GCF_900109685.1 - 29 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_FOBB01000010.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	lanthipeptide-class-i	66,352	90,727

NZ_FOBB01000021.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	NRPS	1	1,895

NZ_FOBB01000008.1 (Chitinophaga rupis)

Region	Type	From	To
Region 4.1	T3PKS	11,233	52,348
Region 4.2	terpene	306,050	326,997
Region 4.3	NRPS	339,779	372,387

NZ_FOBB01000009.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	terpene	70,022	91,131

NZ_FOBB01000002.1 (Chitinophaga rupis)

Region	Type	From	To
Region 6.1	T1PKS,hglE-KS	310,408	361,832
Region 6.2	terpene	488,285	509,250
Region 6.3	lanthipeptide-class-iv	887,046	908,992
Region 6.4	lanthipeptide-class-iv	926,338	948,731
Region 6.5	terpene	1,109,852	1,130,829

NZ_FOBB01000013.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	lanthipeptide-class-i	140,215	177,456

NZ_FOBB01000006.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	NRPS,T1PKS	128,849	216,204
Region 9.2	arylpolyene,resorcinol	262,155	308,456

NZ_FOBB01000020.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	NRPS,transAT-PKS	1	13,773

NZ_FOBB01000005.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	RiPP-like	344,862	355,692
Region 12.2	terpene-precursor	439,776	460,747

NZ_FOBB01000018.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	NRPS	1	23,578

NZ_FOBB01000015.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	NRPS	1	61,111

NZ_FOBB01000004.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	RRE-containing	342,644	365,718

NZ_FOBB01000001.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	microviridin	1,350,852	1,371,243
Region 17.2	terpene-precursor	1,622,143	1,643,126

NZ_FOBB01000007.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	lanthipeptide-class-i	92,262	118,479
Region 18.2	terpene	311,956	332,957

NZ_FOBB01000011.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	NI-siderophore	79,182	110,837	Low	putrebactin/avaroferrin	other:other

NZ_FOBB01000012.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	terpene,NRPS,T1PKS,lanthipeptide-class-i	92,206	193,552

NZ_FOBB01000003.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	terpene	237,821	259,863	Low	carotenoid	terpene
Region 21.2	arylpolyene	845,844	895,770	Low	flexirubin	PKS

NZ_FOBB01000016.1 (Chitinophaga rupis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 22.1	NRPS,RiPP-like	1	31,998

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	lanthipeptide-class-i	66,352	90,727
Region 3.1	NRPS	1	1,895
Region 4.1	T3PKS	11,233	52,348
Region 4.2	terpene	306,050	326,997
Region 4.3	NRPS	339,779	372,387
Region 5.1	terpene	70,022	91,131
Region 6.1	T1PKS,hglE-KS	310,408	361,832
Region 6.2	terpene	488,285	509,250
Region 6.3	lanthipeptide-class-iv	887,046	908,992
Region 6.4	lanthipeptide-class-iv	926,338	948,731
Region 6.5	terpene	1,109,852	1,130,829
Region 7.1	lanthipeptide-class-i	140,215	177,456
Region 9.1	NRPS,T1PKS	128,849	216,204
Region 9.2	arylpolyene,resorcinol	262,155	308,456
Region 11.1	NRPS,transAT-PKS	1	13,773
Region 12.1	RiPP-like	344,862	355,692
Region 12.2	terpene-precursor	439,776	460,747
Region 13.1	NRPS	1	23,578
Region 15.1	NRPS	1	61,111
Region 16.1	RRE-containing	342,644	365,718
Region 17.1	microviridin	1,350,852	1,371,243
Region 17.2	terpene-precursor	1,622,143	1,643,126
Region 18.1	lanthipeptide-class-i	92,262	118,479
Region 18.2	terpene	311,956	332,957
Region 19.1	NI-siderophore	79,182	110,837	Low	putrebactin/avaroferrin	other:other
Region 20.1	terpene,NRPS,T1PKS,lanthipeptide-class-i	92,206	193,552
Region 21.1	terpene	237,821	259,863	Low	carotenoid	terpene
Region 21.2	arylpolyene	845,844	895,770	Low	flexirubin	PKS
Region 22.1	NRPS,RiPP-like	1	31,998

No secondary metabolite regions were found in these records:: NZ_FOBB01000023.1 (Chitinophaga rupis); NZ_FOBB01000014.1 (Chitinophaga rupis); NZ_FOBB01000022.1 (Chitinophaga rupis); NZ_FOBB01000017.1 (Chitinophaga rupis); NZ_FOBB01000019.1 (Chitinophaga rupis)

Compact view

NZ_FOBB01000010.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 66,352 - 90,727 nt. (total: 24,376 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BMZ54_RS27665: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BMZ54_RS27685: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase dehydratase

BMZ54_RS27645: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

BMZ54_RS27650: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002640.2	0.57	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0000560.5	0.47	ribosomal	subtilomycin	Bacillus subtilis
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0002005.2	0.46	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0002698.2	0.45	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001928.2	0.45	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0000500.5	0.45	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002640.2	0.57	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0000560.5	0.47	ribosomal	subtilomycin	Bacillus subtilis
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0002005.2	0.46	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0002698.2	0.45	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001928.2	0.45	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0000500.5	0.45	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for BMZ54_RS27645

BMZ54_RS27655

Leader:

MKKKKVDLSKKLLFSKETIAQLTADQQAQVN

Core:

GGAATLAATCTEDTRLISSCRATSPGPGRPCCMIP

Core with dehydrations:

GGAADhbLAADhbCysDhbEDDhbRLIDhaDhaCysRADhbDhaPGPGRPCysCysMIP

antiSMASH-DB 4.0 matches for BMZ54_RS27655

100.0%

NZ_FOBB01000010.1:

Lanthipeptides: BMZ54_RS27655_lanthipeptide

1

GGAATLAATCTEDTRLISSCRATSPGPGRPCCMIP

35

GGAATLAATCTEDTRLISSCRATSPGPGRPCCMIP

1

GGAATLAATCTEDTRLISSCRATSPGPGRPCCMIP

35

64.9%

NZ_CP073766.1:

Lanthipeptides: KD145_RS08715_lanthipeptide

1

GGAATLAATCTEDTRLISSCRATSPGPGRPCCMIP

35

GG TL TCTEDTR ISSCRAT P P CC IP

3

GGINTLYLTCTEDTRAISSCRATRPSPNATCCQIP

37

63.9%

NZ_LR655208.1:

Lanthipeptides: FS985_RS23945_lanthipeptide

2

GAATLAATCTEDTRLISSCRATSPGPGRPCCMIP

35

G ++ CT+DTR ISSCRATSPG GRPCC IP

3

GGFGVSVLCTDDTRQISSCRATSPGTGRPCCQIP

36

with 13 more sequence matches

Only the first 10 are displayed here.

62.2%

NZ_FUWZ01000001.1:

Lanthipeptides: B5D63_RS07910_lanthipeptide

1

GGAATLAATCTEDTRLISSCRATSPGPGRPCCMIP

35

GG AT C EDTR ISSCRAT P P PCC IP

3

GGVATRDIVCMEDTRYISSCRATRPSPNSPCCQIP

37

51.2%

NZ_JAABOK010000018.1:

Lanthipeptides: GWG06_RS26540_lanthipeptide

1

GGAATLAATCTEDTRLISSCRATSPGPGRPCCMIP

35

GG + EDTR ISSCRAT P P PCCMIP

7

GGFIVTVTSMCEDTRQISSCRATRPRPNAPCCMIP

41

51.2%

NZ_CP051204.2and 1 other:

NZ_CP051205.1 Lanthipeptides: HF329_RS14580_lanthipeptide

Lanthipeptides: HF324_RS23005_lanthipeptide

1

GGAATLAATCTEDTRLISSCRATSPGPGRPCCMIP

35

GG AT C EDTR ISSC AT P P PCC IP

9

GGVATRDIVCMEDTRYISSCVATRPSPNSPCCQIP

43

46.3%

NZ_JAABOK010000018.1:

Lanthipeptides: GWG06_RS26535_lanthipeptide

1

GGAATLAATCTEDTRLISSCRATSPGPGRPCCMIP

35

GG + EDTR ISSC AT P P CCMIP

7

GGFIVTVTSACEDTRQISSCIATRPRPNMTCCMIP

41

42.9%

NZ_QLLL01000002.1:

Lanthipeptides: LX64_RS25750_lanthipeptide

5

TLAATCTEDTRLISSCRATSPGPGRPCCMIP

35

T+ + C ++ ISSC AT P RPCC IP

1

TVGSACITESLAISSCIATRPSSTRPCCQIP

31

28.6%

NZ_BMUQ01000012.1and 11 others:

NZ_CP041604.2 Lanthipeptides: FNV64_RS07000_lanthipeptideNZ_CP041610.2 Lanthipeptides: FNV62_RS03705_lanthipeptideNZ_CP041611.1 Lanthipeptides: FNV63_RS03970_lanthipeptideNZ_CP041613.2 Lanthipeptides: FNV68_RS05855_lanthipeptideNZ_CP041650.2 Lanthipeptides: FNV59_RS05275_lanthipeptideNZ_CP050974.1 Lanthipeptides: HEP84_RS02235_lanthipeptideNZ_CP051010.1 Lanthipeptides: HEP87_RS03725_lanthipeptideNZ_FONR01000009.1 Lanthipeptides: BM303_RS25620_lanthipeptideNZ_KQ948493.1 Lanthipeptides: AQJ27_RS49365_lanthipeptideNZ_VISR01000021.1 Lanthipeptides: FB157_RS31330_lanthipeptideNZ_VISR01000021.1 Lanthipeptides: FB157_RS31330_lanthipeptide

Lanthipeptides: IE289_RS27575_lanthipeptide

1

GGAATLAATCTEDTRLISSCRATSPGPGRPCC

32

GGAA AA L C + S G CC

11

GGAAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

28.6%

NZ_BMUU01000006.1and 2 others:

NZ_BMUZ01000004.1 Lanthipeptides: IE267_RS12185_lanthipeptideNZ_CP070373.1 Lanthipeptides: GWQ54_RS15625_lanthipeptide

Lanthipeptides: IE233_RS19480_lanthipeptide

1

GGAATLAATCTEDTRLISSCRATSPGPGRPCC

32

GGAA AA L C + S G CC

11

GGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

27.9%

NZ_JAAOYX010000001.1:

Lanthipeptides: FHS47_RS11835_lanthipeptide

1

GGAATLAATCTEDTRLISSCRA-TSPGPGRPC

31

G A T+ A + D L+S+C + T+ PG C

12

GHAQTVMAMTSTDIALVSNCSSCTASRPGVCC

43

26.2%

NZ_NNBJ01000008.1:

Lanthipeptides: CG740_RS17895_lanthipeptide

1

GGAATLAATCTEDTRLISSCRATSPGPGRPCC

32

GGAA A L C + S G CC

11

GGAAAEAGLTDSSDSLYGFCSSPSGSHGSWCC

42

25.7%

NZ_CP014228.1:

Lanthipeptides: AXF14_RS11840_lanthipeptide

3

AATLAATCTEDTRLISSCRATSPG

26

T C DT L SCR + G

9

VVTTVTACWNDTALWGSCRLGTRG

32

MIBiG 4.0 matches for BMZ54_RS27655

14.3%

BGC0000517.4 (BAB04173.1):

Lanthipeptide: haloduracin β or haloduracin α

8

ATCTEDTRLISSCR

21

A CT + SC

15

AYCTLTVECMPSCN

28

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.64 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.31 out of 28.19

Confidence: medium

Additional weak hits (7):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.83 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.41 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.96 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.10 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.29 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 26.78 out of 31.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.05 out of 39.62

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

BMZ54_RS27655 - Class I

Cleavage pHMM score: -13.70

RODEO score: 16

Monoisotopic mass: 3319.6 Da

Molecular weight: 3321.8 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3339.8 Da N = 1; 3357.9 Da N = 2; 3375.9 Da N = 3; 3393.9 Da N = 4

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 147 - 234; Score: 29.2

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_FOBB01000021.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 1,895 nt. (total: 1,895 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

BMZ54_RS32650: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001844.4	0.57	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001844.4	0.57	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NZ_FOBB01000008.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 11,233 - 52,348 nt. (total: 41,116 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BMZ54_RS24840: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

Transferases: glycosyltransferase

BMZ54_RS24870: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Ligases: synthase

BMZ54_RS24850: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

BMZ54_RS24875: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.53	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001962.3	0.51	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0002403.2	0.48	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0002332.2	0.45	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001831.3	0.45	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000280.5	0.43	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001387.5	0.38	other (other)	nucleocidin	Streptomyces calvus
BGC0000903.3	0.38	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002316.2	0.36	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000516.4	0.34	ribosomal	geobacillin II	Geobacillus thermodenitrificans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.53	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001962.3	0.51	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0002403.2	0.48	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0002332.2	0.45	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001831.3	0.45	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000280.5	0.43	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001387.5	0.38	other (other)	nucleocidin	Streptomyces calvus
BGC0000903.3	0.38	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002316.2	0.36	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000516.4	0.34	ribosomal	geobacillin II	Geobacillus thermodenitrificans

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

Additional weak hits (10):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.66 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.78 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.62 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.75 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.95 out of 20.01

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.45 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.45 out of 26.06

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.37 out of 32.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.03 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.18 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_FOBB01000008.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 306,050 - 326,997 nt. (total: 20,948 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BMZ54_RS25845: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: hydrolase

BMZ54_RS25815: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

BMZ54_RS25850: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

BMZ54_RS25820: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002365.2	0.35	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001043.4	0.35	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000996.5	0.35	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0000999.4	0.35	NRPS, PKS	heat-stable antifungal factor	Lysobacter enzymogenes
BGC0001726.4	0.32	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0002509.3	0.32	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0001556.5	0.31	NRPS, PKS	combamide	Streptomyces sp.
BGC0001344.4	0.30	NRPS, PKS	tubulysin A, tubulysin B, tubulysin C, tubulysin D, tubulysin E, tubulysin F, tubulysin G, tubulysin H, tubulysin I	Cystobacter sp. SBCb004
BGC0002342.3	0.30	NRPS, PKS	myxofacycline C, myxofacycline D, myxofacycline G, myxofacycline E, myxofacycline A, myxofacycline F, myxofacycline B	Myxococcus xanthus
BGC0002434.2	0.30	NRPS, PKS	clifednamide D, clifednamide E, clifednamide F, clifednamide G, clifednamide H, clifednamide I, clifednamide J	Kitasatospora sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002365.2	0.35	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001043.4	0.35	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000996.5	0.35	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0000999.4	0.35	NRPS, PKS	heat-stable antifungal factor	Lysobacter enzymogenes
BGC0001726.4	0.32	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0002509.3	0.32	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0001556.5	0.31	NRPS, PKS	combamide	Streptomyces sp.
BGC0001344.4	0.30	NRPS, PKS	tubulysin A, tubulysin B, tubulysin C, tubulysin D, tubulysin E, tubulysin F, tubulysin G, tubulysin H, tubulysin I	Cystobacter sp. SBCb004
BGC0002342.3	0.30	NRPS, PKS	myxofacycline C, myxofacycline D, myxofacycline G, myxofacycline E, myxofacycline A, myxofacycline F, myxofacycline B	Myxococcus xanthus
BGC0002434.2	0.30	NRPS, PKS	clifednamide D, clifednamide E, clifednamide F, clifednamide G, clifednamide H, clifednamide I, clifednamide J	Kitasatospora sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

BMZ54_RS25820: T1TS

Domain 1 (6 - 277): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.36 out of 21.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.98 out of 29.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 27.64 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.34 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.86 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.67 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.82 out of 27.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.84 out of 36.54

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.12 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

NZ_FOBB01000008.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 339,779 - 372,387 nt. (total: 32,609 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

BMZ54_RS25985: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BMZ54_RS25995: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BMZ54_RS26000: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0000342.4	0.67	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0000342.4	0.67	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.79 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.60 out of 28.19

Confidence: medium

Additional weak hits (5):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.55 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.73 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.84 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.74 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.18 out of 28.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 339778 - 372387:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - Lys - Lys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BMZ54_RS25995: fatty_acid - Lys - Lys

Search NORINE for peptide: strict or relaxed

CAL_domain (505..946): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 122.4
NH2: 42.2
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1590..1979): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: lys (Lys)

Stachelhaus prediction details:

Stachelhaus sequence:: YGFAFDTAVEEPSSISGGDYNTYGPTETTVCATY
Nearest Stachelhaus code(s):: Lys DAESIGSVCK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2638..3022): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YTFSFDTSIEEPSVITGGDYNTYGPVESTVCATY
Nearest Stachelhaus code(s):: Lys DAESIGSVCK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

BMZ54_RS26000: X

AMP-binding (263..531): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWLAFDASVQQADILVGGE---------------
Nearest Stachelhaus code(s):: Gln DAQDLGVVDK (47% 8Å match); Ile DAQDLGVVDK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_FOBB01000009.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 70,022 - 91,131 nt. (total: 21,110 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

BMZ54_RS26335: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

BMZ54_RS26365: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002306.2	0.49	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0002260.3	0.46	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0002005.2	0.46	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0000588.5	0.44	ribosomal	microcin L	Escherichia coli
BGC0002698.2	0.43	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001210.5	0.43	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002640.2	0.42	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001861.4	0.42	ribosomal	bacillicin BAG2O	Bacillus cereus BAG2O-1
BGC0000587.5	0.41	ribosomal	microcin H47	Escherichia coli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002306.2	0.49	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0002260.3	0.46	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0002005.2	0.46	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0000588.5	0.44	ribosomal	microcin L	Escherichia coli
BGC0002698.2	0.43	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001210.5	0.43	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002640.2	0.42	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001861.4	0.42	ribosomal	bacillicin BAG2O	Bacillus cereus BAG2O-1
BGC0000587.5	0.41	ribosomal	microcin H47	Escherichia coli

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

BMZ54_RS26335: T1TS

Domain 1 (78 - 350): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.07 out of 18.46

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.08 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.17 out of 27.78

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

Additional weak hits (4):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.41 out of 21.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.07 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.21 out of 32.93

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.98 out of 27.04

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence

NZ_FOBB01000002.1 - Region 1 - T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 310,408 - 361,832 nt. (total: 51,425 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BMZ54_RS08570: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BMZ54_RS08595: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase

BMZ54_RS08635: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

BMZ54_RS08640: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: dehalogenase hydrolase

BMZ54_RS08580: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

BMZ54_RS08645: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase synthase

BMZ54_RS08625: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BMZ54_RS08630: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BMZ54_RS08655: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BMZ54_RS08660: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002192.3	0.60	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.55	PKS	ACT-Toxin II	Alternaria alternata
BGC0000451.5	0.36	NRPS	turnerbactin	Teredinibacter turnerae T7901
BGC0000056.3	0.35	PKS	esperamicin	Actinomadura verrucosospora
BGC0001928.2	0.35	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.54	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000451.5	0.51	NRPS	turnerbactin	Teredinibacter turnerae T7901

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.22 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.02 out of 27.78

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.94 out of 21.55

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 25.31

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.67 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.64 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.25 out of 28.19

Confidence: medium

Additional weak hits (17):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.88 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.16 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.80 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.76 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.79 out of 39.62

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.38 out of 32.74

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.88 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.35 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.61 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.86 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.42 out of 39.62

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.29 out of 36.54

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.79 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.71 out of 33.14

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.59 out of 30.11

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 310407 - 361832:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (pk)
Non-colinear ordering:: BMZ54_RS08655 + BMZ54_RS08650

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 310407 - 354703:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (pk)
Non-colinear ordering:: BMZ54_RS08655 + BMZ54_RS08650

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 314731 - 361832:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (pk)
Non-colinear ordering:: BMZ54_RS08655 + BMZ54_RS08650

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BMZ54_RS08655: pk

PKS_AT (606..820): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 15.8
Malonyl-CoA: 1.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BMZ54_RS08660: mal

PKS_AT (1186..1473): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 73.3
Methoxymalonyl-CoA: 28.3
inactive: 26.4
Methylmalonyl-CoA: 21.5
Propionyl-CoA: 14.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_FOBB01000002.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 488,285 - 509,250 nt. (total: 20,966 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase glycosyltransferase

BMZ54_RS09140: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

BMZ54_RS09145: sugar transferase

smcogs: SMCOG1146: sugar transferase

BMZ54_RS09155: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Lyases: cyclase

BMZ54_RS09185: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000742.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000743.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0001817.5	0.45	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000741.3	0.41	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.41	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.41	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000800.5	0.41	saccharide	xanthan	Xanthomonas campestris
BGC0001410.3	0.40	saccharide	polysaccharide A	Bacteroides fragilis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000742.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000743.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0001817.5	0.45	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000741.3	0.41	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.41	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.41	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000800.5	0.41	saccharide	xanthan	Xanthomonas campestris
BGC0001410.3	0.40	saccharide	polysaccharide A	Bacteroides fragilis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene			C10	C1-C10	none
sesquiterpene			C15	C1-C10	none

Genes with terpene domains:

BMZ54_RS09185: T1TS

Domain 1 (1 - 313): Type 1 terpene synthase

Subtype: Germacrene A synthase type

Reactions:: GPP → monoterpene_C1-C10; FPP → sesquiterpene_C1-C10

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.22 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.03 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.47 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.72 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.52 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.06 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.70 out of 26.06

Confidence: medium

Additional weak hits (3):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.27 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.45 out of 26.06

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.85 out of 30.98

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GPP	Geranyl diphoshate

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_FOBB01000002.1 - Region 3 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 887,046 - 908,992 nt. (total: 21,947 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BMZ54_RS10655: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000843.5	0.27	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001428.4	0.26	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001421.4	0.26	NRPS, PKS	myxochromide B	Myxococcus sp.
BGC0001427.4	0.26	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001424.4	0.26	NRPS, PKS	myxochromide C	Myxococcus virescens
BGC0001426.4	0.26	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001423.4	0.26	NRPS, PKS	myxochromide C	Myxococcus hansupus
BGC0001425.4	0.26	NRPS, PKS	myxochromide A	Myxococcus xanthus DK 1622
BGC0001057.4	0.24	NRPS, PKS	zearalenone	Fusarium graminearum
BGC0001422.4	0.22	NRPS, PKS	myxochromide A	Myxococcus fulvus HW-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000843.5	0.27	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001428.4	0.26	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001421.4	0.26	NRPS, PKS	myxochromide B	Myxococcus sp.
BGC0001427.4	0.26	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001424.4	0.26	NRPS, PKS	myxochromide C	Myxococcus virescens
BGC0001426.4	0.26	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001423.4	0.26	NRPS, PKS	myxochromide C	Myxococcus hansupus
BGC0001425.4	0.26	NRPS, PKS	myxochromide A	Myxococcus xanthus DK 1622
BGC0001057.4	0.24	NRPS, PKS	zearalenone	Fusarium graminearum
BGC0001422.4	0.22	NRPS, PKS	myxochromide A	Myxococcus fulvus HW-1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.02 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.77 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.86 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.62 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.32 out of 26.06

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description

NZ_FOBB01000002.1 - Region 4 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 926,338 - 948,731 nt. (total: 22,394 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

BMZ54_RS10845: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	lanthipeptide-class-iv	Similarity score	Type	Compound(s)	Organism
BGC0000868.5		0.30	other (other)	teichuronic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001654.5		0.24	saccharide	lipooligosaccharide	Bacteroides thetaiotaomicron VPI-5482

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0000868.5		0.30	other (other)	teichuronic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001654.5		0.24	saccharide	lipooligosaccharide	Bacteroides thetaiotaomicron VPI-5482

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.05 out of 21.55

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.40 out of 30.25

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.66 out of 32.93

Confidence: medium

Additional weak hits (7):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.70 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 29.41 out of 39.62

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.84 out of 32.74

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.81 out of 36.54

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 20.26 out of 30.12

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.27 out of 26.85

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
ColR	Phenol-responsive regulator
LexA variant 3	Repressor of DNA damage response

NZ_FOBB01000002.1 - Region 5 - terpene

Download region GenBank file

Download region SVG

Location: 1,109,852 - 1,130,829 nt. (total: 20,978 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

BMZ54_RS11460: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	terpene	Similarity score	Type	Compound(s)	Organism
BGC0001642.3		0.75	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0000080.5		0.23	PKS	jerangolid A, jerangolid D	Sorangium cellulosum

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0001642.3		0.75	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0000080.5		0.23	PKS	jerangolid A, jerangolid D	Sorangium cellulosum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene			C10	C1-C10	none
sesquiterpene			C15	C1-C10	none

Genes with terpene domains:

BMZ54_RS11460: T1TS

Domain 1 (9 - 322): Type 1 terpene synthase

Subtype: Germacrene A synthase type

Reactions:: GPP → monoterpene_C1-C10; FPP → sesquiterpene_C1-C10

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.22 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.89 out of 27.78

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 21.55

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.10 out of 24.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.34 out of 28.19

Confidence: medium

Additional weak hits (6):

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.55 out of 30.11

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 22.87 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.99 out of 26.06

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 21.24 out of 30.12

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.58 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.88 out of 26.06

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GPP	Geranyl diphoshate

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 2	Repressor of DNA damage response
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_FOBB01000013.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 140,215 - 177,456 nt. (total: 37,242 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

BMZ54_RS31525: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

BMZ54_RS31560: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

BMZ54_RS31600: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.70	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.57	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0000590.5	0.51	ribosomal	microcin N	Escherichia coli
BGC0001229.4	0.47	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0002698.2	0.47	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001392.5	0.46	ribosomal	pinensins	Chitinophaga pinensis DSM 2588
BGC0001289.5	0.46	ribosomal	penisin	Paenibacillus ehimensis
BGC0000517.4	0.46	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0002674.2	0.46	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0000504.5	0.46	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.70	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.57	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0000590.5	0.51	ribosomal	microcin N	Escherichia coli
BGC0001229.4	0.47	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0002698.2	0.47	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001392.5	0.46	ribosomal	pinensins	Chitinophaga pinensis DSM 2588
BGC0001289.5	0.46	ribosomal	penisin	Paenibacillus ehimensis
BGC0000517.4	0.46	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0002674.2	0.46	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0000504.5	0.46	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for BMZ54_RS31560

BMZ54_RS31540

Leader:

MKLQKKLTAKLSFTKQTIAKLNEDAMAS

Core:

IRGGAGAAAEGFNIPILGAISYAECASTGQPTCNTQGDQSF

Core with dehydrations:

IRGGAGAAAEGFNIPILGAIDhaYAECysADhaDhbGQPDhbCysNDhbQGDQDhaF

antiSMASH-DB 4.0 matches for BMZ54_RS31540

100.0%

NZ_FOBB01000013.1:

Lanthipeptides: BMZ54_RS31540_lanthipeptide

1

IRGGAGAAAEGFNIPILGAISYAECASTGQPTCNTQGDQSF

41

IRGGAGAAAEGFNIPILGAISYAECASTGQPTCNTQGDQSF

1

IRGGAGAAAEGFNIPILGAISYAECASTGQPTCNTQGDQSF

41

24.4%

NC_015215.1:

Lanthipeptides: allorf_0087347_0087508_lanthipeptide

14

IPILGAISYAECASTGQPTC---NTQGDQS

40

P G S+AEC + C N+ D+S

4

FPQNGWKSFAECKGIRELDCESYNSSRDES

33

22.0%

NZ_CP039297.1and 3 others:

NZ_CP040672.1 Lanthipeptides: allorf_1096094_1096255_lanthipeptideNZ_CP059318.1 Lanthipeptides: allorf_0101095_0101256_lanthipeptideNZ_CP087137.1 Lanthipeptides: allorf_0100933_0101094_lanthipeptide

Lanthipeptides: allorf_0101160_0101321_lanthipeptide

13

NIPILGAISYAECASTGQPTCNT

35

P G S+AEC T + C T

3

RFPQNGWKSFAECKGTRELDCET

25

with 6 more sequence matches

22.0%

NZ_FOMK01000014.1:

Lanthipeptides: allorf_183755_183922_lanthipeptide

24

ECASTGQPTCNTQGDQSF

41

+C STG +CNT G+ +F

15

DCVSTGDASCNT-GNVTF

31

17.4%

NZ_QVFA01000004.1:

Lanthipeptides: DW882_RS14120_lanthipeptide

16

ILGAISYAECASTGQPTCNTQG

37

++ AIS A T P C +G

25

VVSAISNISAAMTKVPACKPKG

46

14.6%

NZ_BMRD01000003.1:

Lanthipeptides: allorf_069062_069292_lanthipeptide

25

CASTGQPTCNTQGD

38

C ++G+P QGD

5

CLASGRPIIGNQGD

18

14.6%

NZ_BMTW01000001.1:

Lanthipeptides: IE134_RS03425_lanthipeptide

28

TGQPTCNTQGDQSF

41

TG+P C G +S+

3

TGRPRCRRPGSRSW

16

14.6%

NZ_CP099993.1:

Lanthipeptides: NGM10_RS05615_lanthipeptide

23

AECASTGQPTCNTQGDQ

39

+ C + P CN+ GD

1

SSCYISDDPVCNSPGDD

17

14.5%

NZ_NNBO01000009.1:

Lanthipeptides: allorf_135626_135823_lanthipeptide

13

NIPILGAISYAECASTGQP

31

++P+LG CA TG+P

41

HVPLLG-----RCAETGRP

54

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.77 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.30 out of 27.78

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.63 out of 27.55

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.54 out of 26.33

Confidence: medium

Additional weak hits (6):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.27 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.63 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.32 out of 33.14

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 23.44 out of 30.12

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.60 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.40 out of 20.01

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

BMZ54_RS31540 - Class I

Cleavage pHMM score: -12.70

RODEO score: 14

Monoisotopic mass: 3934.9 Da

Molecular weight: 3937.3 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3955.3 Da N = 1; 3973.3 Da N = 2; 3991.3 Da N = 3; 4009.3 Da N = 4

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_FOBB01000006.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 128,849 - 216,204 nt. (total: 87,356 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: esterase

BMZ54_RS22010: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

BMZ54_RS22000: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BMZ54_RS22020: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BMZ54_RS22025: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BMZ54_RS22030: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BMZ54_RS22035: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BMZ54_RS22040: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BMZ54_RS22045: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BMZ54_RS22050: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.86	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.86	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.82	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001249.5	0.82	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002286.3	0.81	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.81	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.81	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.80	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.79	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.74	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.02 out of 27.78

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 23.75 out of 25.31

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

Additional weak hits (7):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.71 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.26 out of 20.01

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.82 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.50 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.66 out of 30.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.26 out of 31.73

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 128848 - 216204:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala - X - X - X) + (ohmal) + (Ser) + (mal) + (Ser - Ser - Lys) + (mal) + (Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BMZ54_RS22000: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (458..848): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSITFDISILEAQALCGGDWNMYGPTETTIWSST
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

BMZ54_RS22025: Ser - Ser - Lys

Search NORINE for peptide: strict or relaxed

AMP-binding (538..929): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFTSGEMNLYGPTEASIDVTY
Nearest Stachelhaus code(s):: Ser DVWHFSLIDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1594..1978): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEMHFVCSGEHNLYGPTEAAIDVTS
Nearest Stachelhaus code(s):: Ser DVWHVSLIDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2656..3035): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YTFAFDTSVEEPSTISGGDYNTYGPTESTVCATY
Nearest Stachelhaus code(s):: Lys DAESIGSVCK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

BMZ54_RS22030: mal

PKS_AT (530..810): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 88.9
inactive: 43.8
Methoxymalonyl-CoA: 25.0
Methylmalonyl-CoA: 19.1
Propionyl-CoA: 1.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BMZ54_RS22035: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (541..927): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWELHFICSGEYNLYGPTEAAIDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

BMZ54_RS22040: mal

PKS_AT (521..801): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 141.1
inactive: 79.1
Methoxymalonyl-CoA: 38.0
Methylmalonyl-CoA: 22.7
fatty_acid: 10.3
trans-1,2-CPDA: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BMZ54_RS22045: X

A-OX (372..1133): X

No predictions made

BMZ54_RS22050: Ala - X - X

Search NORINE for peptide: strict or relaxed

AMP-binding (225..601): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: FWATFDLSVFEYNTNLAGERNLYGPSEDTTYSTC
Nearest Stachelhaus code(s):: Ala DLFNNALTYK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1251..1632): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FFYAFDAAVMEAYMLAGVELNAYGPTEATIVSCA
Nearest Stachelhaus code(s):: Thr DGMLVGAIVK (56% 8Å match); bOH-Tyr DASTLGAICK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2279..2679): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FVYSFDASVKDGHMDLGGEVNDYGPTESTIVSQK
Nearest Stachelhaus code(s):: D-bMe-Asp DARHVGIFVK (47% 8Å match); Leu DAWFLGNIVK (44% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ToxT	Regulator of MSHA biosynthesis

NZ_FOBB01000006.1 - Region 2 - arylpolyene,resorcinol

Download region GenBank file

Download region SVG

Location: 262,155 - 308,456 nt. (total: 46,302 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)
resorcinol: DarB

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

BMZ54_RS22335: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: synthase

BMZ54_RS22375: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BMZ54_RS22405: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

BMZ54_RS22420: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001526.4	0.37	other (other)	bartoloside E, bartoloside F, bartoloside G, bartoloside H, bartoloside I, bartoloside J, bartoloside K	Synechocystis salina LEGE 06099
BGC0001525.3	0.35	other (other)	bartoloside B, bartoloside C, bartoloside D	Synechocystis salina LEGE 06155
BGC0000838.3	0.28	PKS	flexirubin	Flavobacterium johnsoniae UW101
BGC0000840.5	0.27	other (other)	xanthomonadin I	Xanthomonas oryzae pv. oryzae
BGC0000255.5	0.27	PKS	pederin	Uncultured bacterium
BGC0001535.3	0.26	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002323.2	0.26	ribosomal	nisin J	Staphylococcus capitis
BGC0001618.3	0.26	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0001789.3	0.26	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000535.4	0.26	ribosomal	nisin A	Lactococcus lactis subsp. lactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001526.4	0.51	other (other)	bartoloside E, bartoloside F, bartoloside G, bartoloside H, bartoloside I, bartoloside J, bartoloside K	Synechocystis salina LEGE 06099
BGC0001525.3	0.49	other (other)	bartoloside B, bartoloside C, bartoloside D	Synechocystis salina LEGE 06155
BGC0000838.3	0.43	PKS	flexirubin	Flavobacterium johnsoniae UW101
BGC0000840.5	0.42	other (other)	xanthomonadin I	Xanthomonas oryzae pv. oryzae
BGC0000255.5	0.42	PKS	pederin	Uncultured bacterium
BGC0001535.3	0.42	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002323.2	0.42	ribosomal	nisin J	Staphylococcus capitis
BGC0001618.3	0.41	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0001789.3	0.41	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000535.4	0.41	ribosomal	nisin A	Lactococcus lactis subsp. lactis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.83 out of 26.06

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.35 out of 20.97

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.27 out of 30.11

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.00 out of 26.06

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.99 out of 27.55

Confidence: medium

Additional weak hits (12):

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 21.73 out of 30.11

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.08 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.74 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.27 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.00 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.04 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.65 out of 27.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.99 out of 28.14

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.53 out of 33.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.72 out of 29.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.85 out of 30.22

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 22.81 out of 36.54

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
GnfM	Regulator of nitrogen-fixation genes
MogR	Repressor of flagellar motility genes

NZ_FOBB01000020.1 - Region 1 - NRPS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 13,773 nt. (total: 13,773 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

BMZ54_RS32640: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: ligase synthase

BMZ54_RS32630: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BMZ54_RS32635: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BMZ54_RS32645: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.86	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.76	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.67	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.67	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 13773:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn) + (ohmal - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BMZ54_RS32630: X

AMP-binding (258..652): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MGQAFDVCGFEMAFITGGEHNAYGPTECTVCAAT
Nearest Stachelhaus code(s):: Ac-OH-Orn DVFALGAVNK (50% 8Å match)
Stachelhaus code match:: 80% (moderate)

BMZ54_RS32640: mal

PKS_AT (8..292): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 96.3
inactive: 41.8
Methoxymalonyl-CoA: 31.7
Methylmalonyl-CoA: 31.0
Propionyl-CoA: 30.8
Benzoyl-CoA: 20.2
2-Methylbutyryl-CoA: 17.5
CHC-CoA: 13.6
Ethylmalonyl-CoA: 12.5
Isobutyryl-CoA: 12.2
Acetyl-CoA: 7.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

BMZ54_RS32645: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (538..930): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATFDLTVTSCKLIAGGDINEYGPTEATVGCIV
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_FOBB01000005.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 344,862 - 355,692 nt. (total: 10,831 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

BMZ54_RS20900: hydrolase

smcogs: SMCOG1179: hydrolase

Similar gene clusters

Analysis type:

Reference	RiPP-like	Similarity score	Type	Compound(s)	Organism
BGC0002788.2		0.19	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0002788.2		0.19	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.76 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 22.84 out of 36.54

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_FOBB01000005.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 439,776 - 460,747 nt. (total: 20,972 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BMZ54_RS21250: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Hydrolases: protease

BMZ54_RS21245: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: synthase synthetase

BMZ54_RS21190: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

BMZ54_RS21215: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: permease

BMZ54_RS21220: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000622.5	0.50	ribosomal	megacin	Bacillus megaterium
BGC0001632.3	0.44	ribosomal	kawaguchipeptin A	Microcystis aeruginosa NIES-88
BGC0002213.3	0.41	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000508.3	0.38	ribosomal	epidermin	Staphylococcus epidermidis
BGC0001880.3	0.38	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000678.5	0.38	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000649.3	0.37	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000664.5	0.37	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002629.2	0.36	ribosomal	limnothamide	Limnothrix sp. CACIAM 69d

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000622.5	0.50	ribosomal	megacin	Bacillus megaterium
BGC0001632.3	0.44	ribosomal	kawaguchipeptin A	Microcystis aeruginosa NIES-88
BGC0002213.3	0.41	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000508.3	0.38	ribosomal	epidermin	Staphylococcus epidermidis
BGC0001880.3	0.38	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000678.5	0.38	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000649.3	0.37	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000664.5	0.37	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002629.2	0.36	ribosomal	limnothamide	Limnothrix sp. CACIAM 69d

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BMZ54_RS21215: PT_FPPS_like

Domain 1 (28 - 322): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.60 out of 29.72

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.78 out of 27.78

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.50 out of 32.93

Confidence: medium

Additional weak hits (3):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.94 out of 31.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.63 out of 36.54

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.00 out of 30.98

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 3	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C

NZ_FOBB01000018.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 23,578 nt. (total: 23,578 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

BMZ54_RS32510: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BMZ54_RS32515: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BMZ54_RS32525: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.68	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.68	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 23578:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser) + (D-Tyr - D-X - Val) + (Tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BMZ54_RS32510: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (670..1072): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWATFDVSVWEWHFLCSGEYNLYGPTEAAIDVTC
Nearest Stachelhaus code(s):: Ser DVWHLSLIDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

BMZ54_RS32515: Tyr - X - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (546..939): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: MDQAFDASVSEMTLITAGEFNAYGPTECAVCVSM
Nearest Stachelhaus code(s):: Tyr DASTIAAVCK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2051..2441): X

nrpys: Leu, 3OH-Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHSFDACGWEPFLLTGGDVNNYGLTETGVVATS
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DAWFLGNVVK (88% 8Å match); Leu DAWFLGNVVK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3553..3950): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGTGFDAVTFEGWFVAGGEVNGYGPTENTTFSLT
Nearest Stachelhaus code(s):: Val DAFWVGGTFK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

BMZ54_RS32525: Tyr - X

Search NORINE for peptide: strict or relaxed

AMP-binding (263..660): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: TWRAFDSAVNDSNITLAGEINEYGPAENAICSTA
Nearest Stachelhaus code(s):: His DSALTAEVCK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1338..1727): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWLAFDASVQQADILVGGELNVYGITECTVNSAC
Nearest Stachelhaus code(s):: Ile DAQDLGVVDK (76% 8Å match); Dpr DAQDLAVVNK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

NZ_FOBB01000015.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 61,111 nt. (total: 61,111 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

BMZ54_RS32200: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase

BMZ54_RS32210: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

BMZ54_RS32165: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BMZ54_RS32170: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BMZ54_RS32180: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BMZ54_RS32185: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BMZ54_RS32190: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BMZ54_RS32195: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BMZ54_RS32205: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.71	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.71	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.09 out of 27.78

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.81 out of 27.55

Confidence: medium

Additional weak hits (3):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 25.85 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 61111:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asp) + (D-X) + (Asn - X) + (ohmal - Asp) + (Asn - X) + (D-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BMZ54_RS32170: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (427..827): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YWFSFDLCYTASKLVCGGEVNHYGPTETTIGAVA
Nearest Stachelhaus code(s):: Asp DLTKVGHIGK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

BMZ54_RS32180: X

AMP-binding (259..649): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: THHMFDGSLLDTTIISAGEYNGYGPSEITVNATL
Nearest Stachelhaus code(s):: Val DGGQIAGVYK (56% 8Å match); Trp DGWTISGVCK (53% 8Å match); Phe DAWTIAGVCK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

BMZ54_RS32185: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (472..866): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATFDLTLTSTKLIVGGEYNEYGPTEATIGCTV
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

BMZ54_RS32190: X

AMP-binding (238..627): X

nrpys: Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TDHAFDVAVCEIMFITGGEYNAYGPTECAICAAI
Nearest Stachelhaus code(s):: Leu DAMLIGAICK (59% 8Å match); Arg DVESIGAIAK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

BMZ54_RS32200: Asp - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (414..818): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YWLAFDLGYTSGKLILGGEFNHYGPTETTIGTVF
Nearest Stachelhaus code(s):: Asp DLTKIGHIGK (71% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1866..2149): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATFDLTLTSCKLIVGGEYNEYGPTENTIGCTM
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

BMZ54_RS32205: X - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (240..626): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MWFTFDALAELPQFILSGEYNLYGCSEGTASSTI
Nearest Stachelhaus code(s):: Ala DILQISLVYK (47% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1288..1690): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MSWAFDVFIGDRESILGSDINSYGCTEATIDSSF
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
ToxT	Regulator of MSHA biosynthesis

NZ_FOBB01000004.1 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 342,644 - 365,718 nt. (total: 23,075 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: reductase

BMZ54_RS18325: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Lyases: dehydratase hydratase

BMZ54_RS18285: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

BMZ54_RS18300: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.74	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.48	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0002316.2	0.44	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001289.5	0.42	ribosomal	penisin	Paenibacillus ehimensis
BGC0000559.4	0.41	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000506.4	0.40	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0001701.4	0.40	ribosomal	nisin O	Blautia obeum
BGC0000537.3	0.39	ribosomal	nisin U	Streptococcus uberis
BGC0000541.5	0.39	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001789.3	0.39	ribosomal	suicin 90-1330	Streptococcus suis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.74	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.48	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0002316.2	0.44	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001289.5	0.42	ribosomal	penisin	Paenibacillus ehimensis
BGC0000559.4	0.41	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000506.4	0.40	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0001701.4	0.40	ribosomal	nisin O	Blautia obeum
BGC0000537.3	0.39	ribosomal	nisin U	Streptococcus uberis
BGC0000541.5	0.39	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001789.3	0.39	ribosomal	suicin 90-1330	Streptococcus suis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.98 out of 23.79

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.22 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.37 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.59 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.50 out of 28.19

Confidence: medium

Additional weak hits (3):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.98 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.08 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.40 out of 36.54

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 143 - 228; Score: 25.3

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_FOBB01000001.1 - Region 1 - microviridin

Download region GenBank file

Download region SVG

Location: 1,350,852 - 1,371,243 nt. (total: 20,392 nt) Show pHMM detection rules used

microviridin: (mvd or mvnA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000593.4	0.68	ribosomal	microviridin J	Microcystis aeruginosa MRC
BGC0000592.5	0.58	ribosomal	microviridin B	Microcystis aeruginosa NIES-298
BGC0002049.3	0.55	ribosomal	microviridin N9, microviridin N8, microviridin N7, microviridin N6, microviridin N5, microviridin N4, microviridin N3	Nostoc punctiforme PCC 73102
BGC0000594.5	0.50	ribosomal	microviridin K	Planktothrix agardhii NIVA-CYA 126/8
BGC0000591.5	0.49	ribosomal	marinostatin	Alteromonas sp. B-10-31
BGC0002626.2	0.45	ribosomal	microviridin 1688, microviridin 1739, microviridin 1748	Nostoc sp. TH1S01
BGC0002382.3	0.42	ribosomal	grimoviridin	Grimontia marina
BGC0002339.3	0.31	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0000665.5	0.29	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000663.5	0.28	terpene	hopene	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000593.4	0.68	ribosomal	microviridin J	Microcystis aeruginosa MRC
BGC0000592.5	0.58	ribosomal	microviridin B	Microcystis aeruginosa NIES-298
BGC0002049.3	0.55	ribosomal	microviridin N9, microviridin N8, microviridin N7, microviridin N6, microviridin N5, microviridin N4, microviridin N3	Nostoc punctiforme PCC 73102
BGC0000594.5	0.50	ribosomal	microviridin K	Planktothrix agardhii NIVA-CYA 126/8
BGC0000591.5	0.49	ribosomal	marinostatin	Alteromonas sp. B-10-31
BGC0002626.2	0.45	ribosomal	microviridin 1688, microviridin 1739, microviridin 1748	Nostoc sp. TH1S01
BGC0002382.3	0.42	ribosomal	grimoviridin	Grimontia marina
BGC0002339.3	0.31	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0000665.5	0.29	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000663.5	0.28	terpene	hopene	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.74 out of 27.78

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.47 out of 21.55

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 25.09 out of 25.88

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.84 out of 29.72

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.45 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.71 out of 18.16

Confidence: strong

Additional weak hits (7):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.35 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.92 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.11 out of 31.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.01 out of 32.93

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.99 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.28 out of 39.62

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.39 out of 28.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
ArcA	Repressor of carbon oxidation
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
NtrC	Nitrogen regulatory protein C
PsrA	Oleic acid responsive regulator
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_FOBB01000001.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1,622,143 - 1,643,126 nt. (total: 20,984 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BMZ54_RS06615: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase

BMZ54_RS06575: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: synthetase

BMZ54_RS06585: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002584.2	0.40	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002007.2	0.38	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000632.5	0.37	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0001206.5	0.37	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000665.5	0.37	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000936.5	0.36	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000925.5	0.36	other (other)	quinolobactin	Pseudomonas fluorescens
BGC0000678.5	0.35	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002584.2	0.40	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002007.2	0.38	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000632.5	0.37	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0001206.5	0.37	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000665.5	0.37	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000936.5	0.36	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000925.5	0.36	other (other)	quinolobactin	Pseudomonas fluorescens
BGC0000678.5	0.35	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BMZ54_RS06585: PT_FPPS_like

Domain 1 (40 - 322): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.69 out of 28.19

Confidence: medium

Additional weak hits (3):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.08 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.32 out of 29.38

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 21.04 out of 30.12

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
ZuR variant 1	Zinc-responsive repressor

NZ_FOBB01000007.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 92,262 - 118,479 nt. (total: 26,218 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BMZ54_RS23490: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Lyases: cyclase dehydratase

BMZ54_RS23440: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

BMZ54_RS23460: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.57	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001289.5	0.47	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0001392.5	0.42	ribosomal	pinensins	Chitinophaga pinensis DSM 2588
BGC0000544.4	0.41	ribosomal	planosporicin	Planomonospora alba
BGC0002663.2	0.37	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0002026.3	0.35	NRPS, PKS	thaxteramide A1, thaxteramide A2, thaxteramide B1, thaxteramide B2	Jahnella sp. MSr9139

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.57	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001289.5	0.47	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0001392.5	0.42	ribosomal	pinensins	Chitinophaga pinensis DSM 2588
BGC0000544.4	0.41	ribosomal	planosporicin	Planomonospora alba
BGC0002663.2	0.37	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0002026.3	0.35	NRPS, PKS	thaxteramide A1, thaxteramide A2, thaxteramide B1, thaxteramide B2	Jahnella sp. MSr9139

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.22 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.54 out of 26.06

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.87 out of 29.72

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.97 out of 27.78

Confidence: medium

Additional weak hits (6):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.24 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.69 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.53 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.62 out of 29.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 24.35 out of 33.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.89 out of 33.14

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 148 - 237; Score: 63.7

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes
NtrC	Nitrogen regulatory protein C
ToxT	Regulator of MSHA biosynthesis

NZ_FOBB01000007.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 311,956 - 332,957 nt. (total: 21,002 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

BMZ54_RS24330: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001428.4	0.25	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001424.4	0.25	NRPS, PKS	myxochromide C	Myxococcus virescens
BGC0000398.5	0.24	NRPS	orfamide B	Pseudomonas sp. CMR12a
BGC0002060.3	0.22	PKS	secimide	Pseudomonas syringae pv. syringae B728a
BGC0001422.4	0.21	NRPS, PKS	myxochromide A	Myxococcus fulvus HW-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001428.4	0.25	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001424.4	0.25	NRPS, PKS	myxochromide C	Myxococcus virescens
BGC0000398.5	0.24	NRPS	orfamide B	Pseudomonas sp. CMR12a
BGC0002060.3	0.22	PKS	secimide	Pseudomonas syringae pv. syringae B728a
BGC0001422.4	0.21	NRPS, PKS	myxochromide A	Myxococcus fulvus HW-1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene			C10	C1-C10	none
sesquiterpene			C15	C1-C10	none

Genes with terpene domains:

BMZ54_RS24330: T1TS

Domain 1 (1 - 312): Type 1 terpene synthase

Subtype: Germacrene A synthase type

Reactions:: GPP → monoterpene_C1-C10; FPP → sesquiterpene_C1-C10

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.40 out of 27.78

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.51 out of 27.55

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.22 out of 32.93

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.59 out of 32.93

Confidence: medium

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GPP	Geranyl diphoshate

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
LexA variant 3	Repressor of DNA damage response

NZ_FOBB01000011.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 79,182 - 110,837 nt. (total: 31,656 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BMZ54_RS29005: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Hydrolases: peptidase

BMZ54_RS29055: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: decarboxylase

BMZ54_RS29030: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: ligase

BMZ54_RS28990: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.63	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0001499.5	0.57	other (other)	aerobactin	Pantoea ananatis
BGC0000941.3	0.56	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.56	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001478.5	0.56	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0001531.5	0.56	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002464.3	0.56	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0001498.5	0.55	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0000939.5	0.54	other (other)	aerobactin	Grimontia hollisae
BGC0002692.2	0.54	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.63	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0001499.5	0.57	other (other)	aerobactin	Pantoea ananatis
BGC0000941.3	0.56	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.56	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001478.5	0.56	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0001531.5	0.56	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002464.3	0.56	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0001498.5	0.55	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0000939.5	0.54	other (other)	aerobactin	Grimontia hollisae
BGC0002692.2	0.54	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.64 out of 30.25

Confidence: medium

Additional weak hits (3):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.11 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.28 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.47 out of 21.55

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ColR	Phenol-responsive regulator

NZ_FOBB01000012.1 - Region 1 - NRPS,T1PKS,lanthipeptide-class-i,terpene

Download region GenBank file

Download region SVG

Location: 92,206 - 193,552 nt. (total: 101,347 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

BMZ54_RS30280: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

BMZ54_RS30450: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

BMZ54_RS33615: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: esterase hydrolase

BMZ54_RS30260: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

BMZ54_RS30405: thioesterase

smcogs: SMCOG1004: thioesterase

BMZ54_RS30445: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

BMZ54_RS30530: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: cyclase dehydratase

BMZ54_RS30300: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

BMZ54_RS30305: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

BMZ54_RS30470: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

BMZ54_RS30485: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Ligases: ligase synthase

BMZ54_RS30415: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BMZ54_RS30420: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BMZ54_RS30430: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BMZ54_RS30455: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BMZ54_RS30460: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BMZ54_RS30465: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.87	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.84	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.80	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.78	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002071.2	0.77	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001128.4	0.77	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.76	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.71	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	0.72	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

BMZ54_RS30300: T1TS

Domain 1 (9 - 302): Type 1 terpene synthase

Subtype: unknown

BMZ54_RS30305: T1TS

Domain 1 (8 - 281): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.19 out of 27.78

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.00 out of 29.72

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.89 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.13 out of 28.19

Confidence: medium

Additional weak hits (13):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.96 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.28 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.56 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.50 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.35 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 25.53 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.01 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.15 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.66 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.45 out of 31.73

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.13 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.35 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.57 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 1, location 92205 - 193552:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - mal - Ser - X) + (X) + (X - Orn - Orn) + (X - Cys - D-Asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 108386 - 193552:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - mal - Ser - X) + (X) + (X - Orn - Orn) + (X - Cys - D-Asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BMZ54_RS30415: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (263..660): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATFDLTITCTKLIVGGEYNEYGPTEITVGCTV
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

BMZ54_RS30420: X - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (5..429): X

nrpys: Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWQIFDASLRDVHCIMAGEVNFYGPSETTLIKSF
Nearest Stachelhaus code(s):: Asp DPRHLALLAK (62% 8Å match); cohOhi DVHIIAFLVK (44% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1086..1485): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: LWVTFDLSVYDGDSFMSGDISLGGATEGTVWSNY
Nearest Stachelhaus code(s):: Cys DLFDFSLVWK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

BMZ54_RS30430: X - Orn - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (8..435): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWETFDASLRDLHCLMAGEVNLYGTSETTLAKTF
Nearest Stachelhaus code(s):: Asp DPRHLALLAK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1092..1495): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MGWAFDVFFGDRESILGSDLNSYGTTETTIDASY
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2151..2554): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MGWAFDVFFGDRESILGSDLNSYGTTETTIDASY
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

BMZ54_RS30455: X

AMP-binding (9..421): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWESFDASLRDLHCLMAGEVNLYGTSETTLAKTF
Nearest Stachelhaus code(s):: Asp DPRHLALLAK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

BMZ54_RS30460: X

AMP-binding (9..423): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWESFDASLRDLHCLMAGEVNLYGTSETTLAKTF
Nearest Stachelhaus code(s):: Asp DPRHLALLAK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

BMZ54_RS30465: fatty_acid - mal - Ser

Search NORINE for peptide: strict or relaxed

CAL_domain (48..477): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 203.5
NH2: 47.6
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

PKS_AT (1187..1475): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 100.0%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.1
inactive: 148.1
Methoxymalonyl-CoA: 61.3
Methylmalonyl-CoA: 53.2
Propionyl-CoA: 47.9
2-Methylbutyryl-CoA: 34.3
Isobutyryl-CoA: 24.0
Ethylmalonyl-CoA: 21.5
CHC-CoA: 18.8
Benzoyl-CoA: 18.7
Acetyl-CoA: 11.4
trans-1,2-CPDA: 10.9
3-Methylbutyryl-CoA: 10.9
fatty_acid: 0.0

AMP-binding (3090..3485): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWQTFDVSVWEVHFYCSGEHNHYGPTEASVEVSN
Nearest Stachelhaus code(s):: Ser DVWHMSHVEK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
NtrC	Nitrogen regulatory protein C
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_FOBB01000003.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 237,821 - 259,863 nt. (total: 22,043 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BMZ54_RS14125: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: hydrolase

BMZ54_RS14145: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000650.3	0.61	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000637.3	0.48	terpene	carotenoid	Corynebacterium glutamicum
BGC0000644.3	0.43	terpene	carotenoid	Dietzia sp. CQ4
BGC0001456.3	0.42	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.41	terpene	carotenoid	Streptomyces avermitilis
BGC0000636.3	0.39	terpene	carotenoid	Brevibacterium linens
BGC0001902.3	0.27	NRPS, PKS	bengamide	Myxococcus virescens
BGC0000274.5	0.24	PKS	tetarimycin A, tetarimycin B	uncultured bacterium
BGC0002104.3	0.23	NRPS, PKS	eurocidin D, eurocidin E	Streptomyces eurocidicus ATCC 27428
BGC0000187.5	0.22	PKS	asukamycin	Streptomyces nodosus subsp. asukaensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000650.3	0.61	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000637.3	0.48	terpene	carotenoid	Corynebacterium glutamicum
BGC0000644.3	0.43	terpene	carotenoid	Dietzia sp. CQ4
BGC0001456.3	0.42	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.41	terpene	carotenoid	Streptomyces avermitilis
BGC0000636.3	0.39	terpene	carotenoid	Brevibacterium linens
BGC0001902.3	0.27	NRPS, PKS	bengamide	Myxococcus virescens
BGC0000274.5	0.24	PKS	tetarimycin A, tetarimycin B	uncultured bacterium
BGC0002104.3	0.23	NRPS, PKS	eurocidin D, eurocidin E	Streptomyces eurocidicus ATCC 27428
BGC0000187.5	0.22	PKS	asukamycin	Streptomyces nodosus subsp. asukaensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

BMZ54_RS14130: PT_phytoene_like

Domain 1 (11 - 271): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → PSPP; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

BMZ54_RS14140: Lycopene_cycl

Domain 1 (3 - 91): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.91 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.40 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.09 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.99 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.25 out of 30.25

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_FOBB01000003.1 - Region 2 - arylpolyene

Download region GenBank file

Download region SVG

Location: 845,844 - 895,770 nt. (total: 49,927 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BMZ54_RS16550: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

BMZ54_RS16650: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase halogenase methyltransferase

BMZ54_RS16605: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

BMZ54_RS16610: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

BMZ54_RS16675: methyltransferase

smcogs: SMCOG1248: methyltransferase

BMZ54_RS16690: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: deacetylase

BMZ54_RS16580: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Ligases: synthase

BMZ54_RS16560: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

BMZ54_RS16590: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BMZ54_RS16615: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BMZ54_RS16645: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

BMZ54_RS16555: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000107.3	0.56	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000866.5	0.50	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000231.5	0.49	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0002510.2	0.49	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000107.3	0.56	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000866.5	0.50	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000231.5	0.49	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0002510.2	0.49	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.76 out of 27.78

Confidence: medium

Additional weak hits (6):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.27 out of 30.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.14 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.04 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.56 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.68 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.22 out of 28.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

BMZ54_RS16535: X

AMP-binding (65..334): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNELFMAGMAYGAVVCIGEYSTYASTEMQTAFTE
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ToxT	Regulator of MSHA biosynthesis

NZ_FOBB01000016.1 - Region 1 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 1 - 31,998 nt. (total: 31,998 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase synthase

BMZ54_RS32340: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BMZ54_RS32350: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BMZ54_RS32355: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.43	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.40	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.40	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.38	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.36	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.35	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.35	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.35	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.35	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.34	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.68	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 31998:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - X) + (Val - Thr - Leu) + (Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BMZ54_RS32340: Thr - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (1776..2173): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LTEHFDFSVWEGNQIFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2848..3246): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: LWVTFDLSVYDGDSFMSGDISLGGATEATVWSNY
Nearest Stachelhaus code(s):: Cys DLFDFSLVWK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

BMZ54_RS32350: X - Val - Thr - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (262..652): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWFTFTDCHLEFQFILSGEYNLYGCTECTATTSI
Nearest Stachelhaus code(s):: Ala DILQISLVYK (44% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1301..1698): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LHIGFDAATFEGWFLVGGDINGYGPTENTTFSLT
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2354..2759): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAGHFDVTVWEGAQIFCGEINMYGITETTVHVTF
Nearest Stachelhaus code(s):: Ser DVWSIAMVHK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (3417..3805): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHSFDAAGWEPFLLTGGDANNYGPSESTVVTTS
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (85% 8Å match); Leu or Tyr DAWFLGNVVK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

BMZ54_RS32355: fatty_acid

CAL_domain (944..1381): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 37.7
shikimic_acid: 0.0
NH2: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

Link to PARAS substrate predictor