GCF_900091545.1 - 19 region(s)

Download region SVG

Location: 95,305 - 116,306 nt. (total: 21,002 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GA0074695_RS00460: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase

GA0074695_RS00480: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Isomerases: mutase

GA0074695_RS00530: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthase

GA0074695_RS00455: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000889.5	0.43	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.43	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000905.5	0.39	other (other)	heme D1	Heliobacillus mobilis
BGC0002493.3	0.38	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000678.5	0.38	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000682.3	0.34	terpene	terretonin	Aspergillus terreus NIH2624
BGC0001444.5	0.34	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0000157.5	0.33	PKS	tautomycetin	Streptomyces sp. CK4412
BGC0001987.2	0.33	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0002002.3	0.32	NRPS	1,6-phenazinedimethanol, fontizine A	Serratia fonticola

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000889.5	0.43	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.43	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000905.5	0.39	other (other)	heme D1	Heliobacillus mobilis
BGC0002493.3	0.38	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000678.5	0.38	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000682.3	0.34	terpene	terretonin	Aspergillus terreus NIH2624
BGC0001444.5	0.34	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0000157.5	0.33	PKS	tautomycetin	Streptomyces sp. CK4412
BGC0001987.2	0.33	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0002002.3	0.32	NRPS	1,6-phenazinedimethanol, fontizine A	Serratia fonticola

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

GA0074695_RS00480: T1TS

Domain 1 (8 - 315): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 26.85

Confidence: medium

Additional weak hits (8):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.03 out of 26.85

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.48 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.91 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.06 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.27 out of 28.14

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.67 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_LT607411.1 - Region 2 - terpene

Download region SVG

Location: 176,736 - 197,668 nt. (total: 20,933 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

GA0074695_RS00890: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

GA0074695_RS00905: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: deacetylase hydrolase

GA0074695_RS00895: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

GA0074695_RS00920: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Lyases: hydratase

GA0074695_RS00885: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001456.3	0.48	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.48	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000645.3	0.48	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000633.3	0.47	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.47	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.46	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000650.3	0.45	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000641.3	0.44	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000640.3	0.44	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000639.3	0.44	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001456.3	0.48	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.48	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000645.3	0.48	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000633.3	0.47	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.47	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.46	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000650.3	0.45	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000641.3	0.44	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000640.3	0.44	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000639.3	0.44	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

GA0074695_RS00900: PT_phytoene_like

Domain 1 (6 - 289): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.54 out of 18.46

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 23.43 out of 23.43

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.90 out of 23.43

Confidence: medium

Additional weak hits (6):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.97 out of 23.43

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.29 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.08 out of 26.12

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.07 out of 31.73

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.70 out of 36.53

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.76 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_LT607411.1 - Region 3 - T3PKS

Download region SVG

Location: 731,601 - 772,650 nt. (total: 41,050 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GA0074695_RS03590: Hydroxylation

MITE: MITE0000081Hydroxylation (identity: 77.80%)
smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: Prenylation aminotransferase methyltransferase

GA0074695_RS03580: Prenylation

MITE: MITE0000083Prenylation (identity: 61.30%)

GA0074695_RS03585: methyltransferase

smcogs: SMCOG1089: methyltransferase

GA0074695_RS03670: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: deformylase

GA0074695_RS03555: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: synthase

GA0074695_RS03595: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002362.3	0.83	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001077.4	0.71	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0000918.3	0.57	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001896.4	0.43	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001206.5	0.43	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002554.2	0.42	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001903.3	0.41	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0001374.5	0.41	other (other)	thienodolin	Streptomyces albogriseolus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002362.3	0.83	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001077.4	0.71	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0000918.3	0.57	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001896.4	0.43	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001206.5	0.43	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002554.2	0.42	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001903.3	0.41	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0001374.5	0.41	other (other)	thienodolin	Streptomyces albogriseolus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (13):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.62 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.36 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.57 out of 20.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.19 out of 33.14

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.63 out of 27.18

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.49 out of 27.04

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.56 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.50 out of 23.43

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.83 out of 24.78

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.23 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.11 out of 32.38

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor

NZ_LT607411.1 - Region 4 - terpene-precursor

Download region SVG

Location: 1,772,879 - 1,793,946 nt. (total: 21,068 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

GA0074695_RS08545: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Ligases: synthetase

GA0074695_RS08550: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: transport

GA0074695_RS08575: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000878.5	0.42	other (other)	puromycin	Streptomyces alboniger
BGC0000616.4	0.39	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.38	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000643.3	0.37	terpene	carotenoid	Brevundimonas vesicularis
BGC0000634.3	0.37	terpene	carotenoid	Brevundimonas sp. SD212
BGC0000544.4	0.37	ribosomal	planosporicin	Planomonospora alba
BGC0001910.4	0.37	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001364.3	0.37	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000878.5	0.42	other (other)	puromycin	Streptomyces alboniger
BGC0000616.4	0.39	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.38	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000643.3	0.37	terpene	carotenoid	Brevundimonas vesicularis
BGC0000634.3	0.37	terpene	carotenoid	Brevundimonas sp. SD212
BGC0000544.4	0.37	ribosomal	planosporicin	Planomonospora alba
BGC0001910.4	0.37	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001364.3	0.37	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

GA0074695_RS08550: PT_FPPS_like

Domain 1 (41 - 353): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

Additional weak hits (8):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.07 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.00 out of 21.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.90 out of 33.73

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.18 out of 27.55

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.96 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.45 out of 24.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.13 out of 26.85

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.62 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_LT607411.1 - Region 5 - terpene-precursor

Download region SVG

Location: 2,052,314 - 2,073,396 nt. (total: 21,083 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GA0074695_RS09885: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Ligases: synthetase

GA0074695_RS09865: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.45	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.45	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.43	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.43	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000648.3	0.40	terpene	carotenoid	Myxococcus xanthus
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000644.3	0.38	terpene	carotenoid	Dietzia sp. CQ4
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0000649.3	0.38	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.45	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.45	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.43	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.43	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000648.3	0.40	terpene	carotenoid	Myxococcus xanthus
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000644.3	0.38	terpene	carotenoid	Dietzia sp. CQ4
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0000649.3	0.38	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

GA0074695_RS09865: PT_FPPS_like

Domain 1 (44 - 352): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (10):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 39.62

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.49 out of 31.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.63 out of 39.62

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.66 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.77 out of 21.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.84 out of 39.62

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.70 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.82 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.01 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_LT607411.1 - Region 6 - terpene

Download region SVG

Location: 2,129,233 - 2,150,183 nt. (total: 20,951 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

GA0074695_RS10185: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: cyclase

GA0074695_RS10200: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

GA0074695_RS10195: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002193.2	0.57	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0000660.5	0.51	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.49	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002193.2	0.57	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0000660.5	0.51	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.49	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

GA0074695_RS10200: T1TS

Domain 1 (7 - 315): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

Additional weak hits (3):

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.84 out of 36.53

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.38 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein

NZ_LT607411.1 - Region 7 - RiPP-like,terpene

Download region SVG

Location: 2,270,135 - 2,294,897 nt. (total: 24,763 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

GA0074695_RS10790: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GA0074695_RS10835: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: hydrolase

GA0074695_RS10820: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: hydratase

GA0074695_RS10775: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

GA0074695_RS10815: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001007.5	0.31	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001006.5	0.29	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0000894.4	0.24	other (other)	citrinin	Monascus aurantiacus
BGC0000594.5	0.21	ribosomal	microviridin K	Planktothrix agardhii NIVA-CYA 126/8
BGC0002473.3	0.20	NRPS	propanochelin, butanochelin, pentanochelin	Acinetobacter bouvetii DSM 14964 = CIP 107468
BGC0001910.4	0.20	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002391.2	0.20	terpene	zealexin B3, zealexin C2	Zea mays
BGC0002425.3	0.20	ribosomal	stlassin	Streptomyces sp.
BGC0001810.3	0.19	PKS	trehangelin	Polymorphospora rubra
BGC0002805.2	0.18	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001910.4	0.53	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002391.2	0.53	terpene	zealexin B3, zealexin C2	Zea mays
BGC0001911.3	0.49	terpene	raimonol	Streptomyces anulatus
BGC0001197.5	0.49	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001483.4	0.47	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001006.5	0.46	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0001007.5	0.46	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0002394.2	0.45	terpene	taxa-4(5),11(12)-diene, taxa-4(20),11(12)-diene	Taxus chinensis
BGC0000286.3	0.44	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000670.4	0.44	terpene	thalianol, thaliandiol, thalianin	Arabidopsis thaliana

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

GA0074695_RS10840: T1TS

Domain 1 (38 - 247): Type 1 terpene synthase

Subtype: unknown

GA0074695_RS10845: T2TS

Domain 1 (18 - 516): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.42 out of 26.85

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.71 out of 29.72

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

Additional weak hits (10):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.72 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.32 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.45 out of 30.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.63 out of 24.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.13 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 36.53

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.18 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.99 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT607411.1 - Region 8 - NRPS,T1PKS

Download region SVG

Location: 2,566,811 - 2,617,345 nt. (total: 50,535 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: reductase

GA0074695_RS12180: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Hydrolases: hydrolase

GA0074695_RS12155: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

GA0074695_RS12185: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GA0074695_RS12225: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GA0074695_RS12230: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GA0074695_RS12240: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

GA0074695_RS12250: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.36 out of 28.19

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.03 out of 23.43

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.15 out of 20.97

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.04 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.78 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.59 out of 28.19

Confidence: medium

Additional weak hits (50):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.71 out of 29.38

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.19 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.82 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.26 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.36 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.81 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.70 out of 32.74

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.10 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.33 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.79 out of 30.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.61 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.75 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.38 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.05 out of 28.14

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.38 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.29 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.05 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.43 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.64 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.44 out of 32.74

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.54 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.72 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.02 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.06 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.44 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.68 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.05 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.19 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.72 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.02 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.46 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.09 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.88 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.18 out of 29.38

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.51 out of 32.93

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.47 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.05 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.15 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.11 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.69 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.57 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.31 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.45 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.80 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.22 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 10, location 2566810 - 2617345:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys) + (ohmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

GA0074695_RS12225: mal

PKS_AT (517..795): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 95.7
Methylmalonyl-CoA: 52.3
Methoxymalonyl-CoA: 51.5
inactive: 41.3
Propionyl-CoA: 31.1
Ethylmalonyl-CoA: 26.2
Isobutyryl-CoA: 19.4
Benzoyl-CoA: 14.7
2-Methylbutyryl-CoA: 11.6
Acetyl-CoA: 11.0
CHC-CoA: 9.1
fatty_acid: 7.3
3-Methylbutyryl-CoA: 4.6
trans-1,2-CPDA: 2.5

GA0074695_RS12230: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (571..974): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDLSFDLSVYDANSLLSGDVSLGGATEGSIWSIC
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CcpA	Catabolite control protein A
FuR variant 1	Ferric Uptake Regulator
RpoN	Regulator of nitrogen assimilation and virulence
ZuR variant 1	Zinc-responsive repressor

NZ_LT607411.1 - Region 9 - NRPS,T1PKS

Download region SVG

Location: 2,853,458 - 2,966,247 nt. (total: 112,790 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

GA0074695_RS13460: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

GA0074695_RS13550: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

GA0074695_RS13595: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

GA0074695_RS13670: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acylase aminotransferase halogenase kinase methyltransferase

GA0074695_RS13415: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

GA0074695_RS13465: methyltransferase

smcogs: SMCOG1089: methyltransferase

GA0074695_RS13560: halogenase

smcogs: SMCOG1119: halogenase

GA0074695_RS13565: halogenase

smcogs: SMCOG1119: halogenase

GA0074695_RS13575: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

GA0074695_RS13625: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

GA0074695_RS13680: methyltransferase

smcogs: SMCOG1089: methyltransferase

GA0074695_RS13695: aminotransferase

smcogs: SMCOG1019: aminotransferase

GA0074695_RS32375: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: dehalogenase esterase hydrolase

GA0074695_RS13475: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

GA0074695_RS13505: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

GA0074695_RS13520: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

GA0074695_RS13525: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

GA0074695_RS13570: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

GA0074695_RS13675: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

GA0074695_RS13470: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GA0074695_RS13485: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GA0074695_RS13580: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

GA0074695_RS13600: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GA0074695_RS13630: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GA0074695_RS13650: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GA0074695_RS13655: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GA0074695_RS13660: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GA0074695_RS13710: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Translocases: transport

GA0074695_RS13480: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002286.3	1.06	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	1.06	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	1.04	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	1.04	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	1.02	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.02	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	1.02	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	1.02	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.99	NRPS	HC-toxin	Alternaria jesenskae
BGC0001160.5	0.86	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.51 out of 30.11

Confidence: medium

Additional weak hits (15):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.40 out of 26.12

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.45 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.85 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.43 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.63 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.38 out of 21.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.61 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.13 out of 20.97

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.23 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.60 out of 30.11

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.66 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.56 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 11, location 2853457 - 2966247:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys) + (X) + (NH2 - X) + (mal - D-X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 12, location 2853457 - 2899949:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 13, location 2893689 - 2966247:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (NH2 - X) + (mal - D-X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

GA0074695_RS13470: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (583..981): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVSFDLSVWDGNSLLSGDVSLGGATEGSIWSIF
Nearest Stachelhaus code(s):: Cys DLWNLSLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

GA0074695_RS13485: X

AMP-binding (39..474): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NAILHDMGVIGATAINGAECPMYGMAEATLAITM
Nearest Stachelhaus code(s):: Trp DMIICGCAAK (35% 8Å match); 4Me-Pro DMIFTGLPAK (26% 8Å match)
Stachelhaus code match:: 60% (weak)

GA0074695_RS13600: Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (45..423): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HMILHDLGFVCGGALNAAEMPAYGLAEGTVGVSC
Nearest Stachelhaus code(s):: Phe DLVGMAAVGK (38% 8Å match)
Stachelhaus code match:: 90% (moderate)

GA0074695_RS13625: mal

PKS_AT (34..312): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 37.7
Methoxymalonyl-CoA: 27.9
Methylmalonyl-CoA: 20.1
inactive: 18.7
Benzoyl-CoA: 12.3
Isobutyryl-CoA: 11.0
Propionyl-CoA: 8.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

GA0074695_RS13630: X

AMP-binding (468..875): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LGAHFDVSVFEGSQIFAGEVNMYGITETTVHSTY
Nearest Stachelhaus code(s):: Ser DVWSIAMVHK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

GA0074695_RS13650: NH2 - X

CAL_domain (58..497): NH2

minowa: NH2

Prediction, score:

NH2: 86.0
Acetyl-CoA: 27.1
shikimic_acid: 0.0
fatty_acid: 0.0
AHBA: -0.5

AMP-binding (1181..1581): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TQVSFDLSVWDGNSWLSGDVASGGPTETAIWCVA
Nearest Stachelhaus code(s):: Ser DLGNWSSIWK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

GA0074695_RS13655: mal - X

Search NORINE for peptide: strict or relaxed

PKS_AT (528..815): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 156.0
Methoxymalonyl-CoA: 84.6
Methylmalonyl-CoA: 72.0
inactive: 66.2
Ethylmalonyl-CoA: 49.2
Propionyl-CoA: 40.9
Isobutyryl-CoA: 35.2
fatty_acid: 32.2
2-Methylbutyryl-CoA: 30.0
Acetyl-CoA: 27.2
Benzoyl-CoA: 25.1
CHC-CoA: 24.6
trans-1,2-CPDA: 22.7
3-Methylbutyryl-CoA: 9.9

AMP-binding (1477..1746): X

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVSFDLSVYDGNSLMSGD---------------
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CelR	Cellobiose uptake repressor

NZ_LT607411.1 - Region 10 - T1PKS

Download region SVG

Location: 3,036,776 - 3,082,382 nt. (total: 45,607 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

GA0074695_RS14075: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

GA0074695_RS14185: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GA0074695_RS14235: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

GA0074695_RS14240: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

GA0074695_RS34365: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase

GA0074695_RS14155: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: hydrolase

GA0074695_RS14205: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: dehydratase hydratase

GA0074695_RS14150: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

GA0074695_RS14160: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

GA0074695_RS14180: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

GA0074695_RS14115: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GA0074695_RS14135: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GA0074695_RS14140: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

GA0074695_RS14120: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

Additional weak hits (10):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.46 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.59 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.14 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.83 out of 29.25

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 26.30 out of 32.93

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.83 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.65 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.94 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 14, location 3036775 - 3082382:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

GA0074695_RS14115: X

AMP-binding (7..425): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MVEDHELTTMQMEAVNSFDVQSWSQSENGALCIR
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

GA0074695_RS14135: fatty_acid

CAL_domain (151..467): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 20.5
NH2: 19.7
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

GA0074695_RS14140: mal

PKS_AT (620..901): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 203.7
inactive: 94.1
Methoxymalonyl-CoA: 77.2
Methylmalonyl-CoA: 68.3
Propionyl-CoA: 49.6
CHC-CoA: 38.8
Isobutyryl-CoA: 34.6
Benzoyl-CoA: 33.6
2-Methylbutyryl-CoA: 32.8
Acetyl-CoA: 28.2
trans-1,2-CPDA: 26.1
fatty_acid: 22.0
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -2.3

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT607411.1 - Region 11 - NRPS

Download region SVG

Location: 3,084,673 - 3,149,130 nt. (total: 64,458 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

GA0074695_RS14280: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

GA0074695_RS14380: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

GA0074695_RS14385: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

GA0074695_RS14410: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: acyltransferase kinase

GA0074695_RS14270: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

GA0074695_RS14355: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: peptidase protease

GA0074695_RS14310: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

GA0074695_RS14445: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: ligase

GA0074695_RS14350: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GA0074695_RS14395: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (10):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.08 out of 18.57

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.50 out of 32.74

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.28 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.12 out of 30.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.40 out of 26.12

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.19 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.95 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.25 out of 27.04

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.38 out of 26.85

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.94 out of 27.55

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 15, location 3084672 - 3149130:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala - X) + (X - X) + (Thr - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

GA0074695_RS14350: Thr - X

Search NORINE for peptide: strict or relaxed

AMP-binding (499..908): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAIHFDFSVWEGSQVFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1557..1940): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHAFDMALFELVIAVAGEFNLYGPSEYTTMSTG
Nearest Stachelhaus code(s):: Thr DMFVAGLIWK (35% 8Å match)
Stachelhaus code match:: 70% (weak)

GA0074695_RS14355: X - X

AMP-binding (476..876): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HVIAFDVSLEQTNLYLAGDICCYGPTEATITCTA
Nearest Stachelhaus code(s):: Arg DVENVGGITK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1520..1922): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HVQAFDASMDQADVSVGGDSCTYGPTEATIACTF
Nearest Stachelhaus code(s):: Arg DADDSGCVDK (47% 8Å match); Lys DADDAGTVDK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

GA0074695_RS14395: Ala - X

Search NORINE for peptide: strict or relaxed

AMP-binding (21..419): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFESSGVFAGELNIYGPTEATVYATA
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1078..1485): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: EWHSFDVSEHEAYPVQGGERNEYGPSETHGVTGD
Nearest Stachelhaus code(s):: Trp DVHEVGAVVK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT607411.1 - Region 12 - NRPS,arylpolyene

Download region SVG

Location: 3,228,843 - 3,302,851 nt. (total: 74,009 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

GA0074695_RS14820: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

GA0074695_RS14930: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GA0074695_RS15000: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acyltransferase methyltransferase

GA0074695_RS14770: methyltransferase

smcogs: SMCOG1089: methyltransferase

GA0074695_RS14775: methyltransferase

smcogs: SMCOG1089: methyltransferase

GA0074695_RS14920: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: deaminase dehalogenase

GA0074695_RS14895: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

GA0074695_RS14950: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase synthase

GA0074695_RS14850: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GA0074695_RS14855: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GA0074695_RS14860: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GA0074695_RS14885: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

GA0074695_RS14890: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

GA0074695_RS33680: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GA0074695_RS34560: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GA0074695_RS34565: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

GA0074695_RS14785: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.80	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.80	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001133.4	0.72	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002071.2	0.71	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

Additional weak hits (18):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.73 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.03 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.89 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.93 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.64 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.71 out of 39.62

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.44 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.20 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.02 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.43 out of 26.06

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.97 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.85 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 16, location 3228842 - 3302851:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala) + (D-Ser) + (D-X - Val - Ser - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 17, location 3228842 - 3269970:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala) + (D-Ser) + (D-X - Val - Ser - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 18, location 3238707 - 3302851:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala) + (D-Ser) + (D-X - Val - Ser - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

GA0074695_RS33680: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (472..872): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFEGSAVLAGEANIYGPTEATVYSTA
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

GA0074695_RS34565: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (1..411): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEASVDVTY
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

GA0074695_RS14920: X - Val - Ser - X

Search NORINE for peptide: strict or relaxed

AMP-binding (465..862): X

nrpys: 3OH-Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAISFDASVLEALIVVGGDVNAYGPTEITVAATL
Nearest Stachelhaus code(s):: 3OH-Leu DALLVGAVAK (85% 8Å match); Leu DALLVGAVAK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2000..2398): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDASTYEVWLWTGGDGDGYGPTETTTFASH
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3058..3465): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDVSVWQSEVMVTGEMNAYGPTECSDDVTH
Nearest Stachelhaus code(s):: Ser DVWEMTADDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4120..4521): X

nrpys: bMe-Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YFASFDLSVTGVKALLGGEYNMYGPTETTVNCTE
Nearest Stachelhaus code(s):: bMe-Asp DLTKLGMVNK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT607411.1 - Region 13 - NRPS,NRPS-like,T1PKS

Download region SVG

Location: 3,320,048 - 3,387,931 nt. (total: 67,884 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

GA0074695_RS15140: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

GA0074695_RS15230: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Transferases: aminotransferase methyltransferase

GA0074695_RS15145: methyltransferase

smcogs: SMCOG1089: methyltransferase

GA0074695_RS15170: methyltransferase

smcogs: SMCOG1248: methyltransferase

GA0074695_RS15190: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase hydrolase

GA0074695_RS15155: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

GA0074695_RS34190: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase

GA0074695_RS15285: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase synthase

GA0074695_RS15205: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GA0074695_RS15220: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GA0074695_RS15225: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

GA0074695_RS15240: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GA0074695_RS15245: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	1.25	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	1.22	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.18	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	1.16	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002286.3	1.14	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.12	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	1.11	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	1.10	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	1.10	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	1.10	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.88 out of 20.97

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.20 out of 23.79

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.67 out of 28.19

Confidence: medium

Additional weak hits (27):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.22 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.68 out of 29.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.63 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.48 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.98 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.83 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.54 out of 36.54

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.21 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.45 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.02 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.23 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 11.89 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.58 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.42 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.23 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.05 out of 26.06

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 19.98 out of 27.18

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.18 out of 23.43

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.85 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.21 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.07 out of 28.19

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 19, location 3320047 - 3387931:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (ccmal) + (Asn) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 20, location 3320047 - 3363551:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (ccmal) + (Asn) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 21, location 3328926 - 3387931:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (ccmal) + (Asn) + (Ser)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

GA0074695_RS15205: X

AMP-binding (6..389): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VNQAFDAAIPDPHCLLGGEVNGYGATEMTFVARY
Nearest Stachelhaus code(s):: D-bMe-Asp DARHVGIFVK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

GA0074695_RS15220: X

AMP-binding (27..414): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FGCAFDAVVIGVHLMCGGEVDTYGPTETTVTAVA
Nearest Stachelhaus code(s):: dh-Trp DAALMGAVTK (59% 8Å match); Dhpg DALSMGTVIK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

GA0074695_RS15225: mal

PKS_AT (542..825): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 160.4
inactive: 104.9
Methoxymalonyl-CoA: 65.8
Methylmalonyl-CoA: 58.5
Propionyl-CoA: 40.6
Isobutyryl-CoA: 34.8
Ethylmalonyl-CoA: 26.6
Benzoyl-CoA: 25.8
CHC-CoA: 23.8
Acetyl-CoA: 22.8
2-Methylbutyryl-CoA: 18.3
fatty_acid: 14.2
trans-1,2-CPDA: 11.2
3-Methylbutyryl-CoA: 10.3

GA0074695_RS15240: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (456..844): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTGGKVVIGGEINEYGPTEATVGCVA
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (85% 8Å match); OH-Asn or Asn DLTKVGEVGK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

GA0074695_RS15245: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (496..901): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAIDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_LT607411.1 - Region 14 - terpene

Download region SVG

Location: 3,612,002 - 3,638,048 nt. (total: 26,047 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GA0074695_RS16265: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

GA0074695_RS16290: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: dehydratase

GA0074695_RS16235: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

GA0074695_RS16270: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.60	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.60	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

GA0074695_RS16255: PT_phytoene_like

Domain 1 (8 - 267): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

GA0074695_RS16260: PT_phytoene_like

Domain 1 (9 - 286): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

GA0074695_RS16270: PT_FPPS_like

Domain 1 (52 - 330): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

GA0074695_RS16275: T2TS

Domain 1 (23 - 642): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

Additional weak hits (4):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.68 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.28 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.39 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT607411.1 - Region 15 - RRE-containing

Download region SVG

Location: 3,793,617 - 3,814,720 nt. (total: 21,104 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GA0074695_RS17145: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Hydrolases: peptidase

GA0074695_RS17140: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Isomerases: mutase

GA0074695_RS17155: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000585.5	0.47	ribosomal	microcin C7	Escherichia coli
BGC0002284.3	0.43	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000706.3	0.43	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001778.5	0.41	other (other)	showdomycin	Streptomyces showdoensis
BGC0000207.5	0.41	PKS	chartreusin	Streptomyces chartreusis
BGC0001810.3	0.37	PKS	trehangelin	Polymorphospora rubra
BGC0000312.4	0.37	NRPS	bassianolide	Beauveria bassiana
BGC0002147.2	0.34	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0002091.3	0.34	NRPS	holomycin	Yersinia ruckeri ATCC 29473
BGC0002326.2	0.34	NRPS	endopyrrole B, endopyrrole C, endopyrrole A	Mycetohabitans rhizoxinica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000585.5	0.47	ribosomal	microcin C7	Escherichia coli
BGC0002284.3	0.43	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000706.3	0.43	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001778.5	0.41	other (other)	showdomycin	Streptomyces showdoensis
BGC0000207.5	0.41	PKS	chartreusin	Streptomyces chartreusis
BGC0001810.3	0.37	PKS	trehangelin	Polymorphospora rubra
BGC0000312.4	0.37	NRPS	bassianolide	Beauveria bassiana
BGC0002147.2	0.34	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0002091.3	0.34	NRPS	holomycin	Yersinia ruckeri ATCC 29473
BGC0002326.2	0.34	NRPS	endopyrrole B, endopyrrole C, endopyrrole A	Mycetohabitans rhizoxinica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.28 out of 23.43

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (7):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.96 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.97 out of 23.43

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.62 out of 27.04

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.79 out of 25.88

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.82 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.41 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.74 out of 28.19

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 0 - 94; Score: 61.9

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
BldD	Development and antibiotic global regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT607411.1 - Region 16 - terpene

Download region SVG

Location: 4,010,082 - 4,031,335 nt. (total: 21,254 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.41	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001725.3	0.41	other (other)	oxetanocin A	Bacillus megaterium
BGC0000503.5	0.40	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002656.2	0.39	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002488.3	0.39	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002487.3	0.39	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0002346.3	0.38	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001920.4	0.38	ribosomal	siamycin I	Streptomyces sp.
BGC0001674.5	0.38	ribosomal	MS-271	Streptomyces mirabilis
BGC0002307.3	0.38	ribosomal	humidimycin	Streptomyces humidus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.41	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001725.3	0.41	other (other)	oxetanocin A	Bacillus megaterium
BGC0000503.5	0.40	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002656.2	0.39	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002488.3	0.39	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002487.3	0.39	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0002346.3	0.38	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001920.4	0.38	ribosomal	siamycin I	Streptomyces sp.
BGC0001674.5	0.38	ribosomal	MS-271	Streptomyces mirabilis
BGC0002307.3	0.38	ribosomal	humidimycin	Streptomyces humidus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

GA0074695_RS18250: Lycopene_cycl

Domain 1 (9 - 378): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.98 out of 23.79

Confidence: strong

Additional weak hits (1):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.56 out of 26.85

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_LT607411.1 - Region 17 - NRPS-like,lanthipeptide-class-i

BGC0002322.3 (CEJ66604.1):

Download region SVG

Location: 4,720,747 - 4,780,779 nt. (total: 60,033 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

GA0074695_RS21305: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

GA0074695_RS21410: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: cyclase dehydratase

GA0074695_RS21240: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

GA0074695_RS21245: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

GA0074695_RS21250: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

GA0074695_RS21400: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase

GA0074695_RS21365: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.45	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000542.3	0.31	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.31	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000515.4	0.29	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0002635.2	0.28	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001727.3	0.28	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000544.4	0.28	ribosomal	planosporicin	Planomonospora alba
BGC0000556.5	0.27	ribosomal	streptin	Streptococcus pyogenes
BGC0001210.5	0.27	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000513.3	0.26	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001289.5	0.54	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.53	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000544.4	0.49	ribosomal	planosporicin	Planomonospora alba
BGC0000556.5	0.48	ribosomal	streptin	Streptococcus pyogenes
BGC0000542.3	0.48	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.48	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001727.3	0.47	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000560.5	0.47	ribosomal	subtilomycin	Bacillus subtilis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for GA0074695_RS21245

allorf_4732303_4732509

Leader:

MKTLVPAPSNTSENPFDLDLRTLPVGTTQPI

Core:

ELAGTGACETWGGTCWTCEYSTCGFTCGGRTGRPCAC

Core with dehydrations:

ELAGDhbGACysEDhbWGGDhbCysWDhbCysEYDhaDhbCysGFDhbCysGGRDhbGRPCysACys

antiSMASH-DB 4.0 matches for allorf_4732303_4732509

100.0%

NZ_LT607411.1:

Lanthipeptides: allorf_4732303_4732509_lanthipeptide

1

ELAGTGACETWGGTCWTCEYSTCGFTCGGRTGRPCAC

37

ELAGTGACETWGGTCWTCEYSTCGFTCGGRTGRPCAC

1

ELAGTGACETWGGTCWTCEYSTCGFTCGGRTGRPCAC

37

35.1%

NZ_AP022871.1and 1 other:

NZ_AP022871.1 Lanthipeptides: Psuf_RS10930_lanthipeptide

Lanthipeptides: Psuf_RS10930_lanthipeptide

15

CWTCEYSTCGFTCGGRTGRPCAC

37

C + +TC TCGG TG PCAC

15

CVSRVNTTCMRTCGGTTGVPCAC

37

29.7%

NZ_BBYJ01000013.1:

Lanthipeptides: allorf_220397_220594_lanthipeptide

21

STCGFTCG--GRTGRPCAC

37

STC +C G+TGRPC C

12

STCASSCNSYGQTGRPCRC

30

with 6 more sequence matches

29.7%

NZ_CP071595.1:

Lanthipeptides: J3S04_RS01545_lanthipeptide

12

GGTCWTCEYSTCGFTCGGRTGRPCAC

37

G TCW+C ++CG C G P C

6

GSTCWSCNNASCG--CPITIGYPTVC

29

27.0%

NZ_CP068437.1:

Lanthipeptides: JK628_RS01375_lanthipeptide

2

LAGTGACETWGGTCWTCEYSTCGFTCG

28

+AG GA T C + + +TC CG

1

IAGAGARPTADAYCLSGKVNTCAPRCG

27

26.9%

NZ_CP059572.1:

Lanthipeptides: AGRA3207_RS24970_lanthipeptide

9

ETWGGTCWTCEYSTCGFTCGGRTGRPCAC

37

TW C S C TCG TGRPC C

25

PTWPINSCQCASSGCSHTCGA-TGRPCLC

52

23.9%

NZ_AKXV01000031.1and 1 other:

NZ_AKXV01000031.1 Lanthipeptides: Y19_RS44045_lanthipeptide

Lanthipeptides: Y19_RS44045_lanthipeptide

1

ELAGTGACETWGGTCWTCEYSTCGFTCGGRTGRP

34

EL G + +GGT W+C T T + P

5

ELVEMGEADVYGGTTWSCAIVTAVATLVSASACP

38

18.9%

NZ_CP058552.1:

Lanthipeptides: allorf_1481722_1481871_lanthipeptide

23

CGFTCGGRTGRPCA

36

C F GRT RP

7

CLFARTGRTNRPLV

20

16.7%

NZ_BMMP01000005.1and 3 others:

NZ_BMMP01000005.1 Lanthipeptides: IEY56_RS09415_lanthipeptideNZ_FMHJ01000003.1 Lanthipeptides: H181DRAFT_RS29345_lanthipeptideNZ_FMHJ01000003.1 Lanthipeptides: H181DRAFT_RS29345_lanthipeptide

Lanthipeptides: IEY56_RS09415_lanthipeptide

1

ELAGTGACETWGGTCWTC

18

EL + +GGT W C

5

ELVELSDADAYGGTAWVC

22

MIBiG 4.0 matches for allorf_4732303_4732509

21.6%

Lasso peptide: citrocin

12

GGTCWTCEYSTCGFTCGGRTGR

33

GG EY GG GR

1

GGVGKIIEY-----FIGGGVGR

17

13.5%

BGC0000503.5 (cinA):

Lanthipeptide: cinnamycin

17

TCEYSTCGFTCGGRT

31

+C + F C G T

4

SCSFGPFTFVCDGNT

18

10.8%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

14

TCWTCEYSTCGFT

26

+ CEYS+

6

SLLVCEYSSLSVV

18

with 1 more sequence matches

10.8%

BGC0001155.5 (AGY49587.1):

Thiopeptide: GE2270

22

TCGFTCG

28

CGF C

5

VCGFCCS

11

allorf_4738370_4738597

Leader:

MPLRGHGCEQAVVAVGVIDTAVTPA

Core:

CRIGEWLRIRPTTVTRSRHHCGSPPRLRTVGCLLLSLNRGRCRLAAFLRS

Core with dehydrations:

CysRIGEWLRIRPDhbDhbVDhbRDhaRHHCysGDhaPPRLRDhbVGCysLLLDhaLNRGRCysRLAAFLRDha

antiSMASH-DB 4.0 matches for allorf_4738370_4738597

100.0%

NZ_LT607411.1:

Lanthipeptides: allorf_4738370_4738597_lanthipeptide

1

CRIGEWLRIRPTTVTRSRHHCGSPPRLRTVGCLLLSLNRGRCRLAAFLRS

50

CRIGEWLRIRPTTVTRSRHHCGSPPRLRTVGCLLLSLNRGRCRLAAFLRS

1

CRIGEWLRIRPTTVTRSRHHCGSPPRLRTVGCLLLSLNRGRCRLAAFLRS

50

14.0%

NZ_CABWKH010000001.1:

Lanthipeptides: allorf_011277_011396_lanthipeptide

10

RPTTVTRSRHHCG

22

RPT T+S HC

6

RPTPATKSSSHCS

18

10.0%

NZ_JAHKNI010000008.1:

Lanthipeptides: KO481_RS24315_lanthipeptide

1

CRIGEWLRIRP

11

C +G+W RP

14

CGVGQWTHTRP

24

with 1 more sequence matches

10.0%

NZ_PGGW01000010.1and 1 other:

NZ_PGGW01000010.1 Lanthipeptides: CUT44_RS02535_lanthipeptide

Lanthipeptides: CUT44_RS02535_lanthipeptide

14

VTRSRHHCGSPPRLRTVGCL

33

+ ++ +CGS GC+

2

MNKTSDNCGSTSESACAGCI

21

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.29 out of 23.79

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.45 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.20 out of 36.53

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (11):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 39.62

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.72 out of 29.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.95 out of 36.54

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.30 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.57 out of 32.74

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.45 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.70 out of 21.55

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.85 out of 27.18

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.12 out of 36.53

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.21 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Core peptide predictions

allorf_4732303_4732509 - Class I

Cleavage pHMM score: -5.80

RODEO score: 22

Monoisotopic mass: 3650.5 Da

Molecular weight: 3653.1 Da

Number of bridges: 7

Alternative weights: (assuming N unmodified Ser/Thr residues); 3671.1 Da N = 1

allorf_4738370_4738597 - Class I

Cleavage pHMM score: -11.50

RODEO score: 15

Monoisotopic mass: 5596.1 Da

Molecular weight: 5599.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 5617.6 Da N = 1; 5635.7 Da N = 2; 5653.7 Da N = 3; 5671.7 Da N = 4

Predicted core structure(s)

For candidate cluster 25, location 4720746 - 4780779:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 27, location 4738115 - 4780779:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

GA0074695_RS21365: X

AMP-binding (15..375): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NAILYGLSVV-SAGTQAGGFVMYGQTEATARMAY
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 159 - 250; Score: 57.1

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_LT607411.1 - Region 18 - T2PKS

Download region SVG

Location: 4,913,976 - 4,986,482 nt. (total: 72,507 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

GA0074695_RS22130: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase aminotransferase carboxylase kinase transferase

GA0074695_RS22105: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

GA0074695_RS22115: aminotransferase

smcogs: SMCOG1019: aminotransferase

GA0074695_RS22240: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

GA0074695_RS22275: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

GA0074695_RS22285: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: hydrolase protease

GA0074695_RS22090: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

GA0074695_RS22125: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

GA0074695_RS22165: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

GA0074695_RS22430: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: cyclase

GA0074695_RS22270: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

GA0074695_RS22290: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

GA0074695_RS22300: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Isomerases: mutase

GA0074695_RS22085: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

GA0074695_RS22140: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GA0074695_RS22190: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

GA0074695_RS22210: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GA0074695_RS22215: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GA0074695_RS22225: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GA0074695_RS22245: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GA0074695_RS22255: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

GA0074695_RS22260: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GA0074695_RS22345: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.62	PKS	spore pigment	Streptomyces avermitilis
BGC0000275.4	0.61	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001513.3	0.60	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000261.5	0.59	PKS	R1128	Streptomyces sp. R1128
BGC0001197.5	0.58	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000215.5	0.57	PKS	curamycin	Streptomyces cyaneus
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.62	PKS	spore pigment	Streptomyces avermitilis
BGC0000275.4	0.61	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001513.3	0.60	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000261.5	0.59	PKS	R1128	Streptomyces sp. R1128
BGC0001197.5	0.58	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000215.5	0.57	PKS	curamycin	Streptomyces cyaneus
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (10):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.90 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.27 out of 30.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.90 out of 29.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.38 out of 20.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 18.99 out of 27.04

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.48 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.15 out of 35.63

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.78 out of 35.63

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

GA0074695_RS22140: X

AMP-binding (16..406): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDFS--LASGQTFVNVGAGRIVYGLSEAVVICAL
Nearest Stachelhaus code(s):: Hph or Hty DLGFTGCVNK (38% 8Å match); Hty DLGFTGCVTK (35% 8Å match); 3Me-Glu or Glu DLGKTGVVNK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

GA0074695_RS22215: X

AMP-binding (48..432): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AHLLHTATVLMQFGFNTGD----------VMTRA
Nearest Stachelhaus code(s):: Arg DALFFGLVDK (21% 8Å match)
Stachelhaus code match:: 60% (weak)

GA0074695_RS22245: X

AMP-binding (32..359): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ERYPLGLVGGLGLGTTGGEGNMYGMTEVGVIGTD
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

GA0074695_RS22345: X

AMP-binding (77..338): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SASVYGLFTGGGMVIFGAEVDIYGLSEVAVECVE
Nearest Stachelhaus code(s):: Hph or Hty DLGTIGCVIK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

Type II PKS gene cluster prediction details

Cluster section:: 4913975 to 4986482
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)

GA0074695_RS22210: CLF (Score: 269.5; E-value: 1.1e-82)
GA0074695_RS22255: CLF (Score: 494.4; E-value: 5.3e-151)
GA0074695_RS22260: KS (Score: 706.7; E-value: 2e-215)
GA0074695_RS22265: CYC C5-C18 (Score: 208.6; E-value: 6.1e-65)
GA0074695_RS22270: CYC C9-C14 (Score: 236.4; E-value: 2.3e-73)
GA0074695_RS22290: CYC C4-C21/C2-C23|C2-C19 (Score: 130.4; E-value: 5.7e-41)
GA0074695_RS22300: CYC C4-C21/C2-C23|C2-C19 (Score: 112.7; E-value: 1.7e-35)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_LT607411.1 - Region 19 - azole-containing-RiPP