GCF_900099755.1 - 22 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_FNDV01000009.1 (Actinokineospora alba)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	deazapurine,other	248,099	317,441	Low	huimycin	other:other

NZ_FNDV01000008.1 (Actinokineospora alba)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	azole-containing-RiPP	273,741	301,983
Region 6.2	RiPP-like	343,626	354,432

NZ_FNDV01000006.1 (Actinokineospora alba)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	NAPAA	380,552	414,439

NZ_FNDV01000005.1 (Actinokineospora alba)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	ectoine	2,343	12,717

NZ_FNDV01000004.1 (Actinokineospora alba)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	NRPS-like,NRPS	129,717	190,893
Region 9.2	t3nrps-iterative,T1PKS	204,546	289,537	Low	butyrolactol A	PKS
Region 9.3	NRPS,lanthipeptide-class-ii,ectoine	389,701	447,654	Low	kosinostatin	NRPS:Type I+PKS:Type II+saccharide:hybrid/tailoring

NZ_FNDV01000012.1 (Actinokineospora alba)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	NRP-metallophore,NRPS	1	46,213	Low	gobichelin A/gobichelin B	NRPS:Type I

NZ_FNDV01000003.1 (Actinokineospora alba)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	terpene	188,852	210,078
Region 12.2	NRPS-like,NRPS	314,872	448,401	Low	SW-163C/UK-63598/SW-163E/SW-163F/SW-163G	NRPS:Type I
Region 12.3	NRPS,T1PKS,terpene	622,028	674,040
Region 12.4	hydrogen-cyanide	909,579	922,363

NZ_FNDV01000017.1 (Actinokineospora alba)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	terpene,azole-containing-RiPP,T1PKS	18,801	118,451

NZ_FNDV01000002.1 (Actinokineospora alba)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	oligosaccharide	353,658	380,131
Region 15.2	terpene	929,785	954,806	Low	isorenieratene	terpene

NZ_FNDV01000007.1 (Actinokineospora alba)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	RiPP-like,terpene	220,672	251,033
Region 18.2	hglE-KS	379,078	426,568

NZ_FNDV01000001.1 (Actinokineospora alba)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	NI-siderophore	60,927	92,360
Region 20.2	t3nrps-iterative,T1PKS,NRPS-like,ectoine	170,632	281,691	Low	sporolide A/sporolide B	NRPS:Type I+PKS:Enediyne type I
Region 20.3	terpene-precursor	320,362	341,402

NZ_FNDV01000014.1 (Actinokineospora alba)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	ectoine	111,294	121,695	High	ectoine	other:other

No secondary metabolite regions were found in these records:: NZ_FNDV01000025.1 (Actinokineospora alba); NZ_FNDV01000024.1 (Actinokineospora alba); NZ_FNDV01000027.1 (Actinokineospora alba); NZ_FNDV01000010.1 (Actinokineospora alba); NZ_FNDV01000026.1 (Actinokineospora alba); NZ_FNDV01000028.1 (Actinokineospora alba); NZ_FNDV01000020.1 (Actinokineospora alba); NZ_FNDV01000029.1 (Actinokineospora alba); NZ_FNDV01000023.1 (Actinokineospora alba); NZ_FNDV01000018.1 (Actinokineospora alba); NZ_FNDV01000011.1 (Actinokineospora alba); NZ_FNDV01000013.1 (Actinokineospora alba); NZ_FNDV01000022.1 (Actinokineospora alba); NZ_FNDV01000015.1 (Actinokineospora alba); NZ_FNDV01000016.1 (Actinokineospora alba); NZ_FNDV01000019.1 (Actinokineospora alba); NZ_FNDV01000021.1 (Actinokineospora alba)

Compact view

NZ_FNDV01000009.1 - Region 1 - deazapurine,other

Download region GenBank file

Download region SVG

Location: 248,099 - 317,441 nt. (total: 69,343 nt) Show pHMM detection rules used

deazapurine: (GTP_cyclohydroI and PTPS and QueE and QueC and not (dpdA1 or bTGT))
other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BLR56_RS25840: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase glycosyltransferase methyltransferase

BLR56_RS25630: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

BLR56_RS25850: methyltransferase

smcogs: SMCOG1089: methyltransferase

BLR56_RS34655: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: dehydratase

BLR56_RS25860: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000607.5	0.20	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0000802.5	0.18	saccharide	succinoglycan	Sinorhizobium meliloti
BGC0001310.5	0.18	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001808.5	0.18	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0000881.3	0.18	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0002571.2	0.17	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0002354.4	0.16	other (other)	huimycin	Kutzneria albida DSM 43870
BGC0001224.5	0.15	other (other)	reductasporine	uncultured bacterium
BGC0000879.5	0.15	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0001937.4	0.14	other (other)	tubercidin	Streptomyces tubercidicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000802.5	0.55	saccharide	succinoglycan	Sinorhizobium meliloti
BGC0001808.5	0.50	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0000881.3	0.50	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0000879.5	0.49	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0001310.5	0.49	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001937.4	0.49	other (other)	tubercidin	Streptomyces tubercidicus
BGC0002354.4	0.47	other (other)	huimycin	Kutzneria albida DSM 43870
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0001387.5	0.44	other (other)	nucleocidin	Streptomyces calvus
BGC0000197.5	0.43	PKS, saccharide	aranciamycin	Streptomyces echinatus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.93 out of 26.85

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.87 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 25.31

Confidence: medium

Additional weak hits (15):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.30 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.57 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.83 out of 27.78

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.80 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.63 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.21 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.80 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.44 out of 18.57

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.72 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.52 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_FNDV01000008.1 - Region 1 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 273,741 - 301,983 nt. (total: 28,243 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase acyltransferase

BLR56_RS24105: acyltransferase

smcogs: SMCOG1141: acyltransferase

BLR56_RS24170: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000866.5	0.43	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.3	0.41	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000606.5	0.38	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001472.5	0.37	ribosomal	berninamycin A	Streptomyces bernensis
BGC0002363.3	0.37	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0000882.5	0.37	other (other)	mildiomycin	Streptomyces rimofaciens
BGC0000896.5	0.31	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0000721.4	0.31	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0002467.2	0.30	NRPS	thermochelin	Thermocrispum agreste DSM 44070
BGC0001797.3	0.30	ribosomal	telomestatin	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000866.5	0.43	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.3	0.41	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000606.5	0.38	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001472.5	0.37	ribosomal	berninamycin A	Streptomyces bernensis
BGC0002363.3	0.37	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0000882.5	0.37	other (other)	mildiomycin	Streptomyces rimofaciens
BGC0000896.5	0.31	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0000721.4	0.31	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0002467.2	0.30	NRPS	thermochelin	Thermocrispum agreste DSM 44070
BGC0001797.3	0.30	ribosomal	telomestatin	Streptomyces anulatus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.50 out of 26.85

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

Additional weak hits (3):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.97 out of 32.74

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.09 out of 29.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.79 out of 30.22

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

TFBS Finder

Azole RiPPs

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
RutR	Regulator of the pyrimidine and purine metabolism

Core peptide predictions

No core peptides found.

NZ_FNDV01000008.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 343,626 - 354,432 nt. (total: 10,807 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

BLR56_RS24480: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: dehydratase

BLR56_RS24475: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000595.3	0.34	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000597.4	0.33	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0001760.5	0.31	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970
BGC0000502.5	0.30	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0000842.5	0.28	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0001706.3	0.27	terpene	nodulisporic acid F	Hypoxylon pulicicidum
BGC0000992.4	0.26	NRPS, PKS	fusaridione A, (3R,5S)-5-(4-hydroxybenzyl)-3-methyl-3-((2E,4E,6E,8E,10E)-4,8,10-trimethyldodeca-2,4,6,8,10-pentaenoyl)pyrrolidine-2,4-dione	Fusarium heterosporum
BGC0002788.2	0.23	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001156.5	0.23	terpene	platencin	Streptomyces platensis
BGC0002026.3	0.21	NRPS, PKS	thaxteramide A1, thaxteramide A2, thaxteramide B1, thaxteramide B2	Jahnella sp. MSr9139

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000595.3	0.34	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000597.4	0.33	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0001760.5	0.31	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970
BGC0000502.5	0.30	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0000842.5	0.28	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0001706.3	0.27	terpene	nodulisporic acid F	Hypoxylon pulicicidum
BGC0000992.4	0.26	NRPS, PKS	fusaridione A, (3R,5S)-5-(4-hydroxybenzyl)-3-methyl-3-((2E,4E,6E,8E,10E)-4,8,10-trimethyldodeca-2,4,6,8,10-pentaenoyl)pyrrolidine-2,4-dione	Fusarium heterosporum
BGC0002788.2	0.23	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001156.5	0.23	terpene	platencin	Streptomyces platensis
BGC0002026.3	0.21	NRPS, PKS	thaxteramide A1, thaxteramide A2, thaxteramide B1, thaxteramide B2	Jahnella sp. MSr9139

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

Additional weak hits (4):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.51 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.42 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.06 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.05 out of 27.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_FNDV01000006.1 - Region 1 - NAPAA

Download region GenBank file

Download region SVG

Location: 380,552 - 414,439 nt. (total: 33,888 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLR56_RS20455: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BLR56_RS20535: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Ligases: ligase

BLR56_RS20510: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002535.2	0.48	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002535.2	0.48	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

Additional weak hits (10):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.73 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.12 out of 27.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.47 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.39 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.89 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.44 out of 21.55

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.63 out of 27.18

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.95 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.33 out of 28.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 380551 - 414439:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BLR56_RS20510: X

AMP-binding (43..415): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACG
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_FNDV01000005.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 2,343 - 12,717 nt. (total: 10,375 nt) Show pHMM detection rules used

Region on contig edge.

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLR56_RS16490: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Hydrolases: esterase

BLR56_RS16470: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

BLR56_RS16515: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001778.5	0.52	other (other)	showdomycin	Streptomyces showdoensis
BGC0000131.5	0.45	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0002020.3	0.44	NRPS, saccharide	photolose, oligosaccharide 1 (GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 2 (GlcNAc-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 3 (GlcNAc-β(1-4)-GlcNAc-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 4 (GlcN-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 5 (6-phosphoGlcN-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc)	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002284.3	0.43	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002097.3	0.43	NRPS, PKS, saccharide	kosinostatin	Micromonospora sp. 28ISP2-46
BGC0000706.3	0.42	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001073.5	0.42	NRPS, PKS	kosinostatin	Micromonospora sp. TP-A0468
BGC0002157.2	0.41	NRPS, other (other)	(-)-ditryptophenaline	Aspergillus flavus
BGC0001517.3	0.40	NRPS	asperphenamate	Aspergillus terreus NIH2624
BGC0001302.5	0.40	other (other)	lomofungin	Streptomyces lomondensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001778.5	0.52	other (other)	showdomycin	Streptomyces showdoensis
BGC0000131.5	0.45	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0002020.3	0.44	NRPS, saccharide	photolose, oligosaccharide 1 (GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 2 (GlcNAc-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 3 (GlcNAc-β(1-4)-GlcNAc-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 4 (GlcN-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 5 (6-phosphoGlcN-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc)	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002284.3	0.43	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002097.3	0.43	NRPS, PKS, saccharide	kosinostatin	Micromonospora sp. 28ISP2-46
BGC0000706.3	0.42	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001073.5	0.42	NRPS, PKS	kosinostatin	Micromonospora sp. TP-A0468
BGC0002157.2	0.41	NRPS, other (other)	(-)-ditryptophenaline	Aspergillus flavus
BGC0001517.3	0.40	NRPS	asperphenamate	Aspergillus terreus NIH2624
BGC0001302.5	0.40	other (other)	lomofungin	Streptomyces lomondensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.11 out of 35.63

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.22 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_FNDV01000004.1 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 129,717 - 190,893 nt. (total: 61,177 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BLR56_RS14675: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

BLR56_RS14690: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

BLR56_RS14795: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

BLR56_RS14800: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: glucosidase hydrolase

BLR56_RS14585: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

BLR56_RS14650: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

BLR56_RS14695: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: lyase

BLR56_RS14660: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase

BLR56_RS14665: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS14720: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

BLR56_RS14780: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.68	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.62	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.86 out of 21.84

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

Additional weak hits (16):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.33 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.65 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.41 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.74 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.71 out of 25.88

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.30 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.79 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.62 out of 32.74

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.79 out of 30.22

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.05 out of 28.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.70 out of 35.63

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.60 out of 25.88

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.56 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 129716 - 190893:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala) + (Cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 129716 - 173271:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala) + (Cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 146909 - 190893:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala) + (Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BLR56_RS14665: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (163..552): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDLSVFECNTNVAGEYNLYGPSEDTTYSTY
Nearest Stachelhaus code(s):: Ala DLFNNALTYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

BLR56_RS14720: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (470..887): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: LWVTFDLSVYDGNSFLSGDVSLGGATEATVWSNY
Nearest Stachelhaus code(s):: Cys DLFNFSLVWK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_FNDV01000004.1 - Region 2 - T1PKS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 204,546 - 289,537 nt. (total: 84,992 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLR56_RS14975: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BLR56_RS15000: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

BLR56_RS15010: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BLR56_RS15025: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acylase aminotransferase methyltransferase

BLR56_RS14875: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

BLR56_RS14990: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BLR56_RS15095: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase hydrolase phosphatase

BLR56_RS15015: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

BLR56_RS15020: thioesterase

smcogs: SMCOG1004: thioesterase

BLR56_RS15090: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: decarboxylase

BLR56_RS14960: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

BLR56_RS14945: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BLR56_RS14955: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS14970: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BLR56_RS14980: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLR56_RS14985: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BLR56_RS14995: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLR56_RS15030: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

BLR56_RS14965: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.87	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.86	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.85	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.85	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000018.5	0.60	PKS	angolamycin	Streptomyces eurythermus
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.56 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.04 out of 23.43

Confidence: medium

Additional weak hits (11):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.56 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.29 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.17 out of 27.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.16 out of 25.88

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.02 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.83 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.36 out of 32.93

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.12 out of 23.43

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.19 out of 29.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 204545 - 289537:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-ccmal) + (ccmal) + (ccmal - ohmal - ohmal) + (Me-ccmal) + (ohmal)
Non-colinear ordering:: BLR56_RS14975 + BLR56_RS14980 + BLR56_RS14995 + BLR56_RS14985 + BLR56_RS14990

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BLR56_RS14955: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (13..420): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GSVLFDAGFSQTTCANTGG--MYGLTEA-FRSTY
Nearest Stachelhaus code(s):: Asp DASTATMFRK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

BLR56_RS14975: mmal - mmal

PKS_AT (543..835): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 193.5
Ethylmalonyl-CoA: 177.5
Methoxymalonyl-CoA: 150.5
2-Methylbutyryl-CoA: 123.4
Propionyl-CoA: 107.0
trans-1,2-CPDA: 106.3
CHC-CoA: 98.9
Malonyl-CoA: 91.8
Isobutyryl-CoA: 45.6
Benzoyl-CoA: 44.0
3-Methylbutyryl-CoA: 42.0
Acetyl-CoA: 41.0
fatty_acid: 20.7
inactive: 15.3

PKS_AT (1530..1825): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Malonyl-CoA: 70.8%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 178.8
Ethylmalonyl-CoA: 168.2
Methoxymalonyl-CoA: 152.5
2-Methylbutyryl-CoA: 109.2
trans-1,2-CPDA: 99.2
Malonyl-CoA: 86.3
Propionyl-CoA: 79.0
Isobutyryl-CoA: 76.4
Benzoyl-CoA: 63.1
CHC-CoA: 60.5
3-Methylbutyryl-CoA: 30.4
Acetyl-CoA: 29.7
inactive: 25.5
fatty_acid: 16.9

BLR56_RS14980: mal

PKS_AT (566..856): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 207.8
inactive: 101.2
Methoxymalonyl-CoA: 66.1
Methylmalonyl-CoA: 55.4
Propionyl-CoA: 27.7
Ethylmalonyl-CoA: 26.6
Acetyl-CoA: 21.0
Benzoyl-CoA: 20.8
Isobutyryl-CoA: 20.5
fatty_acid: 16.4
CHC-CoA: 7.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BLR56_RS14985: mmal

PKS_AT (566..862): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Malonyl-CoA: 75.0%; Methoxymalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 193.8
Ethylmalonyl-CoA: 193.0
Methoxymalonyl-CoA: 162.1
2-Methylbutyryl-CoA: 120.4
trans-1,2-CPDA: 119.6
Propionyl-CoA: 101.2
Malonyl-CoA: 101.0
CHC-CoA: 80.5
Isobutyryl-CoA: 71.9
Benzoyl-CoA: 67.9
Acetyl-CoA: 42.3
inactive: 39.3
3-Methylbutyryl-CoA: 33.7
fatty_acid: 29.6

BLR56_RS14990: mal

PKS_AT (555..866): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 116.1
inactive: 84.1
Methoxymalonyl-CoA: 44.9
Methylmalonyl-CoA: 34.0
Propionyl-CoA: 17.0
Isobutyryl-CoA: 8.9
Benzoyl-CoA: 8.6
fatty_acid: 7.6
Ethylmalonyl-CoA: 6.9
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BLR56_RS14995: mal - mal - mal

PKS_AT (536..841): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 131.4
inactive: 88.3
Methoxymalonyl-CoA: 67.4
Methylmalonyl-CoA: 53.8
Ethylmalonyl-CoA: 29.1
Propionyl-CoA: 28.3
Isobutyryl-CoA: 21.8
Acetyl-CoA: 14.4
3-Methylbutyryl-CoA: 13.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (2028..2328): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; 2-Rhyd-Malonyl-CoA: 66.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 140.5
inactive: 83.4
Methoxymalonyl-CoA: 65.5
Methylmalonyl-CoA: 55.4
Propionyl-CoA: 39.6
2-Methylbutyryl-CoA: 25.0
Ethylmalonyl-CoA: 24.4
Isobutyryl-CoA: 20.6
Benzoyl-CoA: 17.5
CHC-CoA: 16.6
fatty_acid: 12.4
trans-1,2-CPDA: 7.9
Acetyl-CoA: 5.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (3536..3835): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; 2-Rhyd-Malonyl-CoA: 66.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 143.0
inactive: 84.6
Methoxymalonyl-CoA: 74.0
Methylmalonyl-CoA: 64.8
Propionyl-CoA: 45.7
Ethylmalonyl-CoA: 38.0
2-Methylbutyryl-CoA: 37.6
Isobutyryl-CoA: 34.4
CHC-CoA: 21.8
Benzoyl-CoA: 21.8
trans-1,2-CPDA: 14.3
fatty_acid: 12.2
Acetyl-CoA: 10.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

NZ_FNDV01000004.1 - Region 3 - NRPS,ectoine,lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 389,701 - 447,654 nt. (total: 57,954 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)
ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BLR56_RS15560: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

BLR56_RS15595: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase

BLR56_RS15635: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: cyclase

BLR56_RS15625: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: ligase

BLR56_RS15620: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS15640: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS15645: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

BLR56_RS15690: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.96	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.96	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.96	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.94	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.93	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001758.4	0.92	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.90	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.90	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002164.2	0.83	NRPS	peramine	Epichloe festucae
BGC0001778.5	0.67	other (other)	showdomycin	Streptomyces showdoensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for BLR56_RS15625

BLR56_RS33870

Leader:

MSFGLRAAALAGLVVTAGA

Core:

ATAVGFSGIFDDPANLASWPTSTTCCPEKPK

Core with dehydrations:

ADhbAVGFDhaGIFDDPANLADhaWPDhbDhaDhbDhbCysCysPEKPK

antiSMASH-DB 4.0 matches for BLR56_RS33870

100.0%

NZ_FNDV01000004.1:

Lanthipeptides: BLR56_RS33870_lanthipeptide

1

ATAVGFSGIFDDPANLASWPTSTTCCPEKPK

31

ATAVGFSGIFDDPANLASWPTSTTCCPEKPK

1

ATAVGFSGIFDDPANLASWPTSTTCCPEKPK

31

58.1%

NZ_LN850107.1:

Lanthipeptides: BN1701_RS15195_lanthipeptide

10

FDDPANLAS-WPTSTTCCPEKPK

31

FDDPA L+ WPTSTTCCPE PK

1

FDDPATLSGIWPTSTTCCPEDPK

23

45.2%

NZ_FOGI01000013.1and 1 other:

NZ_RCDD01000003.1 Lanthipeptides: CLV68_RS20325_lanthipeptide

Lanthipeptides: BMY07_RS27390_lanthipeptide

10

FDDPANLAS--WPTSTTCCPEKPK

31

DDPA + WP STTCCPE P

2

LDDPAAAVAFDWPGSTTCCPELPN

25

with 13 more sequence matches

Only the first 10 are displayed here.

41.9%

NZ_CDME01000002.1:

Lanthipeptides: BN1199_RS00660_lanthipeptide

2

TAVGFSGIFDDPAN-LASWPTSTTCCPEKPK

31

A G +G+FDDPA+ +A +P C E P

1

AAAGAAGVFDDPASAVAVFP---ICSIEDPH

28

38.7%

NZ_JAMTCO010000021.1:

Lanthipeptides: LV75_RS33045_lanthipeptide

10

FDDPANLAS-WPTSTTCCPEKP

30

FDDP + + WP STTCC +P

2

FDDPTAITTNWPGSTTCCGNRP

23

36.8%

NZ_JAMTCR010000003.1:

Lanthipeptides: LV79_RS16640_lanthipeptide

1

ATAVGFSGIFDDPANLAS-WPTSTTCCPEKPK

31

A+AV F G FDDPA +A+ WP STTCCPE P

27

ASAVAF-GAFDDPAAVAANWPGSTTCCPELPN

57

29.0%

NZ_CP069183.1:

Lanthipeptides: LLNCDO700_RS13730_lanthipeptide

5

GFSGIFD---DPANLASWPTSTTCCP

27

G SG+ N+ SW TCC

2

GGSGVIHTISHECNMNSWQFVFTCCS

27

25.8%

NC_012470.1and 11 others:

NZ_CABY01000005.1 Lanthipeptides: SZBHS5_RS06485_lanthipeptideNZ_CP029398.1 Lanthipeptides: DF184_RS05185_lanthipeptideNZ_CP029398.1 Lanthipeptides: DF184_RS05180_lanthipeptideNZ_CP078012.1 Lanthipeptides: KV238_RS09835_lanthipeptideNZ_CP078012.1 Lanthipeptides: KV238_RS09830_lanthipeptideNZ_JAFLMI010000009.1 Lanthipeptides: J0638_RS05350_lanthipeptideNZ_JAFLMI010000009.1 Lanthipeptides: J0638_RS05345_lanthipeptideNZ_LR738724.1 Lanthipeptides: GPW69_RS05065_lanthipeptideNZ_LR738724.1 Lanthipeptides: GPW69_RS05060_lanthipeptideNZ_VZNS01000007.1 Lanthipeptides: F6P79_RS05580_lanthipeptideNZ_VZNS01000007.1 Lanthipeptides: F6P79_RS05575_lanthipeptide

Lanthipeptides: SZO_RS04070_lanthipeptide

5

GFSGIFD---DPANLASWPTSTTCCP

27

G +G+F ++ SW TCC

1

GKNGVFKTISHECHMNSWQFLFTCCS

26

25.8%

NZ_ALSD01000046.1and 49 others:

NZ_CAAHGW010000010.1 Lanthipeptides: E9435_RS08890_lanthipeptideNZ_CAAHHE010000002.1 Lanthipeptides: E9499_RS02935_lanthipeptideNZ_CAAHHF010000009.1 Lanthipeptides: E9478_RS08685_lanthipeptideNZ_CAAHHF010000009.1 Lanthipeptides: E9478_RS08680_lanthipeptideNZ_CAAHHN010000003.1 Lanthipeptides: E9502_RS05700_lanthipeptideNZ_CAAHHU010000009.1 Lanthipeptides: E9510_RS08730_lanthipeptideNZ_CAAHHU010000009.1 Lanthipeptides: E9510_RS08725_lanthipeptideNZ_CAAHHW010000012.1 Lanthipeptides: E9525_RS08980_lanthipeptideNZ_CAAHHW010000012.1 Lanthipeptides: E9525_RS08975_lanthipeptideNZ_CAAHIB010000001.1 Lanthipeptides: E9539_RS01070_lanthipeptideNZ_CAAHIV010000024.1 Lanthipeptides: E9612_RS09265_lanthipeptideNZ_CAAHIV010000024.1 Lanthipeptides: E9612_RS09260_lanthipeptideNZ_CAAHKK010000019.1 Lanthipeptides: E9649_RS08765_lanthipeptideNZ_CAAHKK010000019.1 Lanthipeptides: E9649_RS08760_lanthipeptideNZ_CAAHKP010000014.1 Lanthipeptides: E9652_RS08915_lanthipeptideNZ_CAAHKP010000014.1 Lanthipeptides: E9652_RS08910_lanthipeptideNZ_CAAHKQ010000003.1 Lanthipeptides: E9664_RS02170_lanthipeptideNZ_CAAHKY010000014.1 Lanthipeptides: E9668_RS09655_lanthipeptideNZ_CAAHLP010000002.1 Lanthipeptides: E9684_RS03455_lanthipeptideNZ_CAAHLP010000002.1 Lanthipeptides: E9684_RS03450_lanthipeptideNZ_CAAHQE010000012.1 Lanthipeptides: E9931_RS08825_lanthipeptideNZ_CAAHQE010000012.1 Lanthipeptides: E9931_RS08820_lanthipeptideNZ_CAAHRY010000002.1 Lanthipeptides: E9986_RS03170_lanthipeptideNZ_CAAIES010000002.1 Lanthipeptides: FAH15_RS02470_lanthipeptideNZ_CAAIIA010000012.1 Lanthipeptides: FAH55_RS08470_lanthipeptideNZ_CAAIIA010000012.1 Lanthipeptides: FAH55_RS08465_lanthipeptideNZ_CAAIJM010000015.1 Lanthipeptides: FAI23_RS09580_lanthipeptideNZ_CAAINV010000013.1 Lanthipeptides: FAI86_RS09035_lanthipeptideNZ_CAAINV010000013.1 Lanthipeptides: FAI86_RS09030_lanthipeptideNZ_CAAIRS010000012.1 Lanthipeptides: FAK24_RS08495_lanthipeptideNZ_CAAIRS010000012.1 Lanthipeptides: FAK24_RS08490_lanthipeptideNZ_CAAJFI010000013.1 Lanthipeptides: FAP60_RS08505_lanthipeptideNZ_CAAJFI010000013.1 Lanthipeptides: FAP60_RS08500_lanthipeptideNZ_CAJHJS010000009.1 Lanthipeptides: JMX87_RS06790_lanthipeptideNZ_CAJHJS010000009.1 Lanthipeptides: JMX87_RS06785_lanthipeptideNZ_CM001076.1 Lanthipeptides: SDD27957_RS04310_lanthipeptideNZ_CM001076.1 Lanthipeptides: SDD27957_RS04305_lanthipeptideNZ_CP035426.1 Lanthipeptides: ETT73_RS02595_lanthipeptideNZ_CP035426.1 Lanthipeptides: ETT73_RS02590_lanthipeptideNZ_CP035428.1 Lanthipeptides: ETT71_RS02815_lanthipeptideNZ_CP035437.1 Lanthipeptides: ETT62_RS06680_lanthipeptideNZ_CP035437.1 Lanthipeptides: ETT62_RS06675_lanthipeptideNZ_CP035443.1 Lanthipeptides: ETT56_RS07265_lanthipeptideNZ_GL636070.1 Lanthipeptides: HMPREF9171_RS105315_lanthipeptideNZ_LR793258.1 Lanthipeptides: HV369_RS03145_lanthipeptideNZ_LR793258.1 Lanthipeptides: HV369_RS03140_lanthipeptideNZ_LS483425.1 Lanthipeptides: DQN36_RS06755_lanthipeptideNZ_LS483425.1 Lanthipeptides: DQN36_RS06750_lanthipeptideNZ_LT545678.1 Lanthipeptides: BJR96_RS07040_lanthipeptide

Lanthipeptides: SAG0161_RS120605_lanthipeptide

5

GFSGIF---DDPANLASWPTSTTCCP

27

G +G+F +L +W TCC

1

GKNGVFKTISHECHLNTWAFLATCCS

26

25.8%

NZ_CP060646.1:

Lanthipeptides: H7789_RS06845_lanthipeptide

5

GFSGIF---DDPANLASWPTSTTCCP

27

G +G+F +L +W + TCC

1

GKNGVFKTISHECHLNTWASLATCCS

26

25.8%

NZ_JAHBEV010000004.1and 3 others:

NZ_JAHBEX010000010.1 Lanthipeptides: KII86_RS06785_lanthipeptideNZ_JAHBFD010000039.1 Lanthipeptides: KIJ16_RS07340_lanthipeptideNZ_LN890331.1 Lanthipeptides: LEKG_RS02295_lanthipeptide

Lanthipeptides: KII98_RS01100_lanthipeptide

7

SGIFD---DPANLASWPTSTTCCP

27

SG+ + N+ SW TCC

3

SGVINTVSHECNMNSWQFVFTCCA

26

22.6%

NC_015760.1and 5 others:

NZ_CAJHJN010000010.1 Lanthipeptides: JMZ68_RS09030_lanthipeptideNZ_JACLQK010000036.1 Lanthipeptides: H7U04_RS11500_lanthipeptideNZ_JADPEB010000003.1 Lanthipeptides: I4U26_RS02800_lanthipeptideNZ_JAQCST010000021.1 Lanthipeptides: PGZ09_RS09470_lanthipeptideNZ_OU540596.1 Lanthipeptides: JQ838_RS05640_lanthipeptide

Lanthipeptides: SALIVB_RS03310_lanthipeptide

5

GFSGIFDDPANLASWPTSTTCC

26

G NLA+W CC

3

GVVLTLTHECNLATWTKKLKCC

24

22.6%

NZ_MSRJ01000005.1:

Lanthipeptides: BKH06_RS03755_lanthipeptide

5

GFSGIFDDPANLASWPTSTTCCP

27

G N+ SW TCC

2

GVVTTISHECNMNSWQFIFTCCS

24

allorf_401050_401271

Leader:

MGGNYALSRLTRAQASEPSAGPRKRGRRAQPGCGRTDHGVGRSPIHAA

Core:

GATWEFGYAPPMPLADRRAYVGPCG

Core with dehydrations:

GADhbWEFGYAPPMPLADRRAYVGPCysG

antiSMASH-DB 4.0 matches for allorf_401050_401271

100.0%

NZ_FNDV01000004.1:

Lanthipeptides: allorf_401050_401271_lanthipeptide

1

GATWEFGYAPPMPLADRRAYVGPCG

25

GATWEFGYAPPMPLADRRAYVGPCG

1

GATWEFGYAPPMPLADRRAYVGPCG

25

24.0%

NZ_LMHM01000013.1:

Lanthipeptides: allorf_284448_284594_lanthipeptide

4

WEFGYAPPMPLA

15

W+FG P MP +

10

WKFGGRPRMPCS

21

14.5%

NZ_FNIE01000004.1:

Lanthipeptides: allorf_379559_379762_lanthipeptide

1

GATWEFGYAPPMPLADR

17

G T F Y PP+P + R

30

GLTRRFRYRPPVPRSGR

46

MIBiG 4.0 matches for allorf_401050_401271

12.0%

BGC0002289.2 (CQR60041.1):

Lasso peptide: Leepeptin

3

TWEFGY

8

W F Y

11

NWHFDY

16

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.58 out of 23.79

Confidence: medium

Additional weak hits (9):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.78 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.82 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.76 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.76 out of 29.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.26 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.40 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

BLR56_RS33870 - Class II

Cleavage pHMM score: -2.50

RODEO score: 0

Monoisotopic mass: 3084.5 Da

Molecular weight: 3086.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3104.4 Da N = 1; 3122.5 Da N = 2; 3140.5 Da N = 3; 3158.5 Da N = 4; 3176.5 Da N = 5

allorf_401050_401271 - Class II

Cleavage pHMM score: -5.00

RODEO score: 0

Monoisotopic mass: 2663.3 Da

Molecular weight: 2665.0 Da

Number of bridges: 1

Predicted core structure(s)

For candidate cluster 5, location 389700 - 447654:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - Gly - X) + (X - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BLR56_RS15620: X

AMP-binding (15..398): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWAAFDLSLLDTQAIVTGDHNLYGCTETNDSFLH
Nearest Stachelhaus code(s):: Ala DILQITLVYK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

BLR56_RS15640: Ser - Gly - X

Search NORINE for peptide: strict or relaxed

AMP-binding (21..394): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAVDVTY
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1025..1412): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDIAGLELQALVGGETNLYGPTETTVWSTA
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2062..2456): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VAHVFDVSMADMDLVVGGEMQVYGPTETTVVATM
Nearest Stachelhaus code(s):: Trp DVASVGAVVK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

BLR56_RS15645: X - X - X

AMP-binding (471..859): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VIHVFDVSMVDADLIVGGEVHVYGPTEATVVTTM
Nearest Stachelhaus code(s):: Lys DTEDIGSVVK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1504..1907): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHHAFDASLDPLELVVGGEINVYGPTECTVDTVW
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (71% 8Å match); Gln DAWQVGVVDK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2545..2916): X

nrpys: bMe-Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YRASFDLTVTAVKAMLGGELNVYGPTETCVNCTE
Nearest Stachelhaus code(s):: bMe-Asp DLTKMGVVNK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_FNDV01000012.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 1 - 46,213 nt. (total: 46,213 nt) Show pHMM detection rules used

Region on contig edge.

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

BLR56_RS28485: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: esterase protease

BLR56_RS28500: thioesterase

smcogs: SMCOG1004: thioesterase

BLR56_RS28580: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Isomerases: isomerase

BLR56_RS28465: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

BLR56_RS28470: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS28495: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.87	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.81	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.79	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.78	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.77	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.77	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.74	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.33 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.99 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.03 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.84 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.03 out of 36.53

Confidence: medium

Additional weak hits (10):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.46 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.88 out of 39.62

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.58 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.36 out of 35.63

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.86 out of 36.53

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.39 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.98 out of 36.53

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.71 out of 25.88

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 46213:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - X - D-Ser - OH-Orn) + (Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BLR56_RS28470: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (35..440): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NASLFPFGCPGGALQVGGAQQVFGMAEGLLCYTG
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVLCK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

BLR56_RS28485: Gly - X - Ser - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (482..856): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FDMTFDIAALEAQALVGGETNLYGPTETTIWSTV
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1513..1909): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTQSFDLAFWEVFLLVGTEVNCYGPTETTVNATL
Nearest Stachelhaus code(s):: Hph or Hty DLGFTGCVNK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2559..2958): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4057..4456): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHWFDASWQPWEVGVGGEYNLYGPTETTVDALA
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

BLR56_RS28495: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (475..864): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: CDTTHDMSTFDGNSFLGGDVSVGGPTETTLWNIW
Nearest Stachelhaus code(s):: Cys DMFNFGVLWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_FNDV01000003.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 188,852 - 210,078 nt. (total: 21,227 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BLR56_RS10600: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

Transferases: methyltransferase

BLR56_RS10635: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

BLR56_RS10665: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: cyclase

BLR56_RS10630: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002260.3	0.46	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0001660.3	0.40	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0002285.2	0.39	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001684.3	0.38	other (other)	N-acyloxyacyl glutamine	Klebsiella variicola
BGC0001387.5	0.37	other (other)	nucleocidin	Streptomyces calvus
BGC0000488.4	0.37	ribosomal	circularin A	Clostridium beijerinckii
BGC0001343.3	0.36	PKS	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002260.3	0.46	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0001660.3	0.40	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0002285.2	0.39	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001684.3	0.38	other (other)	N-acyloxyacyl glutamine	Klebsiella variicola
BGC0001387.5	0.37	other (other)	nucleocidin	Streptomyces calvus
BGC0000488.4	0.37	ribosomal	circularin A	Clostridium beijerinckii
BGC0001343.3	0.36	PKS	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

BLR56_RS10630: T1TS

Domain 1 (51 - 402): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

Additional weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.63 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.78 out of 27.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.16 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_FNDV01000003.1 - Region 2 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 314,872 - 448,401 nt. (total: 133,530 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BLR56_RS11225: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BLR56_RS11255: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

BLR56_RS11265: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase aminotransferase halogenase

BLR56_RS11260: aminotransferase

smcogs: SMCOG1019: aminotransferase

BLR56_RS11285: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
MITE: MITE0000030Halogenation (identity: 65.00%)
smcogs: SMCOG1119: halogenase

BLR56_RS11415: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

BLR56_RS11425: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: esterase hydrolase

BLR56_RS11270: thioesterase

smcogs: SMCOG1004: thioesterase

BLR56_RS11320: thioesterase

smcogs: SMCOG1004: thioesterase

BLR56_RS11340: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

BLR56_RS11365: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

BLR56_RS11405: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

BLR56_RS11470: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase

BLR56_RS11195: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS11215: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS11275: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS11300: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BLR56_RS11360: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS11430: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS11475: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS11480: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

BLR56_RS11140: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

BLR56_RS11175: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	1.18	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	1.16	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	1.15	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	1.15	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	1.13	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.12	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.08	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	1.05	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	1.05	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	1.04	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.76	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.76	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.75	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001166.5	0.73	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.40 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.28 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.31 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

Additional weak hits (28):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.09 out of 31.73

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.98 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.33 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.72 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.67 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.78 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.56 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.33 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.43 out of 29.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.99 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.35 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.45 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.79 out of 28.14

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.78 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.40 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.92 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.20 out of 33.14

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.38 out of 27.04

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.23 out of 24.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.44 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.52 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.50 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.22 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.68 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.60 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.57 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 314871 - 448401:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Trp) + (Cys) + (Cys) + (Leu - Ser) + (D-Orn - Orn - D-X - X - D-X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 314871 - 356635:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Trp) + (Cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 333454 - 381949:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Trp) + (Cys) + (Cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 381540 - 448401:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - Ser) + (D-Orn - Orn - D-X - X - D-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BLR56_RS11195: NH2

CAL_domain (42..461): NH2

minowa: NH2

Prediction, score:

NH2: 82.6
AHBA: 13.9
fatty_acid: 12.8
Acetyl-CoA: 3.6
shikimic_acid: 0.0

BLR56_RS11215: Trp

Search NORINE for peptide: strict or relaxed

AMP-binding (4..401): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTQAFDAWFWDLVLTSTGDLNGYGPTEVTVGASI
Nearest Stachelhaus code(s):: Trp DAWVMTGVGK (85% 8Å match); Kyn DAWTTTGVGK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

BLR56_RS11275: X

AMP-binding (31..433): X

nrpys: diOH-Bz, Sal

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NACNAALGCPGGALQVGSSMNVYGIGEGLITSTR
Nearest Stachelhaus code(s):: diOH-Bz or Sal TLPAQGVIAK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

BLR56_RS11295: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (554..949): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDLSFDLSVYDGNTLLSGDVAAGGATEAAIWSNS
Nearest Stachelhaus code(s):: Cys DLYNLSAIWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

BLR56_RS11300: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (545..942): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDIAFDLSVYDGNSLLSGDISLGGATEAAIWSNY
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

BLR56_RS11360: fatty_acid

CAL_domain (41..466): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 23.9
NH2: 14.6
Acetyl-CoA: 2.5
AHBA: 0.1
shikimic_acid: 0.0

BLR56_RS11430: NH2

CAL_domain (158..479): NH2

minowa: NH2

Prediction, score:

NH2: 67.0
Acetyl-CoA: 36.0
fatty_acid: 29.9
AHBA: 11.7
shikimic_acid: 0.0

BLR56_RS11475: Leu - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (10..376): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAESFDASVLEMLIVVGGDVNAYGPTESTVVSTW
Nearest Stachelhaus code(s):: Leu DALLVGAVVK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1942..2315): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWTTFDVSVWEWHFLCSGEHNLYGPTEASVDVTH
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

BLR56_RS11480: Orn - Orn - X - X - X

Search NORINE for peptide: strict or relaxed

AMP-binding (494..865): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHAFDTSWEGLDLMLGGEYNFYGPTEVTVDALS
Nearest Stachelhaus code(s):: Orn DTEDMGFVDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1957..2328): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDHAFDTAIEGFDLMLGGEVNYYGPTECSVDATV
Nearest Stachelhaus code(s):: Orn DTEDMGYVDK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2946..3312): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHQSFDTAVEGFDVTLGGEVNLYGPTEVTVDATW
Nearest Stachelhaus code(s):: Orn DTEDMGLVDK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4359..4733): X

nrpys: Leu, 3OH-Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAESFDASVLEVLIIVGGDINAYGPTESTVVATW
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (85% 8Å match); Leu DALLIGAVVK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5358..5835): X

nrpys: Leu, 3OH-Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAESFDASMLEMLIIVGGDVNAYGPTESTVVATW
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (88% 8Å match); Leu DALLIGAVVK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_FNDV01000003.1 - Region 3 - NRPS,T1PKS,terpene

Download region GenBank file

Download region SVG

Location: 622,028 - 674,040 nt. (total: 52,013 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BLR56_RS12485: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BLR56_RS12495: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BLR56_RS12580: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

BLR56_RS12595: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Transferases: acyltransferase methyltransferase

BLR56_RS12530: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

BLR56_RS12630: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase peptidase

BLR56_RS12490: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

BLR56_RS12510: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

BLR56_RS12575: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase hydratase

BLR56_RS12475: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

BLR56_RS12585: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase synthetase

BLR56_RS12445: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS12455: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BLR56_RS12465: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS12535: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLR56_RS12545: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS12550: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BLR56_RS12555: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS12590: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.98	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.98	NRPS	enniatin	Fusarium equiseti
BGC0001251.4	0.98	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.98	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.97	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.95	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.95	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.94	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.92	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.91	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001251.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.67	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BLR56_RS12585: T1TS

Domain 1 (10 - 312): Type 1 terpene synthase

Subtype: unknown

BLR56_RS12590: PT_FPPS_like

Domain 1 (53 - 288): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.76 out of 23.43

Confidence: medium

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.94 out of 36.54

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.07 out of 30.98

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.20 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.40 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 622027 - 674040:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr) + (Val) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BLR56_RS12445: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (144..535): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAFDASLLEGWLFTGGDVNGYGPTENTTFTCC
Nearest Stachelhaus code(s):: Val DALWLGGTFK (82% 8Å match); bOH-Val DALWLGGTFK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

BLR56_RS12465: X

AMP-binding (7..388): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MAMLHNGIVVSTSAVCGAAVEGYGLSEATCGSTV
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

BLR56_RS12530: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (459..857): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LPTHFDFSVWEGSQVLGGEVNMYGITEGTIHVTI
Nearest Stachelhaus code(s):: Thr DFWSVGMIHK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

BLR56_RS12545: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (558..954): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAFDASTLEVWLFTGGGTNGYGPTENTTFTST
Nearest Stachelhaus code(s):: Val DALWLGGTFK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

BLR56_RS12550: mal

PKS_AT (523..811): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 101.7
Methoxymalonyl-CoA: 58.3
inactive: 48.3
Methylmalonyl-CoA: 44.7
fatty_acid: 20.1
Propionyl-CoA: 18.9
Isobutyryl-CoA: 17.5
Ethylmalonyl-CoA: 16.9
2-Methylbutyryl-CoA: 15.9
trans-1,2-CPDA: 12.8
CHC-CoA: 10.7
Benzoyl-CoA: 9.5
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BLR56_RS12555: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (148..544): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAIDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein

NZ_FNDV01000003.1 - Region 4 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 909,579 - 922,363 nt. (total: 12,785 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

BLR56_RS13665: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

BLR56_RS13680: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

BLR56_RS13690: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002285.2	0.35	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000903.3	0.34	other (other)	fluorometabolite	Streptomyces cattleya
BGC0001386.5	0.33	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0000709.5	0.31	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0001739.3	0.30	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001148.5	0.28	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0000274.5	0.28	PKS	tetarimycin A, tetarimycin B	uncultured bacterium
BGC0001819.3	0.26	PKS	Venemycin	Streptomyces venezuelae
BGC0000982.5	0.26	NRPS, PKS	cystothiazole A	Cystobacter fuscus
BGC0001066.5	0.26	PKS	kendomycin	Streptomyces violaceoruber

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002285.2	0.35	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000903.3	0.34	other (other)	fluorometabolite	Streptomyces cattleya
BGC0001386.5	0.33	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0000709.5	0.31	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0001739.3	0.30	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001148.5	0.28	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0000274.5	0.28	PKS	tetarimycin A, tetarimycin B	uncultured bacterium
BGC0001819.3	0.26	PKS	Venemycin	Streptomyces venezuelae
BGC0000982.5	0.26	NRPS, PKS	cystothiazole A	Cystobacter fuscus
BGC0001066.5	0.26	PKS	kendomycin	Streptomyces violaceoruber

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (3):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.55 out of 27.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.71 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.73 out of 30.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_FNDV01000017.1 - Region 1 - T1PKS,azole-containing-RiPP,terpene

Download region GenBank file

Download region SVG

Location: 18,801 - 118,451 nt. (total: 99,651 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Azole RiPPs

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BLR56_RS32155: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

BLR56_RS32280: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acylase transferase

BLR56_RS32110: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BLR56_RS32125: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

BLR56_RS32225: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: esterase protease

BLR56_RS32230: putative esterase

smcogs: SMCOG1104: putative esterase

BLR56_RS34165: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

BLR56_RS31975: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase

BLR56_RS32135: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLR56_RS32215: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS32220: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001181.4	0.56	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000122.5	0.37	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0001163.3	0.37	PKS	1-heptadecene	Moorea producens 3L
BGC0001161.5	0.36	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0001162.3	0.36	PKS	1-heptadecene	Moorea producens JHB
BGC0002551.2	0.33	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0000483.5	0.33	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002485.2	0.33	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000037.4	0.63	PKS	cichorine	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

BLR56_RS31975: T1TS + T1TS

Domain 1 (1 - 328): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (333 - 697): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.60 out of 29.72

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.23 out of 29.72

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.93 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.81 out of 28.19

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 23.43

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.90 out of 30.12

Confidence: medium

Additional weak hits (30):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.10 out of 25.88

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.44 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.16 out of 30.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 30.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 25.75

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.26 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.67 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.19 out of 21.55

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.71 out of 25.88

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.84 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.86 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.93 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.02 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.29 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 23.43

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.56 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.14 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.62 out of 24.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.10 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.22 out of 32.93

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.19 out of 30.98

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

Terpene

TFBS Finder

Azole RiPPs

Predicted core structure(s)

For candidate cluster 1, location 18800 - 118451:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 74571 - 118451:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BLR56_RS32110: mal

PKS_AT (323..554): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 58.3%; Ethylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 58.6
Methoxymalonyl-CoA: 43.7
Methylmalonyl-CoA: 41.1
Ethylmalonyl-CoA: 35.9
Propionyl-CoA: 22.8
inactive: 22.7
Isobutyryl-CoA: 16.0
fatty_acid: 12.8
Benzoyl-CoA: 7.1
2-Methylbutyryl-CoA: 1.2
CHC-CoA: 0.1
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BLR56_RS32215: shikimic_acid

CAL_domain (49..487): shikimic_acid

minowa: shikimic_acid

Prediction, score:

shikimic_acid: 22.2
AHBA: 21.3
fatty_acid: 19.3
NH2: 5.9
Acetyl-CoA: -1.5

BLR56_RS32220: pk

PKS_AT (601..891): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 58.3%; Ethylmalonyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 82.8
Methoxymalonyl-CoA: 74.8
Malonyl-CoA: 66.8
trans-1,2-CPDA: 50.8
Ethylmalonyl-CoA: 49.8
Propionyl-CoA: 47.0
CHC-CoA: 39.8
Isobutyryl-CoA: 39.0
fatty_acid: 38.8
2-Methylbutyryl-CoA: 33.8
inactive: 27.2
Acetyl-CoA: 25.7
3-Methylbutyryl-CoA: 21.0
Benzoyl-CoA: 16.2

Link to PARAS substrate predictor

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 10 - 107; Score: 67.1; RRE type: NHLP_CD_RRE; Location: 10 - 103; Score: 58.0; RRE type: Cyanobactin_D_RRE; Location: 9 - 86; Score: 52.0

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
NtrC	Nitrogen regulatory protein C
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

Core peptide predictions

No core peptides found.

NZ_FNDV01000002.1 - Region 1 - oligosaccharide

Download region GenBank file

Download region SVG

Location: 353,658 - 380,131 nt. (total: 26,474 nt) Show pHMM detection rules used

oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase synthase

BLR56_RS06610: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

BLR56_RS06625: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Transferases: glycosyltransferase

BLR56_RS06560: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

BLR56_RS06590: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: dehalogenase synthase

BLR56_RS06575: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

BLR56_RS06625: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000927.3	0.46	other (flavin)	roseoflavin	Streptomyces davaonensis JCM 4913
BGC0002573.2	0.44	other (other)	phosphoramidon	Streptomyces mozunensis
BGC0000277.5	0.41	PKS	urdamycin	Streptomyces fradiae
BGC0000236.5	0.41	PKS	kinamycin	Streptomyces murayamaensis
BGC0000929.3	0.38	other (other)	xanthothricin	Burkholderia glumae
BGC0001959.4	0.37	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0002152.2	0.36	other (other)	toxoflavin	Pseudomonas protegens Pf-5
BGC0001972.4	0.36	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000875.4	0.35	other (nucleoside), saccharide	caprazamycin, caprazamycin aglycon	Streptomyces sp. MK730-62F2
BGC0000219.4	0.34	PKS, saccharide	elloramycin	Streptomyces olivaceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000927.3	0.46	other (flavin)	roseoflavin	Streptomyces davaonensis JCM 4913
BGC0002573.2	0.44	other (other)	phosphoramidon	Streptomyces mozunensis
BGC0000277.5	0.41	PKS	urdamycin	Streptomyces fradiae
BGC0000236.5	0.41	PKS	kinamycin	Streptomyces murayamaensis
BGC0000929.3	0.38	other (other)	xanthothricin	Burkholderia glumae
BGC0001959.4	0.37	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0002152.2	0.36	other (other)	toxoflavin	Pseudomonas protegens Pf-5
BGC0001972.4	0.36	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000875.4	0.35	other (nucleoside), saccharide	caprazamycin, caprazamycin aglycon	Streptomyces sp. MK730-62F2
BGC0000219.4	0.34	PKS, saccharide	elloramycin	Streptomyces olivaceus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.58 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.14 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.04 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.76 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_FNDV01000002.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 929,785 - 954,806 nt. (total: 25,022 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLR56_RS09370: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: amidase

BLR56_RS09325: amidase

smcogs: SMCOG1105: amidase

Ligases: synthetase

BLR56_RS09375: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.58	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.57	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.55	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.55	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.53	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000644.3	0.49	terpene	carotenoid	Dietzia sp. CQ4
BGC0000648.3	0.48	terpene	carotenoid	Myxococcus xanthus
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000643.3	0.43	terpene	carotenoid	Brevundimonas vesicularis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.58	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.57	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.55	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.55	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.53	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000644.3	0.49	terpene	carotenoid	Dietzia sp. CQ4
BGC0000648.3	0.48	terpene	carotenoid	Myxococcus xanthus
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000643.3	0.43	terpene	carotenoid	Brevundimonas vesicularis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

BLR56_RS09360: PT_phytoene_like

Domain 1 (8 - 299): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

BLR56_RS09375: PT_FPPS_like

Domain 1 (26 - 322): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

Additional weak hits (9):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.16 out of 30.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.19 out of 29.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.12 out of 27.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.06 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.31 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.49 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.19 out of 24.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 32.93

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_FNDV01000007.1 - Region 1 - RiPP-like,terpene

Download region GenBank file

Download region SVG

Location: 220,672 - 251,033 nt. (total: 30,362 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase reductase

BLR56_RS21845: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

BLR56_RS21870: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

BLR56_RS21840: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.20	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002805.2	0.17	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0000528.5	0.16	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000866.5	0.15	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000888.5	0.15	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.14	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002115.3	0.14	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0001127.5	0.13	NRPS	jagaricin	Janthinobacterium agaricidamnosum
BGC0001184.4	0.13	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000218.5	0.12	PKS	doxorubicin	Streptomyces peucetius

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.48	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000866.5	0.45	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0002313.3	0.45	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002115.3	0.43	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0001184.4	0.43	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002584.2	0.42	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

BLR56_RS21835: Lycopene_cycl

Domain 1 (2 - 344): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (4):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.71 out of 25.75

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.47 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.92 out of 26.06

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_FNDV01000007.1 - Region 2 - hglE-KS

Download region GenBank file

Download region SVG

Location: 379,078 - 426,568 nt. (total: 47,491 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLR56_RS22550: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

BLR56_RS22595: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase glycosyltransferase

BLR56_RS22605: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BLR56_RS22620: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase

BLR56_RS22615: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

BLR56_RS22600: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLR56_RS22625: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0000056.3	0.49	PKS	esperamicin	Actinomadura verrucosospora
BGC0000861.5	0.49	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000863.3	0.49	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0002648.2	0.48	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0000056.3	0.49	PKS	esperamicin	Actinomadura verrucosospora
BGC0000861.5	0.49	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000863.3	0.49	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0002648.2	0.48	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.48 out of 29.72

Confidence: medium

Additional weak hits (12):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.29 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.61 out of 30.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.75 out of 32.74

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.97 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.79 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.97 out of 36.54

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.59 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.78 out of 23.43

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 19.26

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.32 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 379077 - 426568:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BLR56_RS22600: mal

PKS_AT (1217..1506): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 53.7
Methoxymalonyl-CoA: 25.7
Methylmalonyl-CoA: 25.2
trans-1,2-CPDA: 10.2
inactive: 8.9
Ethylmalonyl-CoA: 4.9
Propionyl-CoA: 4.8
CHC-CoA: 4.6
Isobutyryl-CoA: 4.2
fatty_acid: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BLR56_RS22605: mal

PKS_AT (137..355): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 29.7
Methylmalonyl-CoA: 17.6
inactive: 14.8
Methoxymalonyl-CoA: 11.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BLR56_RS22625: X

AMP-binding (203..590): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AVLAHSWGLVGIFVASSGSYNFYGSTEVSAGAIA
Nearest Stachelhaus code(s):: 4-ohPpa VAVFAGGAGK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_FNDV01000001.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 60,927 - 92,360 nt. (total: 31,434 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

BLR56_RS00305: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: glucanase glucosidase

BLR56_RS00320: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

BLR56_RS00410: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

BLR56_RS00425: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Lyases: decarboxylase hydratase

BLR56_RS00310: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

BLR56_RS00370: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.62	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.59	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000947.5	0.51	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001499.5	0.50	other (other)	aerobactin	Pantoea ananatis
BGC0000942.4	0.47	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002285.2	0.45	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001778.5	0.44	other (other)	showdomycin	Streptomyces showdoensis
BGC0001285.5	0.43	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.62	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.59	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000947.5	0.51	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001499.5	0.50	other (other)	aerobactin	Pantoea ananatis
BGC0000942.4	0.47	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002285.2	0.45	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001778.5	0.44	other (other)	showdomycin	Streptomyces showdoensis
BGC0001285.5	0.43	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

Additional weak hits (3):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.31 out of 26.85

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.12 out of 36.53

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_FNDV01000001.1 - Region 2 - NRPS-like,T1PKS,ectoine,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 170,632 - 281,691 nt. (total: 111,060 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

BLR56_RS00990: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BLR56_RS01010: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

BLR56_RS01105: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

BLR56_RS01170: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

BLR56_RS01185: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

BLR56_RS01200: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

BLR56_RS01230: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

BLR56_RS01250: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BLR56_RS01270: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acyltransferase aminotransferase methyltransferase sulfhydrylase

BLR56_RS01015: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

BLR56_RS01090: methyltransferase

smcogs: SMCOG1089: methyltransferase

BLR56_RS01275: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

BLR56_RS01300: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Lyases: decarboxylase dehydratase

BLR56_RS00920: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

BLR56_RS00995: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

BLR56_RS01085: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

BLR56_RS01165: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

BLR56_RS01000: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS01005: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLR56_RS01130: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BLR56_RS01195: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BLR56_RS01225: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BLR56_RS01255: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

BLR56_RS01235: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.82	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.62	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.70	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.68	NRPS	AbT1	Aureobasidium pullulans
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.67	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.87 out of 28.19

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 25.31

Confidence: medium

Additional weak hits (28):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.85 out of 31.73

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.23 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.72 out of 32.74

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.88 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.73 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.25 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.93 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.34 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.96 out of 23.43

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.47 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.95 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.52 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.72 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.33 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.58 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.85 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.82 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.06 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.22 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.75 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.93 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.61 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.96 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 170631 - 281691:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpg)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 216562 - 262394:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpg)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 239936 - 281691:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpg)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BLR56_RS01000: Acetyl-CoA

CAL_domain (36..477): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 51.8
fatty_acid: 27.3
NH2: 22.8
AHBA: 15.7
shikimic_acid: 0.0

BLR56_RS01130: mal

PKS_AT (621..849): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 72.6
Methoxymalonyl-CoA: 44.2
Methylmalonyl-CoA: 41.8
Isobutyryl-CoA: 32.7
inactive: 30.6
Propionyl-CoA: 24.4
Ethylmalonyl-CoA: 18.9
CHC-CoA: 7.8
fatty_acid: 6.4
Acetyl-CoA: 6.3
2-Methylbutyryl-CoA: 5.9
trans-1,2-CPDA: 3.6
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BLR56_RS01225: Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (9..404): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDSAFNVSTYEVHLLTGGDRAMYGATELTLFSTH
Nearest Stachelhaus code(s):: Hpg NVYHLGMLFK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

BLR56_RS01255: X

AMP-binding (10..384): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWAAFDLALLDSQAILTGDHNIYGCTETHELTTA
Nearest Stachelhaus code(s):: Ala DILQITLVYK (53% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
RpoN	Regulator of nitrogen assimilation and virulence
ZuR variant 1	Zinc-responsive repressor

NZ_FNDV01000001.1 - Region 3 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 320,362 - 341,402 nt. (total: 21,041 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BLR56_RS01485: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BLR56_RS01520: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: aminotransferase methyltransferase

BLR56_RS01515: methyltransferase

smcogs: SMCOG1089: methyltransferase

BLR56_RS01530: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

BLR56_RS01535: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Ligases: ligase synthetase

BLR56_RS01500: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

BLR56_RS01510: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001817.5	0.45	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000674.5	0.44	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0000898.5	0.44	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001529.5	0.42	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001817.5	0.45	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000674.5	0.44	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0000898.5	0.44	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001529.5	0.42	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BLR56_RS01500: PT_FPPS_like

Domain 1 (60 - 345): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.61 out of 23.43

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.53 out of 23.43

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (3):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 26.85

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.47 out of 30.97

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_FNDV01000014.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 111,294 - 121,695 nt. (total: 10,402 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BLR56_RS30385: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: aminotransferase

BLR56_RS30395: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.82	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000852.5	0.57	other (other)	ectoine	Sporosarcina pasteurii
BGC0000857.3	0.54	other (other)	ectoine	Methylophaga alcalica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.82	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000852.5	0.57	other (other)	ectoine	Sporosarcina pasteurii
BGC0000857.3	0.54	other (other)	ectoine	Methylophaga alcalica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.05 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.42 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.74 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description