_lanthipeptideNZ_FPAA01000016.1 Lanthipeptides: CHX35_RS15985_lanthipeptide

Lanthipeptides: CHX35_RS16000_lanthipeptide

1

ITSVSLCTPGCGDTGSFNSYCC

22

ITSVSLCTPGCGDTGSFNSYCC

1

ITSVSLCTPGCGDTGSFNSYCC

22

95.5%

NZ_FNNQ01000006.1and 2 others:

NZ_FNNQ01000006.1 Lanthipeptides: BLV90_RS07685_lanthipeptideNZ_FNNQ01000006.1 Lanthipeptides: BLV90_RS07680_lanthipeptide

Lanthipeptides: BLV90_RS07690_lanthipeptide

1

ITSVSLCTPGCGDTGSFNSYCC

22

ITSVSLCTPGCG+TGSFNSYCC

1

ITSVSLCTPGCGETGSFNSYCC

22

90.9%

NC_014023.1and 36 others:

NC_014023.1 Lanthipeptides: BMQ_RS27575_lanthipeptideNZ_CP018875.1 Lanthipeptides: BUW91_RS26425_lanthipeptideNZ_CP018875.1 Lanthipeptides: BUW91_RS26420_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28075_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28070_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28065_lanthipeptideNZ_CP031776.1 Lanthipeptides: D0441_RS30140_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01185_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01180_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01175_lanthipeptideNZ_CP048884.1 Lanthipeptides: BMG_RS27510_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26980_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26975_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26970_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26985_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26980_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26975_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27820_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27815_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27810_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25635_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25630_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25625_lanthipeptideNZ_JAHHYI010000015.1 Lanthipeptides: KM925_RS26245_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28075_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28070_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28065_lanthipeptideNZ_NKAQ01000005.1 Lanthipeptides: CE057_RS19640_lanthipeptideNZ_NKAQ01000005.1 Lanthipeptides: CE057_RS19635_lanthipeptideNZ_NTZG01000054.1 Lanthipeptides: CN510_RS18265_lanthipeptideNZ_NUIN01000020.1 Lanthipeptides: CN973_RS26930_lanthipeptideNZ_NUOI01000090.1 Lanthipeptides: COE08_RS30285_lanthipeptideNZ_NUOI01000090.1 Lanthipeptides: COE08_RS30280_lanthipeptideNZ_NUOQ01000009.1 Lanthipeptides: COE31_RS05925_lanthipeptideNZ_NUXL01000007.1 Lanthipeptides: COJ36_RS20885_lanthipeptideNZ_NUZS01000089.1 Lanthipeptides: COJ90_RS28785_lanthipeptide

Lanthipeptides: BMQ_RS27580_lanthipeptide

1

ITSVSLCTPGCGDTGSFNSYCC

22

ITSVSLCTPGCGDTGS+NS+CC

1

ITSVSLCTPGCGDTGSWNSFCC

22

with 112 more sequence matches

Only the first 10 are displayed here.

86.4%

NZ_AP019791.1:

Lanthipeptides: RxyAA322_RS06460_lanthipeptide

1

ITSVSLCTPGCGDTGSFNSYCC

22

ITS SLCTPGC TGSFNSYCC

1

ITSYSLCTPGCAKTGSFNSYCC

22

86.4%

NZ_LELK01000004.1:

Lanthipeptides: AB986_RS12540_lanthipeptide

1

ITSVSLCTPGCGDTGSFNSYCC

22

ITS S CTPGCG+TGSFNSYCC

1

ITSYSFCTPGCGETGSFNSYCC

22

81.8%

NC_006582.1and 6 others:

NZ_BOQQ01000001.1 Lanthipeptides: KI354_RS00530_lanthipeptideNZ_BOQS01000001.1 Lanthipeptides: KI364_RS00675_lanthipeptideNZ_CP019985.1 Lanthipeptides: BC8716_RS09795_lanthipeptideNZ_CP104963.1 Lanthipeptides: N7M99_RS07725_lanthipeptideNZ_FRBS01000002.1 Lanthipeptides: BUC05_RS08990_lanthipeptideNZ_JAODPB010000001.1 Lanthipeptides: N6H06_RS03040_lanthipeptide

Lanthipeptides: ABC_RS22115_lanthipeptide

1

ITSVSLCTPGCGDTGSFNSYCC

22

TSVS CTPGCG+TGSFNS+CC

1

FTSVSFCTPGCGETGSFNSFCC

22

81.8%

NC_022873.1and 92 others:

NZ_CM000742.1 Lanthipeptides: BMYCO0001_RS26515_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18180_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18175_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18170_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18165_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19775_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19770_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19765_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18710_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18705_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18700_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21370_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21365_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21360_lanthipeptideNZ_CP035965.1 Lanthipeptides: EXW35_RS16385_lanthipeptideNZ_CP035965.1 Lanthipeptides: EXW35_RS16380_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16155_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16150_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16145_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16140_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26195_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26190_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26185_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26180_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16265_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16260_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16255_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16250_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16620_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16615_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16610_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16605_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16110_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16105_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16100_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16095_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14125_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14120_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14115_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18355_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18350_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18345_lanthipeptideNZ_CP047366.1 Lanthipeptides: GSN03_RS15835_lanthipeptideNZ_CP047366.1 Lanthipeptides: GSN03_RS15830_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16415_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16410_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16405_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15130_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15125_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15120_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15990_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15985_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15980_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15975_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25975_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25970_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25965_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25960_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15810_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15805_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15800_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15795_lanthipeptideNZ_JAIPUK010000008.1 Lanthipeptides: K9P71_RS24265_lanthipeptideNZ_JAIPUK010000008.1 Lanthipeptides: K9P71_RS24260_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06155_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06150_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06145_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06140_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21535_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21530_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21525_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11095_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11090_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11085_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11080_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11075_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18900_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18895_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18890_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18885_lanthipeptideNZ_LDHL01000037.1 Lanthipeptides: ABD98_RS26430_lanthipeptideNZ_LDHL01000037.1 Lanthipeptides: ABD98_RS26425_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27280_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27275_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27270_lanthipeptideNZ_MSTN01000016.1 Lanthipeptides: BVF97_RS28620_lanthipeptideNZ_NIUP01000011.1 Lanthipeptides: CEU84_RS08145_lanthipeptideNZ_NIUP01000011.1 Lanthipeptides: CEU84_RS08140_lanthipeptideNZ_NKAX01000026.1 Lanthipeptides: CE086_RS26165_lanthipeptideNZ_NKAX01000026.1 Lanthipeptides: CE086_RS26160_lanthipeptideNZ_NVGU01000011.1 Lanthipeptides: COL71_RS14760_lanthipeptideNZ_NVGU01000011.1 Lanthipeptides: COL71_RS14755_lanthipeptide

Lanthipeptides: YBT1518_RS19670_lanthipeptide

1

ITSVSLCTPGCGDTGSFNSYCC

22

ITS+S CTPGCG+TGSFNS+CC

1

ITSISACTPGCGNTGSFNSFCC

22

79.2%

NZ_VKCY01000012.1:

Lanthipeptides: FNK43_RS09020_lanthipeptide

1

ITSVSLCTPGCGDTGSFNSYCC

22

ITS SLCTPGC TGSFNSYCC

3

ITSFSLCTPGCAKTGSFNSYCC

24

78.3%

NC_003923.1and 9 others:

NC_009641.1 Lanthipeptides: NWMN_RS09635_lanthipeptideNZ_CP023076.1 Lanthipeptides: CJ017_RS08945_lanthipeptideNZ_CP054876.1 Lanthipeptides: HUW54_RS09150_lanthipeptideNZ_CP077098.1 Lanthipeptides: KSF82_RS09475_lanthipeptideNZ_CP092781.1 Lanthipeptides: ML436_RS08940_lanthipeptideNZ_CP102959.1 Lanthipeptides: NW979_RS08780_lanthipeptideNZ_CP102962.1 Lanthipeptides: NW971_RS09555_lanthipeptideNZ_LR133917.1 Lanthipeptides: ELZ45_RS09155_lanthipeptideNZ_LS483317.1 Lanthipeptides: DQL75_RS09700_lanthipeptide

Lanthipeptides: MW_RS09420_lanthipeptide

1

ITSVSLCTPGCGDTGSFNSYCC

22

ITS SLCTPGC TGSFNS+CC

2

ITSHSLCTPGCAKTGSFNSFCC

23

78.3%

NZ_CP047792.1and 1 other:

NZ_JAGSAY010000004.1 Lanthipeptides: KC186_RS06745_lanthipeptide

Lanthipeptides: E3S88_RS07345_lanthipeptide

1

ITSVSLCTPGCGDTGSFNSYCC

22

ITS SLCTPGC +TGSFNS+CC

2

ITSHSLCTPGCANTGSFNSFCC

23

78.3%

NZ_LR134304.1:

Lanthipeptides: EL116_RS09245_lanthipeptide

1

ITSVSLCTPGCGDTGSFNSYCC

22

ITSV CTPGCG TGSFNS+CC

2

ITSVIGCTPGCGKTGSFNSFCC

23

77.3%

NC_022873.1:

Lanthipeptides: YBT1518_RS19675_lanthipeptide

1

ITSVSLCTPGCGDTGSFNSYCC

22

IT +S CTPGCG+TGSFNS+CC

1

ITRISACTPGCGNTGSFNSFCC

22

77.3%

NZ_CP023477.1:

Lanthipeptides: CO204_RS07210_lanthipeptide

1

ITSVSLCTPGCGDTGSFNSYCC

22

S SLCTPGC TGSFNSYCC

1

FKSWSLCTPGCARTGSFNSYCC

22

MIBiG 4.0 matches for CHX35_RS15985

35.3%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

1

ITSVSLCTPGCGDTGSF

17

ITS+SLCTPGC TG+

1

ITSISLCTPGC-KTGAL

16

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.22 out of 26.06

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.44 out of 30.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.11 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.63 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.38 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.35 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 26.27 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.73 out of 28.19

Confidence: medium

Additional weak hits (4):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.86 out of 32.74

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.69 out of 27.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.19 out of 28.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.69 out of 29.65

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

CHX35_RS15985 - Class I

Cleavage pHMM score: 11.40

RODEO score: 35

Monoisotopic mass: 2041.9 Da

Molecular weight: 2043.3 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2061.3 Da N = 1; 2079.4 Da N = 2; 2097.4 Da N = 3

CHX35_RS15990 - Class I

Cleavage pHMM score: 11.40

RODEO score: 35

Monoisotopic mass: 2041.9 Da

Molecular weight: 2043.3 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2061.3 Da N = 1; 2079.4 Da N = 2; 2097.4 Da N = 3

CHX35_RS15995 - Class I

Cleavage pHMM score: 11.40

RODEO score: 35

Monoisotopic mass: 2041.9 Da

Molecular weight: 2043.3 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2061.3 Da N = 1; 2079.4 Da N = 2; 2097.4 Da N = 3

CHX35_RS16000 - Class I

Cleavage pHMM score: 11.40

RODEO score: 35

Monoisotopic mass: 2041.9 Da

Molecular weight: 2043.3 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2061.3 Da N = 1; 2079.4 Da N = 2; 2097.4 Da N = 3

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 158 - 255; Score: 48.0

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor