GCF_900102085.1 - 15 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_FMVM01000008.1 (Paenibacillus polysaccharolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	lassopeptide	58,968	82,944	Low	paeninodin	ribosomal:unmodified
Region 13.2	NRPS-like,NRPS	209,631	270,769

NZ_FMVM01000001.1 (Paenibacillus polysaccharolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	transAT-PKS,NRPS,T1PKS	153,789	217,036	Low	pellasoren/pellasoren B	NRPS:Type I+PKS:Type I
Region 15.2	NRPS-like,HR-T2PKS	355,409	409,004

NZ_FMVM01000006.1 (Paenibacillus polysaccharolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	lanthipeptide-class-iv	113,745	136,495
Region 17.2	lanthipeptide-class-ii	207,896	231,240

NZ_FMVM01000018.1 (Paenibacillus polysaccharolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	terpene-precursor	113,872	136,253

NZ_FMVM01000004.1 (Paenibacillus polysaccharolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	NI-siderophore	99,884	135,608	Low	schizokinen	NRPS:Type IV
Region 21.2	proteusin	327,000	341,539

NZ_FMVM01000002.1 (Paenibacillus polysaccharolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	T3PKS	16,853	58,010

NZ_FMVM01000012.1 (Paenibacillus polysaccharolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	terpene-precursor	100,700	121,605

NZ_FMVM01000013.1 (Paenibacillus polysaccharolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 28.1	terpene	38,207	59,079	Low	carotenoid	terpene

NZ_FMVM01000007.1 (Paenibacillus polysaccharolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 31.1	opine-like-metallophore	123,177	145,313	High	bacillopaline	other:other

NZ_FMVM01000021.1 (Paenibacillus polysaccharolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 32.1	NRPS	35,623	111,664	Low	octapeptin C4	NRPS:Type I

NZ_FMVM01000017.1 (Paenibacillus polysaccharolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 33.1	NRPS-like	159,586	183,447

No secondary metabolite regions were found in these records:: NZ_FMVM01000034.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000032.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000031.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000030.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000029.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000028.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000027.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000026.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000025.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000024.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000023.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000009.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000033.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000019.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000005.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000010.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000003.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000015.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000011.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000016.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000020.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000014.1 (Paenibacillus polysaccharolyticus); NZ_FMVM01000022.1 (Paenibacillus polysaccharolyticus)

Compact view

NZ_FMVM01000008.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 58,968 - 82,944 nt. (total: 23,977 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase hydrolase

BLQ13_RS12515: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

BLQ13_RS12555: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Lyases: cyclase

BLQ13_RS12490: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001356.4	0.67	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0002151.2	0.54	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.54	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002312.2	0.53	ribosomal	ubonodin	Burkholderia ubonensis
BGC0001552.3	0.53	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001634.3	0.53	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001549.3	0.52	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0000575.5	0.52	ribosomal	lariatin	Rhodococcus jostii
BGC0002298.2	0.51	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0001645.3	0.51	ribosomal	lagmysin	Streptomyces sp. NRRL S-118

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001356.4	0.67	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0002151.2	0.54	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.54	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002312.2	0.53	ribosomal	ubonodin	Burkholderia ubonensis
BGC0001552.3	0.53	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001634.3	0.53	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001549.3	0.52	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0000575.5	0.52	ribosomal	lariatin	Rhodococcus jostii
BGC0002298.2	0.51	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0001645.3	0.51	ribosomal	lagmysin	Streptomyces sp. NRRL S-118

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.42 out of 19.52

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

Additional weak hits (3):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.28 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.39 out of 35.63

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 11 - 94; Score: 95.7

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
MexT	Global virulence regulator

NZ_FMVM01000008.1 - Region 2 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 209,631 - 270,769 nt. (total: 61,139 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxidoreductase

BLQ13_RS13195: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

BLQ13_RS13210: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

Transferases: acylase glycosyltransferase

BLQ13_RS13155: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BLQ13_RS13175: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

BLQ13_RS13180: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase

BLQ13_RS13185: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

BLQ13_RS13160: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLQ13_RS13165: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLQ13_RS13170: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.86	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.76	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.75	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.68	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.23 out of 23.79

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.61 out of 29.38

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.93 out of 26.33

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.55 out of 19.26

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.00 out of 29.38

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.94 out of 32.93

Confidence: medium

Additional weak hits (9):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.63 out of 26.12

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.06 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.03 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.30 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.85 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.51 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.90 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.40 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.43 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 209630 - 270769:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid) + (mal - D-Asn - Tyr) + (Phe)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 209630 - 252216:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid) + (mal - D-Asn - Tyr) + (Phe)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 212234 - 270769:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid) + (mal - D-Asn - Tyr) + (Phe)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BLQ13_RS13155: mal

PKS_AT (5..285): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 95.2
Methoxymalonyl-CoA: 49.2
Methylmalonyl-CoA: 41.7
inactive: 39.3
Ethylmalonyl-CoA: 22.5
Propionyl-CoA: 14.1
fatty_acid: 13.9
2-Methylbutyryl-CoA: 12.7
CHC-CoA: 11.0
Isobutyryl-CoA: 9.6
Benzoyl-CoA: 9.5
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BLQ13_RS13160: fatty_acid

CAL_domain (46..466): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 151.5
NH2: 12.8
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

BLQ13_RS13165: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (2353..2746): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGEYNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

BLQ13_RS13170: Tyr - Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (275..670): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SWRFFDGFMTGTICTLAGEYNEYGPTESSIVALC
Nearest Stachelhaus code(s):: Tyr DGTITAEVAK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1313..1700): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LLFAFDASIWEMTLITAGSVNAYGPTEASVCAAI
Nearest Stachelhaus code(s):: Phe DAWTIAAVCK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CRP	Cyclic AMP receptor protein
FuR variant 1	Ferric Uptake Regulator
IolR	Regulator of the inositol catabolism
LexA variant 3	Repressor of DNA damage response
ToxT	Regulator of MSHA biosynthesis

NZ_FMVM01000001.1 - Region 1 - NRPS,T1PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 153,789 - 217,036 nt. (total: 63,248 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLQ13_RS00775: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

BLQ13_RS00790: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acylase aminotransferase

BLQ13_RS00780: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

BLQ13_RS00785: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase esterase phosphatase

BLQ13_RS00755: thioesterase

smcogs: SMCOG1004: thioesterase

BLQ13_RS00770: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

BLQ13_RS00845: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

BLQ13_RS00885: putative esterase

smcogs: SMCOG1104: putative esterase

Ligases: ligase synthase

BLQ13_RS00800: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLQ13_RS00805: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: permease transporter

BLQ13_RS00720: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

BLQ13_RS00870: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.99	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.92	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002175.3	0.90	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.90	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001164.3	0.86	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.86	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001876.2	0.80	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328
BGC0001275.3	0.80	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.80	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.80	PKS	6-methylsalicyclic acid	Aspergillus terreus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002175.3	0.64	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.64	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001876.2	0.60	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.75 out of 18.57

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.87 out of 20.97

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.60 out of 26.85

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.63 out of 27.78

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.36 out of 27.78

Confidence: strong

Additional weak hits (9):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.10 out of 29.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.25 out of 30.97

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.08 out of 20.47

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.23 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.61 out of 30.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.49 out of 29.65

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.68 out of 29.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 153788 - 217036:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - mal - Gly - Val) + (fatty_acid - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BLQ13_RS00785: mal

PKS_AT (5..290): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 61.8
Methoxymalonyl-CoA: 41.4
Methylmalonyl-CoA: 33.9
Ethylmalonyl-CoA: 28.0
inactive: 16.8
fatty_acid: 13.2
trans-1,2-CPDA: 12.3
Benzoyl-CoA: 12.3
CHC-CoA: 11.7
Propionyl-CoA: 11.2
2-Methylbutyryl-CoA: 10.7
Isobutyryl-CoA: 8.6
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BLQ13_RS00800: fatty_acid

CAL_domain (174..480): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 57.3
NH2: 34.9
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

BLQ13_RS00805: X - mal - Gly - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (461..866): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TDLTFDVSCTEGNFFVGGEDNVYGPTECTIWVSH
Nearest Stachelhaus code(s):: Ala DVTNFALIYK (68% 8Å match); Gly DILQFGVIWK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

PKS_AT (1587..1884): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 117.6
inactive: 69.2
Methoxymalonyl-CoA: 53.6
Methylmalonyl-CoA: 45.2
Propionyl-CoA: 33.8
Ethylmalonyl-CoA: 16.3
Isobutyryl-CoA: 13.2
fatty_acid: 10.5
Acetyl-CoA: 7.1
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

AMP-binding (2524..2919): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FDITFDIFGFEALSLTGGEFNMYGPTETTIWSTT
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (4507..4908): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VQSSFDGSIFDAFIMFGGELNGYGPTEATFFASY
Nearest Stachelhaus code(s):: Val DGFFVGGVFK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis

NZ_FMVM01000001.1 - Region 2 - HR-T2PKS,NRPS-like

Download region GenBank file

Download region SVG

Location: 355,409 - 409,004 nt. (total: 53,596 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLQ13_RS01595: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BLQ13_RS01605: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase

BLQ13_RS01600: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: protease

BLQ13_RS01585: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: ligase synthase

BLQ13_RS01560: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLQ13_RS01610: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLQ13_RS01620: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.54	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.54	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001249.5	0.52	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000357.5	0.52	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002174.2	0.51	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001166.5	0.51	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.51	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.51	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.50	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.50	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001249.5	0.59	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002174.2	0.59	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.59	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.15 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.19 out of 26.06

Confidence: medium

Additional weak hits (6):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 20.49 out of 29.51

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.65 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.68 out of 28.14

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 20.64 out of 29.72

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 30.12

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.24 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

BLQ13_RS01560: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (10..398): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FVMTFDIFFLEMQMIIGGEYNVYGPTEATVWATV
Nearest Stachelhaus code(s):: Gly DILQLGVVWK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes

NZ_FMVM01000006.1 - Region 1 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 113,745 - 136,495 nt. (total: 22,751 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001226.4	0.51	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000519.4	0.48	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002571.2	0.40	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0002701.2	0.40	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0000874.5	0.33	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0002556.2	0.26	other (other)	cervinomycin B3, cervinomycin C1, cervinomycin C2, cervinomycin C3, cervinomycin C4	Streptomyces sp.
BGC0000964.5	0.24	NRPS, PKS	burkholdac A, burkholdac B	Burkholderia thailandensis E264
BGC0001199.5	0.24	PKS	akaeolide	Streptomyces sp. NBRC 109706
BGC0000242.5	0.22	PKS	lysolipin I	Streptomyces tendae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001226.4	0.51	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000519.4	0.48	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002571.2	0.40	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0002701.2	0.40	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0000874.5	0.33	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0002556.2	0.26	other (other)	cervinomycin B3, cervinomycin C1, cervinomycin C2, cervinomycin C3, cervinomycin C4	Streptomyces sp.
BGC0000964.5	0.24	NRPS, PKS	burkholdac A, burkholdac B	Burkholderia thailandensis E264
BGC0001199.5	0.24	PKS	akaeolide	Streptomyces sp. NBRC 109706
BGC0000242.5	0.22	PKS	lysolipin I	Streptomyces tendae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.07 out of 23.79

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 23.52 out of 26.33

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 22.38 out of 26.33

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.71 out of 23.43

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.75 out of 23.43

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.16 out of 26.06

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.14 out of 18.16

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.38 out of 25.88

Confidence: medium

Additional weak hits (7):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.95 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.91 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.00 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.39 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.39 out of 31.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.33 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.33 out of 29.25

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
BldD	Development and antibiotic global regulator
IolR	Regulator of the inositol catabolism
MogR	Repressor of flagellar motility genes
PsrA	Oleic acid responsive regulator
ToxT	Regulator of MSHA biosynthesis

NZ_FMVM01000006.1 - Region 2 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 207,896 - 231,240 nt. (total: 23,345 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BLQ13_RS10405: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Lyases: cyclase

BLQ13_RS10360: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001210.5	0.58	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000539.5	0.57	ribosomal	nukacin ISK-1	Staphylococcus warneri
BGC0000554.4	0.56	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000626.3	0.55	ribosomal	thuricin	Bacillus thuringiensis
BGC0000528.5	0.53	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000516.4	0.53	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0000517.4	0.52	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000527.5	0.51	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0002005.2	0.51	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0001787.3	0.51	ribosomal	suicin 3908	Streptococcus suis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001210.5	0.58	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000539.5	0.57	ribosomal	nukacin ISK-1	Staphylococcus warneri
BGC0000554.4	0.56	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000626.3	0.55	ribosomal	thuricin	Bacillus thuringiensis
BGC0000528.5	0.53	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000516.4	0.53	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0000517.4	0.52	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000527.5	0.51	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0002005.2	0.51	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0001787.3	0.51	ribosomal	suicin 3908	Streptococcus suis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for BLQ13_RS10360

BLQ13_RS10365

Leader:

MKQFNLEALAAIEDISDDELMVVTGA

Core:

LAAIEDKKSGGVFCTVSHECHYNSVSPSSWLTCC

Core with dehydrations:

LAAIEDKKDhaGGVFCysDhbVDhaHECysHYNDhaVDhaPDhaDhaWLDhbCysCys

antiSMASH-DB 4.0 matches for BLQ13_RS10365

100.0%

NZ_FMVM01000006.1and 2 others:

NZ_RIAS01000010.1 Lanthipeptides: EC604_RS18225_lanthipeptideNZ_VEJI01000010.1 Lanthipeptides: FS576_RS22075_lanthipeptide

Lanthipeptides: BLQ13_RS10365_lanthipeptide

1

LAAIEDKKSGGVFCTVSHECHYNSVSPSSWLTCC

34

LAAIEDKKSGGVFCTVSHECHYNSVSPSSWLTCC

1

LAAIEDKKSGGVFCTVSHECHYNSVSPSSWLTCC

34

91.2%

NZ_CAKMMP010000011.1:

Lanthipeptides: L6H98_RS19925_lanthipeptide

1

LAAIEDKKSGGVFCTVSHECHYNSVSPSSWLTCC

34

+AAIE KSGGVFCTVSHECHYNSVSPSSWLTCC

1

VAAIEAAKSGGVFCTVSHECHYNSVSPSSWLTCC

34

79.4%

NZ_CP018620.1and 1 other:

NZ_CP062165.1 Lanthipeptides: JNUCC31_RS16755_lanthipeptide

Lanthipeptides: BS614_RS05680_lanthipeptide

1

LAAIEDKKSGGVFCTVSHECHYNSVSPSSWLTCC

34

++ I+ + SGGVFCTVSHECHYNSVSPSSWLTCC

1

VSVIDAQASGGVFCTVSHECHYNSVSPSSWLTCC

34

with 108 more sequence matches

Only the first 10 are displayed here.

61.8%

NZ_CP034248.1:

Lanthipeptides: EIM92_RS14995_lanthipeptide

7

KKSGGVFCTVSHECHYNSVSPSSWLTCC

34

SGGV CT+SHECHYNSVSP++W TCC

4

AASGGVICTISHECHYNSVSPAAWATCC

31

50.0%

NZ_CP086142.1and 3 others:

NZ_CP086142.1 Lanthipeptides: LL065_RS25460_lanthipeptideNZ_CP086142.1 Lanthipeptides: LL065_RS25455_lanthipeptideNZ_CP086142.1 Lanthipeptides: LL065_RS25450_lanthipeptide

Lanthipeptides: LL065_RS25465_lanthipeptide

9

SGGVFCTVSHECHYNSVSPSSWLTCC

34

GGV T +HEC+YNSVSP+SW CC

1

GGGVITTFTHECYYNSVSPASWGGCC

26

47.1%

NZ_CP077726.1and 12 others:

NZ_CP077726.1 Lanthipeptides: KTC92_RS18420_lanthipeptideNZ_CP077726.1 Lanthipeptides: KTC92_RS18415_lanthipeptideNZ_CP077726.1 Lanthipeptides: KTC92_RS18410_lanthipeptideNZ_CP077726.1 Lanthipeptides: KTC92_RS18405_lanthipeptideNZ_CP086248.1 Lanthipeptides: LL036_RS19070_lanthipeptideNZ_CP086248.1 Lanthipeptides: LL036_RS19065_lanthipeptideNZ_CP086248.1 Lanthipeptides: LL036_RS19060_lanthipeptideNZ_CP086248.1 Lanthipeptides: LL036_RS19055_lanthipeptideNZ_CP086248.1 Lanthipeptides: LL036_RS19050_lanthipeptideNZ_CP086248.1 Lanthipeptides: LL036_RS19045_lanthipeptideNZ_CP086248.1 Lanthipeptides: LL036_RS19040_lanthipeptideNZ_CP086248.1 Lanthipeptides: LL036_RS19035_lanthipeptide

Lanthipeptides: KTC92_RS18425_lanthipeptide

11

GVFCTVSHECHYNSVSPSSWLTCC

34

GV T +HEC+YNSVSP+SW CC

3

GVITTFTHECYYNSVSPASWGGCC

26

44.1%

NZ_CP051645.1and 2 others:

NZ_JAKVFF010000018.1 Lanthipeptides: MKR34_RS11425_lanthipeptideNZ_VDOJ01000018.1 Lanthipeptides: FSV48_RS11975_lanthipeptide

Lanthipeptides: HHJ99_RS13350_lanthipeptide

7

KKSGGVFCTVSHECHYNSVSPSSWLTCC

34

KK GV TVSH+CH NS TCC

1

KKKSGVIPTVSHDCHMNSF--QFVFTCC

26

41.2%

NZ_CP046304.1:

Lanthipeptides: FOC54_RS00030_lanthipeptide

7

KKSGGVFCTVSHECHYNSVSPSSWLTCC

34

KK GV TVSH+CH N+ TCC

1

KKKSGVIPTVSHDCHMNTF--QFMFTCC

26

41.2%

NZ_CP060646.1:

Lanthipeptides: H7789_RS06845_lanthipeptide

11

GVFCTVSHECHYNSVSPSSWLTCC

34

GVF T+SHECH N+ +S TCC

4

GVFKTISHECHLNTW--ASLATCC

25

41.2%

NZ_GL985606.1:

Lanthipeptides: HMPREF9062_RS00700_lanthipeptide

11

GVFCTVSHECHYNSVSPSSWLTCC

34

GVF T+SHEC+YNS + TCC

3

GVFHTISHECYYNSWAFI--FTCC

24

41.2%

NZ_JAEEGA010000010.1:

Lanthipeptides: I6N95_RS15660_lanthipeptide

11

GVFCTVSHECHYNSVSPSSWL-TCC

34

GV T+SHECH NS W+ TCC

3

GVIKTISHECHMNSW---QWIFTCC

24

41.2%

NZ_NWMU01000024.1and 3 others:

NZ_NWMU01000024.1 Lanthipeptides: CO197_RS09145_lanthipeptideNZ_VMMF01000004.1 Lanthipeptides: HT717_RS01575_lanthipeptideNZ_VMMF01000004.1 Lanthipeptides: HT717_RS01570_lanthipeptide

Lanthipeptides: CO197_RS09150_lanthipeptide

11

GVFCTVSHECHYNSVSPSSWLTCC

34

GVF T+SHECH NS + TCC

4

GVFKTISHECHMNSF--QFFFTCC

25

38.2%

NZ_CP031746.1:

Lanthipeptides: DCC27_RS08165_lanthipeptide

11

GVFCTVSHECHYNSVSPSSWLTCC

34

GV T++HECH N S LTCC

2

GVISTLTHECHMN--SWQGLLTCC

23

MIBiG 4.0 matches for BLQ13_RS10365

17.6%

BGC0002110.3 (QKV49893.1):

Lanthipeptide: birimositide

9

SGGVFCTVSHECHYN

23

+ G +CT++ EC N

14

NNGGWCTLTKECQPN

28

15.4%

BGC0001229.4 (SBI_06990):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

14

CTVSHECHYN

23

CT+S EC N

28

CTLSKECQPN

37

14.7%

BGC0000517.4 (BAB04173.1):

Lanthipeptide: haloduracin β or haloduracin α

11

GVFCTVSHEC

20

G +CT++ EC

14

GAYCTLTVEC

23

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 24.36 out of 29.25

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.24 out of 18.16

Confidence: strong

Additional weak hits (1):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.52 out of 23.43

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

BLQ13_RS10365 - Class II

Cleavage pHMM score: 1.70

RODEO score: 0

Monoisotopic mass: 3513.6 Da

Molecular weight: 3515.9 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3534.0 Da N = 1; 3552.0 Da N = 2; 3570.0 Da N = 3; 3588.0 Da N = 4

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
SypG	Regulator of biofilm formation and host colonization
ToxT	Regulator of MSHA biosynthesis

NZ_FMVM01000018.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 113,872 - 136,253 nt. (total: 22,382 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase reductase

BLQ13_RS23090: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BLQ13_RS23130: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Ligases: synthetase

BLQ13_RS23100: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0002260.3	0.40	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0000592.5	0.40	ribosomal	microviridin B	Microcystis aeruginosa NIES-298
BGC0002699.2	0.40	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0002260.3	0.40	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0000592.5	0.40	ribosomal	microviridin B	Microcystis aeruginosa NIES-298
BGC0002699.2	0.40	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BLQ13_RS23100: PT_FPPS_like

Domain 1 (533 - 755): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.40 out of 26.06

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.15 out of 26.06

Confidence: medium

Additional weak hits (9):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.14 out of 28.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.87 out of 36.53

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.38 out of 29.72

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.53 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.57 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.15 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.74 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.72 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
MogR	Repressor of flagellar motility genes

NZ_FMVM01000004.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 99,884 - 135,608 nt. (total: 35,725 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

BLQ13_RS07015: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: glucosidase

BLQ13_RS06980: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Lyases: decarboxylase

BLQ13_RS07040: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase

BLQ13_RS06975: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.59	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0000943.5	0.58	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002471.3	0.56	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0002682.2	0.56	other (other)	aerobactin	Vibrio mimicus
BGC0000939.5	0.55	other (other)	aerobactin	Grimontia hollisae
BGC0002073.3	0.55	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0000947.5	0.54	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001870.3	0.54	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0001408.5	0.52	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0001572.3	0.52	other (other)	desferrioxamine E	Pantoea agglomerans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.59	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0000943.5	0.58	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002471.3	0.56	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0002682.2	0.56	other (other)	aerobactin	Vibrio mimicus
BGC0000939.5	0.55	other (other)	aerobactin	Grimontia hollisae
BGC0002073.3	0.55	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0000947.5	0.54	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001870.3	0.54	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0001408.5	0.52	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0001572.3	0.52	other (other)	desferrioxamine E	Pantoea agglomerans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.54 out of 29.38

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.15 out of 20.97

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 25.31

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.54 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.49 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.80 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.81 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

Additional weak hits (12):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.62 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.33 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.15 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.61 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.43 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.65 out of 29.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.59 out of 39.62

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.95 out of 33.14

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 23.44 out of 30.12

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 19.98 out of 30.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
ZuR variant 1	Zinc-responsive repressor

NZ_FMVM01000004.1 - Region 2 - proteusin

Download region GenBank file

Download region SVG

Location: 327,000 - 341,539 nt. (total: 14,540 nt) Show pHMM detection rules used

Region on contig edge.

proteusin: (PoyD or TIGR03793)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLQ13_RS07925: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acyltransferase

BLQ13_RS07975: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000888.5	0.48	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.48	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001184.4	0.44	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000894.4	0.41	other (other)	citrinin	Monascus aurantiacus
BGC0002496.3	0.39	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001197.5	0.37	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000671.3	0.36	terpene	momilactone B	Oryza sativa Japonica Group
BGC0000384.6	0.36	NRPS	lyngbyatoxin	Lyngbya majuscula
BGC0000313.4	0.35	NRPS	beauvericin	Beauveria bassiana
BGC0001605.3	0.35	terpene	gibberellin	Sinorhizobium fredii NGR234

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000888.5	0.48	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.48	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001184.4	0.44	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000894.4	0.41	other (other)	citrinin	Monascus aurantiacus
BGC0002496.3	0.39	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001197.5	0.37	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000671.3	0.36	terpene	momilactone B	Oryza sativa Japonica Group
BGC0000384.6	0.36	NRPS	lyngbyatoxin	Lyngbya majuscula
BGC0000313.4	0.35	NRPS	beauvericin	Beauveria bassiana
BGC0001605.3	0.35	terpene	gibberellin	Sinorhizobium fredii NGR234

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.49 out of 25.88

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.11 out of 20.97

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (2):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.79 out of 30.97

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.52 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
PsrA	Oleic acid responsive regulator

NZ_FMVM01000002.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 16,853 - 58,010 nt. (total: 41,158 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BLQ13_RS02655: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

BLQ13_RS02735: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

Transferases: acetyltransferase aminotransferase methyltransferase

BLQ13_RS02665: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

BLQ13_RS02700: methyltransferase

smcogs: SMCOG1089: methyltransferase

BLQ13_RS02740: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase

BLQ13_RS02645: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

BLQ13_RS02680: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

BLQ13_RS02720: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Ligases: synthase

BLQ13_RS02725: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Translocases: transporter

BLQ13_RS02760: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001962.3	0.50	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000584.5	0.47	ribosomal	colicin V	Escherichia coli
BGC0002332.2	0.47	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001831.3	0.45	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001374.5	0.44	other (other)	thienodolin	Streptomyces albogriseolus
BGC0001964.2	0.44	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0002571.2	0.43	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001962.3	0.50	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000584.5	0.47	ribosomal	colicin V	Escherichia coli
BGC0002332.2	0.47	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001831.3	0.45	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001374.5	0.44	other (other)	thienodolin	Streptomyces albogriseolus
BGC0001964.2	0.44	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0002571.2	0.43	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.54 out of 20.97

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.06 out of 24.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.47 out of 28.19

Confidence: medium

Additional weak hits (5):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.45 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.44 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.16 out of 29.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.05 out of 27.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.14 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
LexA variant 2	Repressor of DNA damage response
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_FMVM01000012.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 100,700 - 121,605 nt. (total: 20,906 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase

BLQ13_RS17755: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

BLQ13_RS17710: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

BLQ13_RS17715: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001594.3	0.37	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0001501.5	0.36	other (other)	ambiguine P	Fischerella sp. TAU
BGC0000666.5	0.36	terpene	xiamycin A	Streptomyces sp. SCSIO 02999

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001594.3	0.37	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0001501.5	0.36	other (other)	ambiguine P	Fischerella sp. TAU
BGC0000666.5	0.36	terpene	xiamycin A	Streptomyces sp. SCSIO 02999

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

BLQ13_RS17715: PT_FPPS_like

Domain 1 (36 - 301): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.93 out of 30.25

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.15 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.42 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.84 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.79 out of 29.38

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ColR	Phenol-responsive regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_FMVM01000013.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 38,207 - 59,079 nt. (total: 20,873 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLQ13_RS18465: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

BLQ13_RS18470: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

BLQ13_RS18495: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Ligases: synthase

BLQ13_RS18490: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000645.3	0.57	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000656.5	0.47	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000640.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000642.3	0.43	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000635.3	0.42	terpene	carotenoid	Paracoccus sp. N81106
BGC0000646.5	0.42	terpene	β-carotein	uncultured bacterium
BGC0000664.5	0.42	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000638.3	0.41	terpene	carotenoid	Pantoea ananatis
BGC0000634.3	0.40	terpene	carotenoid	Brevundimonas sp. SD212
BGC0000641.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000645.3	0.57	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000656.5	0.47	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000640.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000642.3	0.43	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000635.3	0.42	terpene	carotenoid	Paracoccus sp. N81106
BGC0000646.5	0.42	terpene	β-carotein	uncultured bacterium
BGC0000664.5	0.42	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000638.3	0.41	terpene	carotenoid	Pantoea ananatis
BGC0000634.3	0.40	terpene	carotenoid	Brevundimonas sp. SD212
BGC0000641.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none

Genes with terpene domains:

BLQ13_RS18475: PT_phytoene_like

Domain 1 (7 - 274): Prenyltransferase; Phytoene synthase like

Subtype: Diapophytoene synthase

Reactions:: FPP → diapophytoene

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.76 out of 21.84

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.71 out of 26.85

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.93 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.64 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.30 out of 26.06

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (6):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.95 out of 25.88

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.62 out of 30.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.55 out of 36.53

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.25 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.53 out of 33.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.42 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis

NZ_FMVM01000007.1 - Region 1 - opine-like-metallophore

Download region GenBank file

Download region SVG

Location: 123,177 - 145,313 nt. (total: 22,137 nt) Show pHMM detection rules used

opine-like-metallophore: (CntL and CntM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BLQ13_RS11470: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Hydrolases: hydrolase

BLQ13_RS11440: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Ligases: synthase

BLQ13_RS11385: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002488.3	0.82	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002487.3	0.79	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0002489.2	0.53	other (other)	pseudopaline	Pseudomonas aeruginosa PAO1
BGC0002490.2	0.51	other (other)	yersinopine	Yersinia pestis CO92
BGC0002698.2	0.46	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000546.3	0.43	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002656.2	0.41	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0002579.2	0.41	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002488.3	0.82	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002487.3	0.79	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0002489.2	0.53	other (other)	pseudopaline	Pseudomonas aeruginosa PAO1
BGC0002490.2	0.51	other (other)	yersinopine	Yersinia pestis CO92
BGC0002698.2	0.46	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000546.3	0.43	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002656.2	0.41	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0002579.2	0.41	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.67 out of 27.78

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.75 out of 27.55

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (3):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.20 out of 39.62

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.59 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.59 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
ToxT	Regulator of MSHA biosynthesis

NZ_FMVM01000021.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 35,623 - 111,664 nt. (total: 76,042 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BLQ13_RS24530: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

BLQ13_RS24535: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

BLQ13_RS24545: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: aminotransferase

BLQ13_RS24635: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Ligases: ligase

BLQ13_RS24605: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLQ13_RS24620: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BLQ13_RS24625: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

BLQ13_RS24570: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

BLQ13_RS24580: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001153.5	0.86	NRPS	polymyxin B	Paenibacillus polymyxa
BGC0001192.5	0.86	NRPS	colistin A, colistin B	Paenibacillus alvei
BGC0000408.5	0.85	NRPS	polymyxin	Paenibacillus polymyxa
BGC0002653.2	0.84	NRPS	macolacin	Paenibacillus xylanexedens
BGC0000426.5	0.76	NRPS	sevadicin	Paenibacillus larvae
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.74	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001153.5	0.86	NRPS	polymyxin B	Paenibacillus polymyxa
BGC0001192.5	0.86	NRPS	colistin A, colistin B	Paenibacillus alvei
BGC0000408.5	0.85	NRPS	polymyxin	Paenibacillus polymyxa
BGC0002653.2	0.84	NRPS	macolacin	Paenibacillus xylanexedens
BGC0000426.5	0.76	NRPS	sevadicin	Paenibacillus larvae
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.74	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.80 out of 27.78

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.75 out of 18.57

Confidence: strong

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 21.55

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.56 out of 30.25

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.72 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.70 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.43 out of 28.19

Confidence: medium

Additional weak hits (15):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.36 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.41 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.97 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.38 out of 29.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.73 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.08 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.63 out of 26.12

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.08 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.43 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.76 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.45 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.70 out of 26.06

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.88 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 35622 - 111664:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Leu - Leu - Dab - Dab - Thr) + (Dab - Thr - D-Dab - Dab - Dab)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BLQ13_RS24605: Dab - Thr - Dab - Dab - Dab

Search NORINE for peptide: strict or relaxed

AMP-binding (486..898): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TAYAFDVFVGDRESITSSDINSYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1540..1947): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNDHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2607..3065): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINSYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4186..4604): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINAYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISAIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5249..5667): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINAYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISAIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

BLQ13_RS24620: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (269..676): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNDHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

BLQ13_RS24625: Leu - Leu - Dab - Dab

Search NORINE for peptide: strict or relaxed

AMP-binding (283..672): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LMFAFDASCWEKILVTGGSFNAYGPTEASIVTTL
Nearest Stachelhaus code(s):: Leu DAWIVGAIVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1791..2186): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: INTSFDGAIFDGLILFGGENHLYGPSESTVYTTY
Nearest Stachelhaus code(s):: Leu DGFLLGLVYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2830..3248): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINAYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISAIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3894..4312): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINAYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISAIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_FMVM01000017.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 159,586 - 183,447 nt. (total: 23,862 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

BLQ13_RS22630: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Ligases: ligase

BLQ13_RS22645: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

BLQ13_RS22585: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.60	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002276.2	0.59	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.60	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002276.2	0.59	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.30 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.06 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.73 out of 28.19

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.80 out of 20.01

Confidence: medium

Additional weak hits (3):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.14 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.62 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.41 out of 28.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 159585 - 183447:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BLQ13_RS22645: X

AMP-binding (225..634): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LVVAFDASVWDGTITVAGEVNVYGPTECTVATTT
Nearest Stachelhaus code(s):: bMe-Phe DAWTTAVAAK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor