GCF_900101685.1 - 34 region(s)

Download region SVG

Location: 1 - 6,199 nt. (total: 6,199 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

BLS56_RS30255: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 6199:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS30255: Gly - X

Search NORINE for peptide: strict or relaxed

AMP-binding (624..1004): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDIHGLEVQALVGGETNLYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1636..2013): X

nrpys: Dpr, OH-Asp, OMe-Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YRATFDLTVTATKAILGGEVNAYGPTEATVNCLD
Nearest Stachelhaus code(s):: Dpr DLTKIGAVNK (85% 8Å match); OH-Asp or OMe-Asp DLTKIGAVNK (85% 8Å match); Asp DLTKIGAVNK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

NZ_FMZZ01000027.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 36,008 nt. (total: 36,008 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: kinase transferase

BLS56_RS29800: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

BLS56_RS29835: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: dehalogenase esterase hydrolase

BLS56_RS29820: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

BLS56_RS29825: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

BLS56_RS29830: putative esterase

smcogs: SMCOG1104: putative esterase

Ligases: ligase synthase

BLS56_RS29765: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS29840: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLS56_RS29845: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.67	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.67	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.53 out of 26.85

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (6):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.41 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.52 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.06 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.42 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 36008:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS29840: pk

PKS_AT (620..913): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; Methylmalonyl-CoA: 54.2%; Ethylmalonyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 87.3
Methoxymalonyl-CoA: 79.7
Malonyl-CoA: 66.6
Ethylmalonyl-CoA: 63.0
Propionyl-CoA: 56.3
trans-1,2-CPDA: 56.2
Isobutyryl-CoA: 47.6
2-Methylbutyryl-CoA: 47.2
fatty_acid: 41.5
CHC-CoA: 29.0
3-Methylbutyryl-CoA: 27.8
Benzoyl-CoA: 25.3
Acetyl-CoA: 22.7
inactive: 22.0

BLS56_RS29845: fatty_acid

CAL_domain (49..492): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 53.4
Acetyl-CoA: 53.4
AHBA: 14.1
shikimic_acid: 10.1
NH2: 9.3

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
RutR	Regulator of the pyrimidine and purine metabolism

NZ_FMZZ01000023.1 - Region 1 - hglE-KS

Download region SVG

Location: 7,821 - 55,542 nt. (total: 47,722 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLS56_RS28935: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase glycosyltransferase

BLS56_RS28910: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

BLS56_RS28925: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BLS56_RS28930: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

BLS56_RS28915: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase

BLS56_RS28905: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000056.3	0.50	PKS	esperamicin	Actinomadura verrucosospora
BGC0002648.2	0.48	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000863.3	0.48	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0000861.5	0.48	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0002171.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000056.3	0.50	PKS	esperamicin	Actinomadura verrucosospora
BGC0002648.2	0.48	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000863.3	0.48	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0000861.5	0.48	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0002171.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.96 out of 23.43

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.40 out of 27.04

Confidence: medium

Additional weak hits (15):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.09 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.12 out of 18.57

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.34 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.10 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.25 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.46 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.73 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.32 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.30 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.33 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 7820 - 55542:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS28905: X

AMP-binding (202..592): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AVLAWGLTALQMFAASSGSYNFYGSTEVSAASIA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

BLS56_RS28925: pk

PKS_AT (138..349): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 13.0
Malonyl-CoA: 3.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BLS56_RS28930: mal

PKS_AT (1210..1500): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 70.3
Methoxymalonyl-CoA: 31.3
Methylmalonyl-CoA: 28.6
inactive: 24.4
Ethylmalonyl-CoA: 17.4
trans-1,2-CPDA: 13.0
fatty_acid: 11.1
CHC-CoA: 5.4
Propionyl-CoA: 0.2
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_FMZZ01000009.1 - Region 1 - NRP-metallophore,NRPS,ectoine

Download region SVG

Location: 1 - 59,951 nt. (total: 59,951 nt) Show pHMM detection rules used

Region on contig edge.

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BLS56_RS18725: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: aminotransferase formyltransferase

BLS56_RS18675: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

BLS56_RS18760: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: esterase

BLS56_RS18740: thioesterase

smcogs: SMCOG1004: thioesterase

Isomerases: isomerase

BLS56_RS18640: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

BLS56_RS18650: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS18715: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS18735: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	1.66	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	1.64	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	1.14	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.98	other (other)	ectoine	Methylobacter marinus
BGC0002135.2	0.88	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.82	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.80	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.78	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.77	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.77	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.82	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 33.20 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.86 out of 36.53

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 25.38 out of 27.04

Confidence: strong

Additional weak hits (12):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.34 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.59 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.56 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.13 out of 36.53

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.89 out of 33.73

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.24 out of 36.53

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.29 out of 27.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.30 out of 31.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.45 out of 26.85

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 59951:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ser - X) + (X - OH-Orn) + (Cys)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS18650: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (28..425): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NASLFALACPGGALQVGGAQQVFGMAEGLLCYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVLCK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

BLS56_RS18710: Ser - X

Search NORINE for peptide: strict or relaxed

AMP-binding (467..862): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFLCSGEHNLYGPTEASVDVTA
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1941..2323): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGHAFD-SAWELDLLVGGEFNLYGPTEATVDAYG
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (71% 8Å match); Asp DSWKLGVVDK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

BLS56_RS18715: X - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (448..825): X

nrpys: Fo-OH-Orn, Ac-OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTHAFDVAWWEQILLAGTEFNAYGPTEVSVNSTL
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWILGATNK (79% 8Å match); Ac-OH-Orn DVWALGAVNK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1470..1866): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHWFDASWQPWEVGVGGEFNLYGPTESTVDALA
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

BLS56_RS18735: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (468..842): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: AATTHDMSTFDGNSFLGGDVSVGGPTETTLWNIW
Nearest Stachelhaus code(s):: Cys DMFNFGVLWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor

NZ_FMZZ01000009.1 - Region 2 - NAPAA

Download region SVG

Location: 80,015 - 113,887 nt. (total: 33,873 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

BLS56_RS19075: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Isomerases: racemase

BLS56_RS19060: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.78	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.78	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.08 out of 18.57

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.36 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (8):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.26 out of 32.74

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.98 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.15 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.88 out of 35.63

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.27 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 80014 - 113887:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS19010: X

AMP-binding (44..415): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_FMZZ01000008.1 - Region 1 - PKS-like,T1PKS,azoxy-crosslink,butyrolactone

Download region SVG

Location: 45,115 - 113,656 nt. (total: 68,542 nt) Show pHMM detection rules used

azoxy-crosslink: (azdH and LPG_synthase_C and azdO and vlmB)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
PKS-like: (t2pks2 or ksIII)
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BLS56_RS17370: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

BLS56_RS17375: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

BLS56_RS17445: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BLS56_RS17515: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BLS56_RS17545: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BLS56_RS17580: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BLS56_RS17590: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: aminotransferase carboxylase transferase

BLS56_RS17380: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

BLS56_RS17560: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

BLS56_RS17570: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Hydrolases: esterase protease

BLS56_RS17315: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

BLS56_RS17450: thioesterase

smcogs: SMCOG1004: thioesterase

BLS56_RS17455: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Ligases: ligase synthase

BLS56_RS17405: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLS56_RS17435: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLS56_RS17440: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS17520: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

BLS56_RS17595: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.55	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.55	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000595.3	0.48	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002381.3	0.48	PKS, other (other)	tambjamine BE-18591	Streptomyces albus subsp. albus
BGC0000271.5	0.46	PKS	spore pigment	Streptomyces avermitilis
BGC0000275.4	0.46	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0002047.2	0.45	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0002672.2	0.45	PKS	saccharothrixin D, saccharothrixin E, saccharothrixin F, saccharothrixin G, saccharothrixin H, saccharothrixin I, saccharothrixin J, saccharothrixin K, saccharothrixin L, saccharothrixin M	Saccharothrix sp.
BGC0002070.3	0.45	PKS	SEK90, pentangumycin	Saccharothrix espanaensis DSM 44229
BGC0002711.2	0.44	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.56 out of 23.79

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.60 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.43 out of 20.97

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.32 out of 24.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (17):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.74 out of 20.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.71 out of 25.75

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.64 out of 18.57

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.75 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.01 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.79 out of 20.97

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.03 out of 30.11

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.80 out of 32.74

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.20 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.14 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.79 out of 27.04

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.96 out of 29.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.04 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 45114 - 113656:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 50134 - 95084:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 72636 - 113656:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS17435: mal

PKS_AT (549..839): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 172.0
inactive: 97.5
Methylmalonyl-CoA: 64.0
Methoxymalonyl-CoA: 63.2
Isobutyryl-CoA: 37.3
Propionyl-CoA: 34.6
Ethylmalonyl-CoA: 31.9
CHC-CoA: 20.2
Acetyl-CoA: 19.9
2-Methylbutyryl-CoA: 16.7
fatty_acid: 15.8
trans-1,2-CPDA: 12.3
3-Methylbutyryl-CoA: 8.5
Benzoyl-CoA: -3.7

BLS56_RS17440: X

AMP-binding (12..417): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAMLFGIAGMGMFAAYGAAAQIYAATETGTCAVS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response

NZ_FMZZ01000006.1 - Region 1 - NRPS,betalactone

Download region SVG

Location: 2,154 - 45,063 nt. (total: 42,910 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

BLS56_RS13790: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase

BLS56_RS13800: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: hydratase

BLS56_RS13875: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Isomerases: racemase

BLS56_RS13770: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase synthase

BLS56_RS13750: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

BLS56_RS13795: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS13870: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.72	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.68	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 22.27 out of 23.43

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.20 out of 23.43

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.63 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.12 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.37 out of 36.54

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.67 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.62 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.13 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.54 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.21 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 2153 - 45063:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS13795: X

AMP-binding (392..788): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TALSFDMSAFDASSLLGGDYNFAGVTEASFTTTA
Nearest Stachelhaus code(s):: Thr DVFSAGFIYK (47% 8Å match); Trp DIFALGDFRK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

BLS56_RS13870: X

AMP-binding (19..419): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NAMLHDMGMMGLAGLNGSDLPAYGLAEATVAVSF
Nearest Stachelhaus code(s):: Leu DIFALGGVAK (38% 8Å match); Cit DMEADGAVDK (35% 8Å match); ndmHex DAMVLGVVAK (32% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
BldD	Development and antibiotic global regulator
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_FMZZ01000018.1 - Region 1 - terpene

Download region SVG

Location: 20,988 - 41,938 nt. (total: 20,951 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase reductase

BLS56_RS26750: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

BLS56_RS26760: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Hydrolases: dehalogenase

BLS56_RS26725: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: cyclase

BLS56_RS26745: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001736.3	0.43	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002508.2	0.42	other (other)	8-azaguanine	Streptomyces pathocidini
BGC0000933.3	0.41	other (other)	xiamenmycin A	Streptomyces xiamenensis
BGC0001937.4	0.41	other (other)	tubercidin	Streptomyces tubercidicus
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000595.3	0.37	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001895.4	0.37	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0000665.5	0.37	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001227.3	0.35	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001302.5	0.33	other (other)	lomofungin	Streptomyces lomondensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001736.3	0.43	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002508.2	0.42	other (other)	8-azaguanine	Streptomyces pathocidini
BGC0000933.3	0.41	other (other)	xiamenmycin A	Streptomyces xiamenensis
BGC0001937.4	0.41	other (other)	tubercidin	Streptomyces tubercidicus
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000595.3	0.37	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001895.4	0.37	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0000665.5	0.37	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001227.3	0.35	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001302.5	0.33	other (other)	lomofungin	Streptomyces lomondensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

BLS56_RS26745: T1TS

Domain 1 (15 - 307): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.08 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 22.14 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.46 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.78 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.33 out of 26.06

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.96 out of 36.53

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

NZ_FMZZ01000018.1 - Region 2 - T1PKS

Download region SVG

Location: 57,873 - 111,297 nt. (total: 53,425 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLS56_RS26950: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Transferases: aminotransferase

BLS56_RS26965: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Ligases: synthase

BLS56_RS26960: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0002229.2	0.47	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0002052.3	0.45	other (ectoine)	ectoine	Streptomyces sp.
BGC0000043.5	0.44	PKS	curacin A	Moorea producens 19L
BGC0000996.5	0.44	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0000122.5	0.44	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000678.5	0.43	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000170.3	0.43	PKS	yanuthone D	Aspergillus niger ATCC 1015

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0002229.2	0.47	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0002052.3	0.45	other (ectoine)	ectoine	Streptomyces sp.
BGC0000043.5	0.44	PKS	curacin A	Moorea producens 19L
BGC0000996.5	0.44	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0000122.5	0.44	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000678.5	0.43	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000170.3	0.43	PKS	yanuthone D	Aspergillus niger ATCC 1015

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

Additional weak hits (8):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.27 out of 31.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.03 out of 32.74

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.88 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.75 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.08 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.82 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.09 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 57872 - 111297:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS26960: mal - mal - mal

PKS_AT (535..823): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.0
inactive: 81.8
Methoxymalonyl-CoA: 68.0
Methylmalonyl-CoA: 60.6
Isobutyryl-CoA: 30.7
Propionyl-CoA: 25.7
Ethylmalonyl-CoA: 22.2
Acetyl-CoA: 19.5
CHC-CoA: 15.9
fatty_acid: 15.8
Benzoyl-CoA: 14.6
trans-1,2-CPDA: 9.9
2-Methylbutyryl-CoA: 8.2
3-Methylbutyryl-CoA: 5.3

PKS_AT (1528..1817): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 185.5
inactive: 79.0
Methoxymalonyl-CoA: 59.8
Methylmalonyl-CoA: 51.0
Isobutyryl-CoA: 34.0
Propionyl-CoA: 22.0
Acetyl-CoA: 14.9
Ethylmalonyl-CoA: 12.0
fatty_acid: 9.6
3-Methylbutyryl-CoA: 6.3
CHC-CoA: 5.0
trans-1,2-CPDA: 4.7
Benzoyl-CoA: 3.6
2-Methylbutyryl-CoA: -0.0

PKS_AT (3231..3514): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.0
inactive: 82.8
Methoxymalonyl-CoA: 74.9
Methylmalonyl-CoA: 66.6
Ethylmalonyl-CoA: 31.8
Isobutyryl-CoA: 28.8
Propionyl-CoA: 28.5
trans-1,2-CPDA: 20.9
Benzoyl-CoA: 19.6
Acetyl-CoA: 19.2
CHC-CoA: 9.8
2-Methylbutyryl-CoA: 5.5
3-Methylbutyryl-CoA: 5.1
fatty_acid: 0.0

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
RpoN	Regulator of nitrogen assimilation and virulence

NZ_FMZZ01000010.1 - Region 1 - hglE-KS

Download region SVG

Location: 265 - 47,722 nt. (total: 47,458 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase aminotransferase carboxylase halogenase transferase

BLS56_RS20050: halogenase

smcogs: SMCOG1119: halogenase

BLS56_RS20070: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BLS56_RS20075: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

BLS56_RS20085: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

BLS56_RS20135: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: ligase synthase

BLS56_RS20045: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS20060: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

BLS56_RS20110: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002648.2	0.57	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000861.5	0.57	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000862.3	0.55	other (other)	eicosapentaenoic acid	Shewanella pneumatophori
BGC0000261.5	0.52	PKS	R1128	Streptomyces sp. R1128
BGC0000863.3	0.51	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002648.2	0.57	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000861.5	0.57	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000862.3	0.55	other (other)	eicosapentaenoic acid	Shewanella pneumatophori
BGC0000261.5	0.52	PKS	R1128	Streptomyces sp. R1128
BGC0000863.3	0.51	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (8):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.55 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.19 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.31 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.79 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.65 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.11 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.73 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 264 - 47722:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS20045: X

AMP-binding (40..465): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GEMV-----LERPVISGGALNCYGLTEAATAVTV
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

BLS56_RS20060: mal

PKS_AT (575..870): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 91.8
Methoxymalonyl-CoA: 47.3
Methylmalonyl-CoA: 42.8
inactive: 40.1
CHC-CoA: 34.5
fatty_acid: 28.3
Propionyl-CoA: 23.1
Isobutyryl-CoA: 19.8
trans-1,2-CPDA: 14.0
Ethylmalonyl-CoA: 13.6
2-Methylbutyryl-CoA: 10.4
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description

NZ_FMZZ01000010.1 - Region 2 - NRPS,NRPS-like,RiPP-like,lassopeptide

Download region SVG

Location: 98,283 - 185,113 nt. (total: 86,831 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BLS56_RS20495: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Hydrolases: deaminase dehalogenase esterase hydrolase

BLS56_RS20385: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

BLS56_RS20440: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

BLS56_RS20475: thioesterase

smcogs: SMCOG1004: thioesterase

BLS56_RS20500: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

BLS56_RS20555: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: hydratase lyase

BLS56_RS20480: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

BLS56_RS20490: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

BLS56_RS20560: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: ligase

BLS56_RS20525: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS20535: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS20545: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	1.07	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	1.06	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	1.06	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	1.06	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	1.05	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	1.04	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	1.04	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	1.02	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	1.01	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.97	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.77	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.76	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.74	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.73	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.63 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.64 out of 26.33

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (17):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.06 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.02 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.48 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.62 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.13 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.03 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.79 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.30 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.32 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.66 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.37 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.57 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.28 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 35.63

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 2, location 98282 - 185113:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - Pro) + (X - X - Gly - D-Dab) + (X - D-Hpr) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 98282 - 141399:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - D-Hpr) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 114575 - 185113:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - Pro) + (X - X - Gly - D-Dab) + (X - D-Hpr) + (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS20475: X

AMP-binding (201..602): X

nrpys: dnmeProp, Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQAQLSVTGEVNAYGATEVGDDTMH
Nearest Stachelhaus code(s):: dnmeProp or Dab DIWQSTADDK (91% 8Å match); Asp DIWQSTADDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

BLS56_RS20525: fatty_acid

CAL_domain (42..469): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 26.7
NH2: 20.9
AHBA: 5.2
shikimic_acid: 0.0
Acetyl-CoA: -1.2

BLS56_RS20535: X - Hpr

Search NORINE for peptide: strict or relaxed

AMP-binding (487..876): X

nrpys: Asp, Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YHLTFDLGLTAG-GMLGGEVNEYGPTEATIACVE
Nearest Stachelhaus code(s):: Asn DLTKMGEVGK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2107..2506): Hpr

nrpys: Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pip (Hpr)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHLFDFVVQEQFAFQGGEHNVYGPAETHAATTL
Nearest Stachelhaus code(s):: Hpr DFQFFGVAVK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

BLS56_RS20540: X - X - Gly - Dab

Search NORINE for peptide: strict or relaxed

AMP-binding (454..849): X

nrpys: bMe-Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTATKGMLGGEFNVYGATEATVNSTQ
Nearest Stachelhaus code(s):: bMe-Asp DLTKMGVVNK (94% 8Å match); bMe-Asp DLTKMGVVNK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1514..1891): X

nrpys: Dpr, OH-Asp, OMe-Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YRATFDLTVTTTKVILGGEVNAYGPTEATVNCLD
Nearest Stachelhaus code(s):: Dpr DLTKIGAVNK (85% 8Å match); OH-Asp or OMe-Asp DLTKIGAVNK (85% 8Å match); Asp DLTKIGAVNK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2539..2921): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FALTFDIHGLEVQALVGGETNLYGPTETTIWSTS
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3568..3954): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNQSFDASTFEAFVWAGGDANEYGPTETTVFSSV
Nearest Stachelhaus code(s):: Dab DAFFWGEVFK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

BLS56_RS20545: Val - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (456..867): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDSAFDASTYEVWLWTGGDVNGYGPTETTTFATT
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1513..1908): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHTFDVSVQESYAAQAGEHNHYGPAETHVATAW
Nearest Stachelhaus code(s):: Pro DVQYAAHVVK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 85; Score: 76.8

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_FMZZ01000007.1 - Region 1 - indole

Download region SVG

Location: 7,468 - 28,496 nt. (total: 21,029 nt) Show pHMM detection rules used

Region on contig edge.

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLS56_RS15615: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase

BLS56_RS15600: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001294.5	0.54	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001197.5	0.43	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002128.3	0.42	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0002643.2	0.42	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0002404.2	0.41	other (other)	falcarindiol	Solanum lycopersicum
BGC0000888.5	0.41	other (other)	bacilysin	Bacillus sp. CS93
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000231.5	0.38	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001184.4	0.38	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002161.2	0.37	PKS	scytalone, T3HN	Pestalotiopsis fici W106-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001294.5	0.54	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001197.5	0.43	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002128.3	0.42	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0002643.2	0.42	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0002404.2	0.41	other (other)	falcarindiol	Solanum lycopersicum
BGC0000888.5	0.41	other (other)	bacilysin	Bacillus sp. CS93
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000231.5	0.38	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001184.4	0.38	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002161.2	0.37	PKS	scytalone, T3HN	Pestalotiopsis fici W106-1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (7):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.40 out of 20.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.11 out of 26.85

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.86 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.16 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.57 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.74 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.13 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_FMZZ01000007.1 - Region 2 - T1PKS,lanthipeptide-class-iii,terpene

BGC0000553.3 (SSGG_RS09925):

Download region SVG

Location: 53,355 - 144,530 nt. (total: 91,176 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BLS56_RS15765: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BLS56_RS15825: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BLS56_RS15930: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

BLS56_RS15940: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BLS56_RS15950: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

BLS56_RS15975: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

BLS56_RS15980: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

BLS56_RS16000: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: methyltransferase

BLS56_RS15805: methyltransferase

smcogs: SMCOG1089: methyltransferase

BLS56_RS16045: methyltransferase

smcogs: SMCOG1089: methyltransferase

BLS56_RS31430: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: amidase

BLS56_RS15850: amidase

smcogs: SMCOG1105: amidase

Lyases: cyclase dehydratase

BLS56_RS15815: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

BLS56_RS15995: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

BLS56_RS15965: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLS56_RS15970: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLS56_RS16070: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLS56_RS16120: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.55	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000197.5	0.34	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000041.3	0.33	PKS	oronofacic acid	Pseudomonas syringae
BGC0002514.3	0.32	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0002000.4	0.32	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000218.5	0.31	PKS	doxorubicin	Streptomyces peucetius
BGC0002012.4	0.30	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0001273.3	0.30	PKS	asperlactone	Aspergillus ochraceus
BGC0001065.5	0.30	PKS	herboxidiene	Streptomyces chromofuscus
BGC0002191.2	0.30	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000041.3	0.66	PKS	oronofacic acid	Pseudomonas syringae
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

Lanthipeptide predictions

Lanthipeptide(s) for BLS56_RS16080

BLS56_RS16085

Leader:

MNSVLELQELAVDDHEGAPGAP

Core:

DFSNGSLLNCDSTLSLLICE

Core with dehydrations:

DFDhaNGDhaLLNCysDDhaDhbLDhaLLICysE

antiSMASH-DB 4.0 matches for BLS56_RS16085

100.0%

NZ_FMZZ01000007.1:

Lanthipeptides: BLS56_RS16085_lanthipeptide

1

DFSNGSLLNCDSTLSLLICE

20

DFSNGSLLNCDSTLSLLICE

1

DFSNGSLLNCDSTLSLLICE

20

55.0%

NZ_BMUT01000002.1and 3 others:

NZ_CP040752.1 Lanthipeptides: FGW37_RS09755_lanthipeptideNZ_LNBE01000004.1 Lanthipeptides: AS857_RS19855_lanthipeptideNZ_WPBY01000022.1 Lanthipeptides: GO001_RS24105_lanthipeptide

Lanthipeptides: IE241_RS08090_lanthipeptide

3

SNGSLLNCDSTLSLLIC

19

S SLL+C ST S+LIC

3

STVSLLSCVSTASVLIC

19

50.0%

NZ_CP072827.1:

Lanthipeptides: J7W19_RS28510_lanthipeptide

3

SNGSLLNCDSTLSLLIC

19

S SLL+C ST S+L+C

1

STASLLSCVSTASVLLC

17

with 41 more sequence matches

Only the first 10 are displayed here.

47.8%

NZ_CP102509.1:

Lanthipeptides: JIW86_RS37035_lanthipeptide

3

SNGSLLNC-DSTLSLLICE

20

S SLL C DS+LSL C

5

SRASLLLCGDSSLSLTTCH

23

47.6%

NZ_CP034587.1:

Lanthipeptides: EKH77_RS09240_lanthipeptide

3

SNGSLLNCDSTLSLLIC

19

S SLL+C ST S+L+C

4

STVSLLSCISTASVLLC

20

47.6%

NZ_JAMTCR010000003.1:

Lanthipeptides: LV79_RS18340_lanthipeptide

1

DFSNGSLLNC-DSTLSLLICE

20

+SN S + C +S LSLL+C

1

SYSNLSAVTCSESALSLLLCH

21

45.5%

NZ_CP097289.1:

Lanthipeptides: M4V62_RS29260_lanthipeptide

3

SNGSLLNCDSTLSLLIC

19

S SLL C S +SL+IC

5

STASLLLCWSEVSLVIC

21

45.0%

NZ_BBYG01000010.1:

Lanthipeptides: AOQ37_RS09965_lanthipeptide

3

SNGSLLNCDSTLSLLIC

19

S SLL+C S S+L+C

1

STVSLLSCVSAASVLLC

17

45.0%

NZ_BMSE01000001.1and 20 others:

NZ_BMTM01000009.1 Lanthipeptides: IE213_RS27820_lanthipeptideNZ_BMUK01000002.1 Lanthipeptides: IE276_RS03565_lanthipeptideNZ_BMUO01000001.1 Lanthipeptides: IE232_RS00145_lanthipeptideNZ_CP015098.1 Lanthipeptides: A4E84_RS37870_lanthipeptideNZ_CP041604.2 Lanthipeptides: FNV64_RS48055_lanthipeptideNZ_CP041610.2 Lanthipeptides: FNV62_RS46395_lanthipeptideNZ_CP041611.1 Lanthipeptides: FNV63_RS47280_lanthipeptideNZ_CP041613.2 Lanthipeptides: FNV68_RS48480_lanthipeptideNZ_CP041650.2 Lanthipeptides: FNV59_RS47040_lanthipeptideNZ_CP049838.1 Lanthipeptides: G9272_RS40085_lanthipeptideNZ_JACHCX010000007.1 Lanthipeptides: HDC93_RS16065_lanthipeptideNZ_JACHGV010000013.1 Lanthipeptides: HNR57_RS32395_lanthipeptideNZ_JACHXE010000001.1 Lanthipeptides: FHS41_RS01865_lanthipeptideNZ_KB911710.1 Lanthipeptides: H294_RS0120310_lanthipeptideNZ_KQ948484.1 Lanthipeptides: AQJ27_RS46770_lanthipeptideNZ_KQ948484.1 Lanthipeptides: AQJ27_RS46770_lanthipeptideNZ_KZ671983.1 Lanthipeptides: BV882_RS30460_lanthipeptideNZ_LMEQ01000023.1 Lanthipeptides: ASD48_RS25330_lanthipeptideNZ_LMIZ01000012.1 Lanthipeptides: ASE41_RS11285_lanthipeptideNZ_QFRX01000001.1 Lanthipeptides: DI272_RS05815_lanthipeptide

Lanthipeptides: IE153_RS00140_lanthipeptide

3

SNGSLLNCDSTLSLLIC

19

S SLL+C S S+L+C

1

STVSLLSCISAASVLLC

17

45.0%

NZ_BMSI01000009.1:

Lanthipeptides: IE189_RS23215_lanthipeptide

3

SNGSLLNCDSTLSLLIC

19

S SLL+C S S+L+C

1

STVSLLSCVSATSVLLC

17

45.0%

NZ_CP021080.1:

Lanthipeptides: LK06_RS01010_lanthipeptide

4

NGSLLNCDSTLSLLIC

19

SLL+C ST S+L+C

1

TASLLSCVSTTSVLLC

16

45.0%

NZ_CP021978.1:

Lanthipeptides: CEB94_RS37585_lanthipeptide

3

SNGSLLNCDSTLSLLIC

19

S SLL+C S S+L+C

1

STLSLLSCISAASVLLC

17

45.0%

NZ_CP084585.1:

Lanthipeptides: allorf_0614982_0615095_lanthipeptide

2

FSNGSLLNCDSTLSLLIC

19

S+ SL+ C STLS+ C

2

ISSWSLIGCASTLSVGAC

19

MIBiG 4.0 matches for BLS56_RS16085

27.3%

Lanthipeptide: SRO15-2212

12

STLSLLICE

20

S +SLL+CE

3

SQVSLLVCE

11

8.8%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

4

NGSLLNCD

11

G+L+ C+

13

TGALMGCN

20

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

BLS56_RS15815: T1TS + T1TS

Domain 1 (2 - 329): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (333 - 701): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.35 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (44):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.95 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.87 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.53 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.73 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.90 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.10 out of 25.88

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.82 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.00 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.44 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.22 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.71 out of 27.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.34 out of 39.62

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.30 out of 20.97

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.95 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 20.53 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.65 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.88 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.29 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.30 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.18 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.97 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.04 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.38 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.48 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.23 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.83 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.36 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.16 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.21 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.84 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.27 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.39 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.74 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.85 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.12 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.07 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.37 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.17 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.26 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Core peptide predictions

BLS56_RS16085 - Class III

Cleavage pHMM score: 3.30

RODEO score: 0

Monoisotopic mass: 2053.0 Da

Molecular weight: 2054.3 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2072.3 Da N = 1; 2090.3 Da N = 2; 2108.3 Da N = 3

Predicted core structure(s)

For candidate cluster 2, location 53354 - 144530:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Me-ccmal)
Non-colinear ordering:: BLS56_RS15965 + BLS56_RS15970

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 74667 - 125258:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Me-ccmal)
Non-colinear ordering:: BLS56_RS15965 + BLS56_RS15970

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS15965: mal

PKS_AT (555..861): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 181.8
inactive: 83.9
Methoxymalonyl-CoA: 65.5
Methylmalonyl-CoA: 54.1
Isobutyryl-CoA: 34.0
Propionyl-CoA: 27.8
Benzoyl-CoA: 21.6
fatty_acid: 18.7
Ethylmalonyl-CoA: 18.7
CHC-CoA: 7.3
2-Methylbutyryl-CoA: 5.8
3-Methylbutyryl-CoA: 1.7
trans-1,2-CPDA: 0.0
Acetyl-CoA: -2.0

BLS56_RS15970: mmal

PKS_AT (561..854): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Ethylmalonyl-CoA: 75.0%; Methoxymalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 186.1
Ethylmalonyl-CoA: 175.0
Methoxymalonyl-CoA: 161.7
2-Methylbutyryl-CoA: 129.7
Propionyl-CoA: 108.1
trans-1,2-CPDA: 101.2
CHC-CoA: 87.3
Isobutyryl-CoA: 82.4
Malonyl-CoA: 79.2
Benzoyl-CoA: 50.3
Acetyl-CoA: 46.4
3-Methylbutyryl-CoA: 42.5
fatty_acid: 21.9
inactive: 19.3

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_FMZZ01000007.1 - Region 3 - T1PKS,T2PKS

Download region SVG

Location: 223,842 - 343,672 nt. (total: 119,831 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BLS56_RS16635: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BLS56_RS16680: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

BLS56_RS16710: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

BLS56_RS16930: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

BLS56_RS16940: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

BLS56_RS16950: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BLS56_RS16965: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase carboxylase glycosyltransferase transferase

BLS56_RS16670: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

BLS56_RS16675: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

BLS56_RS16815: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

BLS56_RS16915: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: hydrolase protease

BLS56_RS16595: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

BLS56_RS16655: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

BLS56_RS16705: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase

BLS56_RS16700: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: ligase synthase

BLS56_RS16685: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLS56_RS16690: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BLS56_RS16760: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

BLS56_RS16920: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLS56_RS16925: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLS56_RS16960: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS16990: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

BLS56_RS31890: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

BLS56_RS32765: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.56	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001723.5	0.45	PKS	oviedomycin	Streptomyces antibioticus
BGC0001649.3	0.43	PKS	lavendiol	Streptomyces lavendulae
BGC0001276.3	0.43	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000235.5	0.39	PKS	kiamycin	Streptomyces sp. W007
BGC0000234.5	0.36	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002514.3	0.35	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0002047.2	0.35	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0001917.4	0.34	PKS	5aTHQ-9i, 5aTHQ-9n, 5aTHQ-10a, STAMs-9i, STAMs-9n	Streptomyces nigrescens
BGC0001904.2	0.33	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000231.5	0.72	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001649.3	0.64	PKS	lavendiol	Streptomyces lavendulae
BGC0001723.5	0.64	PKS	oviedomycin	Streptomyces antibioticus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.73 out of 29.72

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.69 out of 28.19

Confidence: medium

Additional weak hits (34):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.70 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.10 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.69 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.45 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.34 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.50 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.05 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.14 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.36 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.94 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.90 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.60 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.43 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.24 out of 26.85

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.66 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.91 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.79 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.64 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.10 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.66 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.33 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.40 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.72 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.40 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.38 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.78 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.80 out of 24.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.82 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.06 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.67 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.93 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Type II PKS

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 223841 - 343672:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal - ccmal) + (ohmal) + (ohmal)
Non-colinear ordering:: BLS56_RS31890 + BLS56_RS16920 + BLS56_RS16925

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 223841 - 296327:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 274752 - 343672:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal - ccmal) + (ohmal) + (ohmal)
Non-colinear ordering:: BLS56_RS31890 + BLS56_RS16920 + BLS56_RS16925

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS31890: mal - mal - mal

PKS_AT (1109..1388): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 171.7
inactive: 67.6
Methoxymalonyl-CoA: 53.6
Methylmalonyl-CoA: 43.5
Propionyl-CoA: 27.7
Acetyl-CoA: 24.1
Isobutyryl-CoA: 20.9
Benzoyl-CoA: 16.6
Ethylmalonyl-CoA: 11.4
2-Methylbutyryl-CoA: 10.8
CHC-CoA: 10.2
fatty_acid: 7.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2745..3042): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 203.0
inactive: 105.5
Methylmalonyl-CoA: 53.7
Methoxymalonyl-CoA: 49.9
Propionyl-CoA: 29.6
Isobutyryl-CoA: 26.8
2-Methylbutyryl-CoA: 26.2
CHC-CoA: 15.1
Ethylmalonyl-CoA: 14.3
fatty_acid: 11.9
Benzoyl-CoA: 10.7
Acetyl-CoA: 8.6
3-Methylbutyryl-CoA: 2.4
trans-1,2-CPDA: 0.0

PKS_AT (4367..4655): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.5
inactive: 89.7
Methoxymalonyl-CoA: 71.2
Methylmalonyl-CoA: 65.6
Propionyl-CoA: 35.6
2-Methylbutyryl-CoA: 29.4
Isobutyryl-CoA: 24.8
Acetyl-CoA: 23.5
Ethylmalonyl-CoA: 23.1
CHC-CoA: 14.1
Benzoyl-CoA: 13.8
trans-1,2-CPDA: 13.0
fatty_acid: 10.1
3-Methylbutyryl-CoA: 6.7

BLS56_RS16920: mal

PKS_AT (563..853): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 150.0
inactive: 66.6
Methoxymalonyl-CoA: 66.2
Methylmalonyl-CoA: 60.8
Isobutyryl-CoA: 27.2
Propionyl-CoA: 25.5
Ethylmalonyl-CoA: 22.3
Benzoyl-CoA: 21.5
Acetyl-CoA: 12.6
3-Methylbutyryl-CoA: 11.7
fatty_acid: 10.5
trans-1,2-CPDA: 8.3
CHC-CoA: 7.1
2-Methylbutyryl-CoA: 3.0

BLS56_RS16925: mal

PKS_AT (560..838): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 180.9
inactive: 95.0
Methoxymalonyl-CoA: 72.7
Methylmalonyl-CoA: 58.7
Propionyl-CoA: 47.1
Isobutyryl-CoA: 29.6
Acetyl-CoA: 21.9
2-Methylbutyryl-CoA: 19.3
Ethylmalonyl-CoA: 17.5
Benzoyl-CoA: 17.2
trans-1,2-CPDA: 13.2
CHC-CoA: 12.6
3-Methylbutyryl-CoA: 8.3
fatty_acid: 7.9

BLS56_RS16960: X

AMP-binding (9..427): X

nrpys: Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDNPHATGLYTGCLMSAGV-------EDLVAASE
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Type II PKS gene cluster prediction details

Cluster section:: 223841 to 296327
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 7 (Score: 718.8; E-value: 3.8e-219)
Product class(es):: benzoisochromanequinone
Product molecular weight(s):: acetyl-CoA_7: 307 Da

BLS56_RS16635: KR C9 (Score: 441.2; E-value: 2.7e-135)
BLS56_RS16685: KS (Score: 773.5; E-value: 1.1e-235)
BLS56_RS16690: CLF 7 (Score: 718.8; E-value: 3.8e-219)
BLS56_RS16695: ACP (Score: 113.8; E-value: 6.7e-36)
BLS56_RS16700: CYC C7-C12 (Score: 415.6; E-value: 2.4e-127)
BLS56_RS16705: CYC C5-C14 (Score: 446.2; E-value: 1.1e-136)

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C
ZuR variant 1	Zinc-responsive repressor

NZ_FMZZ01000004.1 - Region 1 - lanthipeptide-class-i

Download region SVG

Location: 49,930 - 74,212 nt. (total: 24,283 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

BLS56_RS10210: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

BLS56_RS10215: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.52	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.52	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0002316.2	0.47	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000508.3	0.43	ribosomal	epidermin	Staphylococcus epidermidis
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0000506.4	0.42	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000529.5	0.41	ribosomal	microbisporicin A2	Microbispora corallina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.52	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.52	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0002316.2	0.47	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000508.3	0.43	ribosomal	epidermin	Staphylococcus epidermidis
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0000506.4	0.42	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000529.5	0.41	ribosomal	microbisporicin A2	Microbispora corallina

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.87 out of 28.19

Confidence: medium

Additional weak hits (6):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.46 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.37 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.68 out of 23.43

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.27 out of 39.62

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.36 out of 32.93

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 156 - 238; Score: 44.3

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CatR	H2O2-responsive repressor
ZuR variant 1	Zinc-responsive repressor

NZ_FMZZ01000004.1 - Region 2 - oligosaccharide

Download region SVG

Location: 84,485 - 163,257 nt. (total: 78,773 nt) Show pHMM detection rules used

oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BLS56_RS10390: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BLS56_RS10450: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

BLS56_RS10710: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BLS56_RS32210: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acyltransferase aminotransferase glycosyltransferase

BLS56_RS10395: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

BLS56_RS10485: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

BLS56_RS10595: acyltransferase

smcogs: SMCOG1141: acyltransferase

Hydrolases: esterase

BLS56_RS10370: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

smcogs: SMCOG1283: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

Lyases: dehydratase

BLS56_RS10420: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

BLS56_RS10405: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

BLS56_RS10410: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002733.3	0.50	other (other)	sinapigladioside	Burkholderia gladioli
BGC0000772.5	0.47	saccharide	lipopolysaccharide	Brucella melitensis
BGC0000770.4	0.47	saccharide	lipo-oligosaccharide	Campylobacter jejuni
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002316.2	0.47	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000874.5	0.46	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000019.5	0.46	PKS	angolamycin	Streptomyces eurythermus
BGC0000898.5	0.45	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000762.3	0.45	saccharide	exopolysaccharide	Rhizobium leguminosarum bv. viciae
BGC0000783.3	0.45	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002733.3	0.50	other (other)	sinapigladioside	Burkholderia gladioli
BGC0000772.5	0.47	saccharide	lipopolysaccharide	Brucella melitensis
BGC0000770.4	0.47	saccharide	lipo-oligosaccharide	Campylobacter jejuni
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002316.2	0.47	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000874.5	0.46	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000019.5	0.46	PKS	angolamycin	Streptomyces eurythermus
BGC0000898.5	0.45	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000762.3	0.45	saccharide	exopolysaccharide	Rhizobium leguminosarum bv. viciae
BGC0000783.3	0.45	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.15 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.03 out of 26.85

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.42 out of 19.52

Confidence: strong

Additional weak hits (13):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.39 out of 32.74

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.16 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.22 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.57 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.36 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.07 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.25 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.47 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.01 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.39 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.17 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.37 out of 32.74

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.78 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_FMZZ01000004.1 - Region 3 - NRPS-like,T1PKS

Download region SVG

Location: 271,912 - 325,812 nt. (total: 53,901 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLS56_RS11470: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Hydrolases: hydrolase

BLS56_RS11405: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: ligase synthase

BLS56_RS11270: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

BLS56_RS11335: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS11350: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS11375: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLS56_RS11380: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLS56_RS11385: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS11395: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

BLS56_RS11275: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.80	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000041.3	0.62	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.61	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.72	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 24.84 out of 29.72

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.95 out of 23.79

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 26.65 out of 30.22

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.13 out of 24.78

Confidence: medium

Additional weak hits (16):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.02 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.72 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 27.04

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.83 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.82 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.44 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.29 out of 23.43

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.67 out of 29.65

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.78 out of 29.25

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.52 out of 20.01

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.17 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.70 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.82 out of 30.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.42 out of 29.65

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.59 out of 18.57

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 271911 - 325812:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (redmal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 271911 - 318304:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (redmal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 282281 - 325812:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (redmal) + (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS11335: X

AMP-binding (7..395): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VGLAWDTCLEEPDLIIGGEVNTYGCTETTLITHA
Nearest Stachelhaus code(s):: Lys DTEDIGSVIK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

BLS56_RS11350: X

AMP-binding (42..442): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GPRMHAGGLSYTFQELATG--------NTGDSAH
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

BLS56_RS11375: mal

PKS_AT (547..841): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 184.4
inactive: 124.5
Methoxymalonyl-CoA: 65.2
Methylmalonyl-CoA: 62.9
Propionyl-CoA: 55.6
Isobutyryl-CoA: 39.3
Ethylmalonyl-CoA: 37.6
Benzoyl-CoA: 34.5
2-Methylbutyryl-CoA: 32.3
CHC-CoA: 20.8
trans-1,2-CPDA: 20.1
fatty_acid: 10.9
Acetyl-CoA: 10.9
3-Methylbutyryl-CoA: 0.0

BLS56_RS11385: X

AMP-binding (15..420): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LEHI-GFHIAGWLANYGGSVQMYGLTESGNAAIC
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

BLS56_RS11395: X

AMP-binding (94..522): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGALHIAGRVVEILMCGSARDGYGSTEAGVLMLD
Nearest Stachelhaus code(s):: Ile or Val DALWMGGVFK (35% 8Å match); Phe DAPIMGGTCK (32% 8Å match); His DAVLVGEVLK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_FMZZ01000002.1 - Region 1 - NI-siderophore

Download region SVG

Location: 81,649 - 111,397 nt. (total: 29,749 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BLS56_RS05670: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BLS56_RS05685: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BLS56_RS05720: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

BLS56_RS05730: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BLS56_RS05750: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

BLS56_RS05765: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: aminotransferase carboxylase transferase

BLS56_RS05675: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

BLS56_RS05680: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

BLS56_RS05755: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: decarboxylase

BLS56_RS05725: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.67	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0001478.5	0.64	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000940.5	0.58	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.58	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002305.2	0.58	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000244.4	0.58	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0002073.3	0.53	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0000941.3	0.53	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002284.3	0.52	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002620.2	0.52	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.67	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0001478.5	0.64	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000940.5	0.58	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.58	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002305.2	0.58	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000244.4	0.58	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0002073.3	0.53	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0000941.3	0.53	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002284.3	0.52	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002620.2	0.52	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (3):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.23 out of 20.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.38 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_FMZZ01000002.1 - Region 2 - RiPP-like

Download region SVG

Location: 139,169 - 149,972 nt. (total: 10,804 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	RiPP-like	Similarity score	Type	Compound(s)	Organism
BGC0001760.5		0.22	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970
BGC0002026.3		0.22	NRPS, PKS	thaxteramide A1, thaxteramide A2, thaxteramide B1, thaxteramide B2	Jahnella sp. MSr9139

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0001760.5		0.22	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970
BGC0002026.3		0.22	NRPS, PKS	thaxteramide A1, thaxteramide A2, thaxteramide B1, thaxteramide B2	Jahnella sp. MSr9139

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.60 out of 23.79

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 24.81 out of 29.65

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (7):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.23 out of 20.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.01 out of 39.62

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.27 out of 30.12

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.51 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.53 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.93 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
LexA variant 1	Repressor of DNA damage response
OsdR	Development and stress management regulator

NZ_FMZZ01000002.1 - Region 3 - terpene

Download region SVG

Location: 303,267 - 328,798 nt. (total: 25,532 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLS56_RS06750: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Ligases: synthetase

BLS56_RS06745: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.56	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.53	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.53	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.53	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.51	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000644.3	0.49	terpene	carotenoid	Dietzia sp. CQ4
BGC0000648.3	0.48	terpene	carotenoid	Myxococcus xanthus
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000640.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.56	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.53	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.53	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.53	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.51	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000644.3	0.49	terpene	carotenoid	Dietzia sp. CQ4
BGC0000648.3	0.48	terpene	carotenoid	Myxococcus xanthus
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000640.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

BLS56_RS06745: PT_FPPS_like

Domain 1 (44 - 349): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

BLS56_RS06760: PT_phytoene_like

Domain 1 (20 - 300): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.68 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.49 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.19 out of 24.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_FMZZ01000002.1 - Region 4 - terpene-precursor

Download region SVG

Location: 492,445 - 513,488 nt. (total: 21,044 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLS56_RS07660: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BLS56_RS07705: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: aminotransferase methyltransferase

BLS56_RS07700: methyltransferase

smcogs: SMCOG1089: methyltransferase

BLS56_RS07715: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

BLS56_RS07720: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Ligases: ligase synthetase

BLS56_RS07675: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

BLS56_RS07695: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0001817.5	0.46	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000674.5	0.45	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001137.5	0.44	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000278.3	0.43	PKS	urdamycin	Streptomyces fradiae
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0001817.5	0.46	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000674.5	0.45	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001137.5	0.44	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000278.3	0.43	PKS	urdamycin	Streptomyces fradiae
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BLS56_RS07675: PT_FPPS_like

Domain 1 (57 - 346): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.85 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.65 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.90 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.08 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.15 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.32 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_FMZZ01000002.1 - Region 5 - lanthipeptide-class-i

BGC0000535.4 (ADJ56352.1):

Download region SVG

Location: 518,130 - 540,718 nt. (total: 22,589 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BLS56_RS07745: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

BLS56_RS07755: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

BLS56_RS07765: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

Lyases: cyclase dehydratase

BLS56_RS07800: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

BLS56_RS07805: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002635.2	0.82	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000544.4	0.68	ribosomal	planosporicin	Planomonospora alba
BGC0002640.2	0.57	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001289.5	0.55	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.54	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.54	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001579.4	0.53	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000529.5	0.53	ribosomal	microbisporicin A2	Microbispora corallina
BGC0001660.3	0.52	ribosomal	mathermycin	Marinactinospora thermotolerans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002635.2	0.82	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000544.4	0.68	ribosomal	planosporicin	Planomonospora alba
BGC0002640.2	0.57	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001289.5	0.55	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.54	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.54	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001579.4	0.53	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000529.5	0.53	ribosomal	microbisporicin A2	Microbispora corallina
BGC0001660.3	0.52	ribosomal	mathermycin	Marinactinospora thermotolerans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for BLS56_RS07805

BLS56_RS30480

Leader:

MTAAIQIQPTPVVQELDLFDLDLEVGVDTMSVDPA

Core:

VTSVSLCTPGCTSPGGGSNCSFCC

Core with dehydrations:

VDhbDhaVDhaLCysDhbPGCysDhbDhaPGGGDhaNCysDhaFCysCys

antiSMASH-DB 4.0 matches for BLS56_RS30480

100.0%

NZ_FMZZ01000002.1:

Lanthipeptides: BLS56_RS30480_lanthipeptide

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

VTSVSLCTPGCTSPGGGSNCSFCC

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

95.8%

NZ_KI866523.1:

Lanthipeptides: MPTA5024_RS39835_lanthipeptide

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

VTS SLCTPGCTSPGGGSNCSFCC

1

VTSWSLCTPGCTSPGGGSNCSFCC

24

87.5%

NZ_AP023356.1:

Lanthipeptides: Aiant_RS23765_lanthipeptide

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

+TSVSLCTPGCTS GGGS CSFCC

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

with 95 more sequence matches

Only the first 10 are displayed here.

87.5%

NZ_AXWW01000016.1and 1 other:

NZ_JAMTCO010000009.1 Lanthipeptides: LV75_RS20160_lanthipeptide

Lanthipeptides: H504_RS39505_lanthipeptide

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

+TS+SLCTPGCTS GGGSNCSFCC

1

ITSISLCTPGCTSAGGGSNCSFCC

24

87.5%

NZ_JADDUE010000020.1:

Lanthipeptides: INP57_RS28495_lanthipeptide

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

VTSVS CTPGCTS GGGSNCS CC

1

VTSVSYCTPGCTSEGGGSNCSHCC

24

83.3%

NZ_JAMTCQ010000009.1:

Lanthipeptides: LY41_RS11610_lanthipeptide

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

VTSVS CTPGCTS GGGS CS CC

1

VTSVSYCTPGCTSEGGGSGCSHCC

24

79.2%

NZ_CP007699.2:

Lanthipeptides: T261_RS08380_lanthipeptide

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

VTS+S CTPGCTS GGGS CS CC

1

VTSISYCTPGCTSDGGGSGCSHCC

24

79.2%

NZ_FMHI01000015.1and 1 other:

NZ_LIXJ01000007.1 Lanthipeptides: AMK22_RS13160_lanthipeptide

Lanthipeptides: H180DRAFT_RS21560_lanthipeptide

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

+TSVS CTPGCTS GGGS CS CC

1

ITSVSYCTPGCTSEGGGSGCSHCC

24

79.2%

NZ_JACHEM010000003.1:

Lanthipeptides: HNQ79_RS07795_lanthipeptide

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

+TSVS CTPGCTS GGGS CS CC

1

ITSVSWCTPGCTSDGGGSGCSHCC

24

79.2%

NZ_JAMHJQ010000009.1and 2 others:

NZ_KN039946.1 Lanthipeptides: FM21_RS35825_lanthipeptideNZ_LIPF01000002.1 Lanthipeptides: AMK11_RS10850_lanthipeptide

Lanthipeptides: M1203_RS22635_lanthipeptide

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

+TSVS CTPGCTS GGGS CS CC

1

ITSVSWCTPGCTSEGGGSGCSHCC

24

79.2%

NZ_KB905819.1:

Lanthipeptides: F603_RS34750_lanthipeptide

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

VTS+S CTPGCTS GGGS CS CC

1

VTSISYCTPGCTSEGGGSGCSHCC

24

79.2%

NZ_LIVZ01000011.1:

Lanthipeptides: AMK31_RS29125_lanthipeptide

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

+TSVS CTPGCTS GGGS CS CC

1

ITSVSYCTPGCTSDGGGSGCSHCC

24

76.9%

NZ_CP071248.1:

Lanthipeptides: BLI009_RS04985_lanthipeptide

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

+TS+SLCTPGCTSP GGS CSFCC

3

LTSISLCTPGCTSPNGGSGCSFCC

26

MIBiG 4.0 matches for BLS56_RS30480

26.5%

Lanthipeptide: nisin A

1

VTSVSLCTPGCTS

13

+TS+SLCTPGC +

1

ITSISLCTPGCKT

13

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.73 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.35 out of 27.55

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

BLS56_RS30480 - Class I

Cleavage pHMM score: 7.20

RODEO score: 31

Monoisotopic mass: 2075.9 Da

Molecular weight: 2077.4 Da

Number of bridges: 4

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2095.4 Da N = 1; 2113.4 Da N = 2; 2131.5 Da N = 3

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 156 - 250; Score: 47.6

TFBS definitions

Regulator	Description

NZ_FMZZ01000001.1 - Region 1 - NRPS-like,betalactone

Download region SVG

Location: 1 - 50,168 nt. (total: 50,168 nt) Show pHMM detection rules used

Region on contig edge.

betalactone: (HMGL-like and AMP-binding)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxidoreductase oxygenase

BLS56_RS00100: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BLS56_RS00110: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BLS56_RS00125: flavodoxin

smcogs: SMCOG1134: flavodoxin

BLS56_RS00130: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

BLS56_RS00135: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

BLS56_RS00155: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

BLS56_RS00160: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Hydrolases: deacetylase esterase hydrolase

BLS56_RS00030: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

BLS56_RS00035: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

BLS56_RS00055: thioesterase

smcogs: SMCOG1004: thioesterase

BLS56_RS00205: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Isomerases: mutase

BLS56_RS00170: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

BLS56_RS00065: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

BLS56_RS00090: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS00150: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000307.4	0.52	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.52	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002276.2	0.48	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001268.4	0.43	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001440.5	0.32	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0001441.5	0.30	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0000132.3	0.30	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0002171.2	0.30	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.30	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002499.2	0.28	NRPS, PKS	enteromycin	Streptomyces achromogenes subsp. streptozoticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002276.2	0.57	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001268.4	0.54	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001441.5	0.49	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0001440.5	0.49	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0002712.2	0.46	PKS	WS-5995 D, WS-5995 B, WS-5995 C, SEK 43	Streptomyces yanglinensis
BGC0000382.5	0.46	NRPS	lipstatin	Streptomyces toxytricini
BGC0001343.3	0.46	PKS	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0000132.3	0.45	PKS	pyrrolomycin	Streptomyces sp. UC 11065

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.20 out of 26.33

Confidence: medium

Additional weak hits (15):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.12 out of 18.57

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 32.93

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.63 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.91 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.72 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.40 out of 36.53

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.09 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.76 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.16 out of 32.74

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.07 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.31 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.32 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 50168:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 7714 - 50168:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS00090: X

AMP-binding (14..412): X

nrpys: Val, Ile, Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LPEAWDAFSLEGFLILGGDYNGYGPVESCVFATV
Nearest Stachelhaus code(s):: Val DALFTGGVFK (59% 8Å match); Leu or Ile DALFIGGTFK (56% 8Å match)
Stachelhaus code match:: 90% (moderate)

BLS56_RS00150: X

AMP-binding (18..367): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NAILYGLSVL-SHGTQAGGYVMYGQTEATARMAY
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator

NZ_FMZZ01000001.1 - Region 2 - terpene

Download region SVG

Location: 271,530 - 292,642 nt. (total: 21,113 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLS56_RS01310: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase

BLS56_RS01365: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Lyases: cyclase

BLS56_RS01335: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000888.5	0.44	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.43	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000551.5	0.43	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001184.4	0.42	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001226.4	0.41	ribosomal	streptocollin	Streptomyces collinus Tu 365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000888.5	0.44	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.43	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000551.5	0.43	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001184.4	0.42	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001226.4	0.41	ribosomal	streptocollin	Streptomyces collinus Tu 365

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

BLS56_RS01330: Lycopene_cycl

Domain 1 (2 - 347): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.87 out of 29.72

Confidence: medium

Additional weak hits (11):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.33 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.93 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.70 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.88 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.01 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.74 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.63 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

NZ_FMZZ01000001.1 - Region 3 - RiPP-like

Download region SVG

Location: 356,610 - 368,901 nt. (total: 12,292 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002346.3	0.35	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0002284.3	0.28	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001127.5	0.27	NRPS	jagaricin	Janthinobacterium agaricidamnosum
BGC0001637.3	0.26	NRPS	kleboxymycin	Klebsiella oxytoca
BGC0002315.2	0.26	PKS	accramycin A	Streptomyces sp.
BGC0001228.5	0.25	NRPS	retimycin A	Salinispora arenicola CNT005
BGC0000446.5	0.25	NRPS	tilivalline, 9-deoxy tilivalline, dihydroxy tilivalline, dehydro tilivalline, dihydroxy-dehydro tilivalline	Klebsiella oxytoca
BGC0000383.5	0.24	NRPS, PKS	luminmycin A, glidobactin A, cepafungin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000339.5	0.24	NRPS	echinomycin	Streptomyces lasaliensis
BGC0000379.5	0.24	NRPS	glycinocin A	Streptomyces viridochromogenes

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002346.3	0.35	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0002284.3	0.28	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001127.5	0.27	NRPS	jagaricin	Janthinobacterium agaricidamnosum
BGC0001637.3	0.26	NRPS	kleboxymycin	Klebsiella oxytoca
BGC0002315.2	0.26	PKS	accramycin A	Streptomyces sp.
BGC0001228.5	0.25	NRPS	retimycin A	Salinispora arenicola CNT005
BGC0000446.5	0.25	NRPS	tilivalline, 9-deoxy tilivalline, dihydroxy tilivalline, dehydro tilivalline, dihydroxy-dehydro tilivalline	Klebsiella oxytoca
BGC0000383.5	0.24	NRPS, PKS	luminmycin A, glidobactin A, cepafungin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000339.5	0.24	NRPS	echinomycin	Streptomyces lasaliensis
BGC0000379.5	0.24	NRPS	glycinocin A	Streptomyces viridochromogenes

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (2):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.03 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.73 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_FMZZ01000001.1 - Region 4 - lassopeptide

Download region SVG

Location: 517,318 - 539,902 nt. (total: 22,585 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BLS56_RS02480: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BLS56_RS02490: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: acetyltransferase

BLS56_RS02455: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

BLS56_RS02445: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

BLS56_RS02485: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.67	ribosomal	albusnodin	Streptomyces albus
BGC0000677.5	0.44	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002013.4	0.42	ribosomal	curacozole	Streptomyces curacoi
BGC0001493.5	0.42	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002402.2	0.41	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0002221.2	0.41	terpene	ent-kauren-16alpha-ol	Serpula lacrymans var. lacrymans S7.9
BGC0001176.4	0.40	ribosomal	streptomonomicin	Streptomonospora alba
BGC0001221.5	0.39	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001435.4	0.38	NRPS, PKS	ikarugamycin	Streptomyces sp. ZJ306

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.67	ribosomal	albusnodin	Streptomyces albus
BGC0000677.5	0.44	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002013.4	0.42	ribosomal	curacozole	Streptomyces curacoi
BGC0001493.5	0.42	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002402.2	0.41	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0002221.2	0.41	terpene	ent-kauren-16alpha-ol	Serpula lacrymans var. lacrymans S7.9
BGC0001176.4	0.40	ribosomal	streptomonomicin	Streptomonospora alba
BGC0001221.5	0.39	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001435.4	0.38	NRPS, PKS	ikarugamycin	Streptomyces sp. ZJ306

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

Additional weak hits (7):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.64 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.26 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.58 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.35 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.34 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.12 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.84 out of 33.14

Confidence: weak

Lasso peptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_FMZZ01000001.1 - Region 5 - PKS-like,T1PKS,t3nrps-iterative

Download region SVG

Location: 586,697 - 664,896 nt. (total: 78,200 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BLS56_RS02765: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BLS56_RS02785: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BLS56_RS02870: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BLS56_RS02990: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: glycosyltransferase

BLS56_RS02735: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase

BLS56_RS02715: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

BLS56_RS02750: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

BLS56_RS02970: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: decarboxylase

BLS56_RS02885: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

BLS56_RS02890: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS02895: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

BLS56_RS02940: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

BLS56_RS32690: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

BLS56_RS02770: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.53	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001250.4	0.53	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.53	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.52	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.51	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.51	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.51	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.50	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.50	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002631.2	0.44	ribosomal	Myxarylin	Pyxidicoccus fallax

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.00 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.64 out of 24.78

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.03 out of 36.53

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.45 out of 25.31

Confidence: medium

Additional weak hits (27):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.20 out of 30.22

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.08 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.04 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.50 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.12 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.00 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.23 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.82 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.74 out of 27.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.85 out of 27.04

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.13 out of 36.53

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.04 out of 32.93

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.17 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.06 out of 23.43

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.37 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.48 out of 29.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.68 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.98 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.92 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 586696 - 664896:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 586696 - 634328:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS32690: pk

PKS_AT (539..829): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 62.5%; Isobutyryl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 105.9
Malonyl-CoA: 96.7
Methoxymalonyl-CoA: 87.8
Isobutyryl-CoA: 73.9
Ethylmalonyl-CoA: 72.4
Propionyl-CoA: 34.4
2-Methylbutyryl-CoA: 32.8
Benzoyl-CoA: 25.2
inactive: 24.3
3-Methylbutyryl-CoA: 24.0
CHC-CoA: 21.5
trans-1,2-CPDA: 20.8
fatty_acid: 11.8
Acetyl-CoA: 4.0

BLS56_RS02890: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (62..447): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAISFDYGLYQLPTTNTGAVAMYGITECKRVTIA
Nearest Stachelhaus code(s):: Asp DYYPTTMRVK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_FMZZ01000001.1 - Region 6 - NRPS-like,t3nrps-iterative

Download region SVG

Location: 781,253 - 834,815 nt. (total: 53,563 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BLS56_RS03570: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

BLS56_RS03655: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

BLS56_RS03660: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BLS56_RS03665: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BLS56_RS03815: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Lyases: decarboxylase dehydratase

BLS56_RS03715: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

BLS56_RS03810: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase

BLS56_RS32880: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001197.5	0.38	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000706.3	0.34	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001483.4	0.32	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002284.3	0.30	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002473.3	0.29	NRPS	propanochelin, butanochelin, pentanochelin	Acinetobacter bouvetii DSM 14964 = CIP 107468
BGC0000189.4	0.28	PKS	3-(2'-hydroxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-hydroxy-3'-oxo-4'-methylhexyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylhexyl)-indole	Xenorhabdus bovienii SS-2004
BGC0001464.3	0.26	other (other)	tetrabromopyrrole	Pseudoalteromonas sp. PS5
BGC0000207.5	0.26	PKS	chartreusin	Streptomyces chartreusis
BGC0001840.2	0.26	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0000259.3	0.26	PKS	prodigiosin	Serratia marcescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001197.5	0.51	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000706.3	0.48	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000131.5	0.47	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0001483.4	0.47	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002284.3	0.45	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002473.3	0.44	NRPS	propanochelin, butanochelin, pentanochelin	Acinetobacter bouvetii DSM 14964 = CIP 107468
BGC0000189.4	0.44	PKS	3-(2'-hydroxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-hydroxy-3'-oxo-4'-methylhexyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylhexyl)-indole	Xenorhabdus bovienii SS-2004
BGC0000207.5	0.42	PKS	chartreusin	Streptomyces chartreusis
BGC0000259.3	0.42	PKS	prodigiosin	Serratia marcescens
BGC0001464.3	0.42	other (other)	tetrabromopyrrole	Pseudoalteromonas sp. PS5

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (13):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.13 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.38 out of 29.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.15 out of 32.93

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.60 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.27 out of 23.43

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.80 out of 26.12

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.42 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.96 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.46 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.02 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.94 out of 32.93

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 11, location 781252 - 834815:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS32880: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (90..521): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LGFMHIAGRVTSFLWVGSGHDGFGSTEAGAILLD
Nearest Stachelhaus code(s):: 4-ohPpa VAVFAGGAGK (35% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_FMZZ01000014.1 - Region 1 - NRPS,transAT-PKS

Download region SVG

Location: 36,734 - 115,543 nt. (total: 78,810 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BLS56_RS24255: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BLS56_RS31905: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acylase acyltransferase glycosyltransferase transferase

BLS56_RS24235: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

BLS56_RS24245: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

BLS56_RS24270: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BLS56_RS24335: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

BLS56_RS24350: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

BLS56_RS24360: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Hydrolases: dehalogenase esterase

BLS56_RS24240: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

BLS56_RS24325: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: hydratase

BLS56_RS24265: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

BLS56_RS24305: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BLS56_RS24320: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

BLS56_RS24345: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.41	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0001201.3	0.39	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0002127.3	0.34	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000205.3	0.34	PKS	bryostatin	Candidatus Endobugula sertula
BGC0001051.5	0.34	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0001012.3	0.32	NRPS, PKS	meridamycin	Streptomyces violaceusniger
BGC0000902.4	0.32	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000255.5	0.32	PKS	pederin	Uncultured bacterium
BGC0002765.2	0.32	NRPS	Keanumycin A, Keanumycin B, Keanumycin C	Pseudomonas sp. QS1027
BGC0002083.3	0.31	PKS	gladiofungin A, gladiofungin B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (4):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.37 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.38 out of 21.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.16 out of 30.97

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.62 out of 39.62

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 36733 - 115543:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys - mal - ohmal - ccmal) + (mal - ccmal - ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS24270: mal

PKS_AT (4..280): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 120.2
inactive: 51.0
Methoxymalonyl-CoA: 40.5
Methylmalonyl-CoA: 31.2
Propionyl-CoA: 23.6
2-Methylbutyryl-CoA: 11.5
Isobutyryl-CoA: 9.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BLS56_RS31905: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (971..1375): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: LWCTFDLSVFDGNSFLSGDISLGGATEATVWSNW
Nearest Stachelhaus code(s):: Cys DLFNFSLVWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

BLS56_RS24345: X

AMP-binding (12..402): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: FVCYFDLSMFEVTSVFCGEDNLYGPTELAVACTG
Nearest Stachelhaus code(s):: D-Ala DLFTVCLIAK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_FMZZ01000013.1 - Region 1 - lassopeptide

Download region SVG

Location: 118,359 - 140,943 nt. (total: 22,585 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

BLS56_RS23740: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

BLS56_RS23730: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.68	ribosomal	albusnodin	Streptomyces albus
BGC0001435.4	0.30	NRPS, PKS	ikarugamycin	Streptomyces sp. ZJ306
BGC0001967.4	0.25	NRPS, PKS	acyldepsipeptide 1	Streptomyces hawaiiensis
BGC0002448.2	0.23	NRPS	Q6402A	Streptomyces violaceusniger
BGC0000957.5	0.22	NRPS, PKS	mycotrienin I	Streptomyces sp. XZQH13
BGC0001762.3	0.20	other (other)	rubrolone A, rubrolone B	Streptomyces sp. KIB-H033

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.68	ribosomal	albusnodin	Streptomyces albus
BGC0001435.4	0.30	NRPS, PKS	ikarugamycin	Streptomyces sp. ZJ306
BGC0001967.4	0.25	NRPS, PKS	acyldepsipeptide 1	Streptomyces hawaiiensis
BGC0002448.2	0.23	NRPS	Q6402A	Streptomyces violaceusniger
BGC0000957.5	0.22	NRPS, PKS	mycotrienin I	Streptomyces sp. XZQH13
BGC0001762.3	0.20	other (other)	rubrolone A, rubrolone B	Streptomyces sp. KIB-H033

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.95 out of 23.79

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (10):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.23 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.06 out of 32.74

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.90 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.49 out of 25.75

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.28 out of 27.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.14 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.26 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.01 out of 30.25

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.07 out of 32.93

Confidence: weak

Lasso peptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism

NZ_FMZZ01000025.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 36,202 nt. (total: 36,202 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BLS56_RS29390: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BLS56_RS29405: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BLS56_RS29410: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase acylase glycosyltransferase methyltransferase

BLS56_RS29395: methyltransferase

smcogs: SMCOG1089: methyltransferase

BLS56_RS29420: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BLS56_RS29445: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

BLS56_RS29470: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

BLS56_RS29510: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase hydrolase phosphatase

BLS56_RS29365: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

BLS56_RS29430: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

BLS56_RS29455: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

BLS56_RS29400: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLS56_RS29425: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000140.5	0.63	PKS	4-hexadecanoyl-3-hydroxy-2-(hydroxymethyl)-2H-furan-5-one	Streptomyces sp. 88-682
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000140.5	0.63	PKS	4-hexadecanoyl-3-hydroxy-2-(hydroxymethyl)-2H-furan-5-one	Streptomyces sp. 88-682
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (2):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.64 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.39 out of 21.55

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 36202:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BLS56_RS29400: NH2

CAL_domain (40..478): NH2

minowa: NH2

Prediction, score:

NH2: 176.4
fatty_acid: 49.7
Acetyl-CoA: 42.6
AHBA: 14.3
shikimic_acid: 7.1

BLS56_RS29420: mal

PKS_AT (524..805): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 116.9
inactive: 73.0
Methoxymalonyl-CoA: 64.6
Methylmalonyl-CoA: 47.5
Propionyl-CoA: 34.4
Acetyl-CoA: 27.2
Isobutyryl-CoA: 23.0
Ethylmalonyl-CoA: 20.8
2-Methylbutyryl-CoA: 15.7
fatty_acid: 14.6
3-Methylbutyryl-CoA: 11.5
Benzoyl-CoA: 10.3
CHC-CoA: 10.2
trans-1,2-CPDA: 0.0

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_FMZZ01000015.1 - Region 1 - T3PKS

Download region SVG

Location: 1 - 28,694 nt. (total: 28,694 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BLS56_RS24660: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: methyltransferase

BLS56_RS24670: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: glucosidase

BLS56_RS24760: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Lyases: decarboxylase

BLS56_RS24635: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

BLS56_RS24675: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001077.4	0.56	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0001962.3	0.51	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0002362.3	0.48	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0002285.2	0.47	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001778.5	0.40	other (other)	showdomycin	Streptomyces showdoensis
BGC0001868.4	0.39	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001510.5	0.39	other (other)	anisomycin	Streptomyces hygrospinosus
BGC0001909.3	0.38	PKS	strobilurin A	Strobilurus tenacellus
BGC0000843.5	0.37	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001964.2	0.36	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001077.4	0.56	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0001962.3	0.51	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0002362.3	0.48	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0002285.2	0.47	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001778.5	0.40	other (other)	showdomycin	Streptomyces showdoensis
BGC0001868.4	0.39	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001510.5	0.39	other (other)	anisomycin	Streptomyces hygrospinosus
BGC0001909.3	0.38	PKS	strobilurin A	Strobilurus tenacellus
BGC0000843.5	0.37	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001964.2	0.36	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.65 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.54 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.71 out of 25.75

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description

NZ_FMZZ01000017.1 - Region 1 - T3PKS

Download region SVG

Location: 245 - 41,351 nt. (total: 41,107 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase

BLS56_RS26190: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase

BLS56_RS26130: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: synthase

BLS56_RS26110: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.59	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.56	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.54	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.49	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000280.5	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000281.3	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000841.5	0.40	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate, clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0000652.5	0.37	terpene	napyradiomycin	Streptomyces sp. CNQ525
BGC0001079.5	0.37	PKS, terpene	napyradiomycin A80915C, napyradiomycin 2, napyradiomycin 3, napyradiomycin 4	Streptomyces aculeolatus
BGC0000665.5	0.36	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.59	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.56	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.54	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.49	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000280.5	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000281.3	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000841.5	0.40	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate, clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0000652.5	0.37	terpene	napyradiomycin	Streptomyces sp. CNQ525
BGC0001079.5	0.37	PKS, terpene	napyradiomycin A80915C, napyradiomycin 2, napyradiomycin 3, napyradiomycin 4	Streptomyces aculeolatus
BGC0000665.5	0.36	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.04 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.66 out of 20.97

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.48 out of 30.25

Confidence: medium

Additional weak hits (16):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.64 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.43 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.00 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.03 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.69 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.70 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.28 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.39 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.10 out of 28.19

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.34 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.84 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.63 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.01 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CcpA	Catabolite control protein A
ColR	Phenol-responsive regulator

NZ_FMZZ01000019.1 - Region 1 - lanthipeptide-class-iii