GCF_028994775.1 - 8 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JAJQMN010000001.1 (Promicromonospora iranensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	T3PKS	336,978	378,087	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 1.2	terpene-precursor	489,542	510,708

NZ_JAJQMN010000017.1 (Promicromonospora iranensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	terpene	56,288	80,390	Low	carotenoid	terpene

NZ_JAJQMN010000004.1 (Promicromonospora iranensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 25.1	lassopeptide	355,300	377,725	Low	albusnodin	ribosomal:RiPP

NZ_JAJQMN010000005.1 (Promicromonospora iranensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	NI-siderophore	301,946	332,528	Low	FW0622	other:other
Region 26.2	ectoine	345,352	355,753	High	ectoine	other:ectoine

NZ_JAJQMN010000007.1 (Promicromonospora iranensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 28.1	hydrogen-cyanide	258,928	271,928	Low	aborycin	ribosomal:RiPP

NZ_JAJQMN010000008.1 (Promicromonospora iranensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 29.1	t3nrps-iterative	162,269	205,503

No secondary metabolite regions were found in these records:: NZ_JAJQMN010000010.1 (Promicromonospora iranensis); NZ_JAJQMN010000011.1 (Promicromonospora iranensis); NZ_JAJQMN010000012.1 (Promicromonospora iranensis); NZ_JAJQMN010000013.1 (Promicromonospora iranensis); NZ_JAJQMN010000014.1 (Promicromonospora iranensis); NZ_JAJQMN010000015.1 (Promicromonospora iranensis); NZ_JAJQMN010000016.1 (Promicromonospora iranensis); NZ_JAJQMN010000018.1 (Promicromonospora iranensis); NZ_JAJQMN010000019.1 (Promicromonospora iranensis); NZ_JAJQMN010000002.1 (Promicromonospora iranensis); NZ_JAJQMN010000020.1 (Promicromonospora iranensis); NZ_JAJQMN010000021.1 (Promicromonospora iranensis); NZ_JAJQMN010000022.1 (Promicromonospora iranensis); NZ_JAJQMN010000023.1 (Promicromonospora iranensis); NZ_JAJQMN010000024.1 (Promicromonospora iranensis); NZ_JAJQMN010000025.1 (Promicromonospora iranensis); NZ_JAJQMN010000026.1 (Promicromonospora iranensis); NZ_JAJQMN010000027.1 (Promicromonospora iranensis); NZ_JAJQMN010000028.1 (Promicromonospora iranensis); NZ_JAJQMN010000029.1 (Promicromonospora iranensis); NZ_JAJQMN010000003.1 (Promicromonospora iranensis); NZ_JAJQMN010000030.1 (Promicromonospora iranensis); NZ_JAJQMN010000006.1 (Promicromonospora iranensis); NZ_JAJQMN010000009.1 (Promicromonospora iranensis)

Compact view

NZ_JAJQMN010000001.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 336,978 - 378,087 nt. (total: 41,110 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

LUU90_RS01585: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

LUU90_RS01610: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

LUU90_RS01625: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

LUU90_RS01645: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

LUU90_RS01665: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

LUU90_RS01630: Methylation

MITE: MITE0000155Methylation (identity: 66.10%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Ligases: synthase

LUU90_RS01635: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.80	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001310.5	0.54	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0002127.3	0.51	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.49	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001077.4	0.47	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002362.3	0.45	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0000285.5	0.45	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000888.5	0.44	other (other)	bacilysin	Bacillus sp. CS93
BGC0001184.4	0.42	other (other)	bacilysin	Bacillus velezensis FZB42

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.80	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001310.5	0.54	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0002127.3	0.51	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.49	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001077.4	0.47	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002362.3	0.45	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0000285.5	0.45	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000888.5	0.44	other (other)	bacilysin	Bacillus sp. CS93
BGC0001184.4	0.42	other (other)	bacilysin	Bacillus velezensis FZB42

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

Additional weak hits (4):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.39 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.09 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.41 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.55 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_JAJQMN010000001.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 489,542 - 510,708 nt. (total: 21,167 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase synthetase

LUU90_RS02255: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

LUU90_RS02285: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus
BGC0001456.3	0.34	terpene	isorenieratene	Streptomyces argillaceus
BGC0001910.4	0.34	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000649.3	0.33	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000664.5	0.33	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000936.5	0.32	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1
BGC0000633.3	0.32	terpene	carotenoid	Streptomyces avermitilis
BGC0000644.3	0.31	terpene	carotenoid	Dietzia sp. CQ4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus
BGC0001456.3	0.34	terpene	isorenieratene	Streptomyces argillaceus
BGC0001910.4	0.34	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000649.3	0.33	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000664.5	0.33	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000936.5	0.32	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1
BGC0000633.3	0.32	terpene	carotenoid	Streptomyces avermitilis
BGC0000644.3	0.31	terpene	carotenoid	Dietzia sp. CQ4

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

LUU90_RS02255: PT_FPPS_like

Domain 1 (65 - 367): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (3):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.17 out of 25.88

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.45 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.47 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAJQMN010000017.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 56,288 - 80,390 nt. (total: 24,103 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

LUU90_RS23815: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: hydrolase

LUU90_RS23865: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

LUU90_RS23835: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

LUU90_RS23805: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000644.3	0.65	terpene	carotenoid	Dietzia sp. CQ4
BGC0000637.3	0.61	terpene	carotenoid	Corynebacterium glutamicum
BGC0000650.3	0.59	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000648.3	0.56	terpene	carotenoid	Myxococcus xanthus
BGC0000636.3	0.49	terpene	carotenoid	Brevibacterium linens
BGC0000664.5	0.47	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002309.2	0.46	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000643.3	0.44	terpene	carotenoid	Brevundimonas vesicularis
BGC0000649.3	0.44	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000644.3	0.65	terpene	carotenoid	Dietzia sp. CQ4
BGC0000637.3	0.61	terpene	carotenoid	Corynebacterium glutamicum
BGC0000650.3	0.59	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000648.3	0.56	terpene	carotenoid	Myxococcus xanthus
BGC0000636.3	0.49	terpene	carotenoid	Brevibacterium linens
BGC0000664.5	0.47	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002309.2	0.46	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000643.3	0.44	terpene	carotenoid	Brevundimonas vesicularis
BGC0000649.3	0.44	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

LUU90_RS23805: PT_FPPS_like

Domain 1 (43 - 342): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

LUU90_RS23810: PT_phytoene_like

Domain 1 (22 - 286): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

LUU90_RS23820: Lycopene_cycl

Domain 1 (3 - 92): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

LUU90_RS23825: Lycopene_cycl

Domain 1 (2 - 92): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.23 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.80 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.78 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_JAJQMN010000004.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 355,300 - 377,725 nt. (total: 22,426 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

LUU90_RS09285: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

LUU90_RS09265: hydrolase

smcogs: SMCOG1179: hydrolase

LUU90_RS09275: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.68	ribosomal	albusnodin	Streptomyces albus
BGC0002053.3	0.43	ribosomal	ulleungdin	Streptomyces sp.
BGC0001506.5	0.43	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002074.2	0.42	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001507.3	0.41	ribosomal	anantin C	Streptomyces olindensis
BGC0001176.4	0.40	ribosomal	streptomonomicin	Streptomonospora alba
BGC0000904.5	0.37	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0002462.3	0.36	saccharide	coformycin	Streptomyces kaniharaensis
BGC0002425.3	0.35	ribosomal	stlassin	Streptomyces sp.
BGC0001435.4	0.34	NRPS, PKS	ikarugamycin	Streptomyces sp. ZJ306

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.68	ribosomal	albusnodin	Streptomyces albus
BGC0002053.3	0.43	ribosomal	ulleungdin	Streptomyces sp.
BGC0001506.5	0.43	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002074.2	0.42	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001507.3	0.41	ribosomal	anantin C	Streptomyces olindensis
BGC0001176.4	0.40	ribosomal	streptomonomicin	Streptomonospora alba
BGC0000904.5	0.37	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0002462.3	0.36	saccharide	coformycin	Streptomyces kaniharaensis
BGC0002425.3	0.35	ribosomal	stlassin	Streptomyces sp.
BGC0001435.4	0.34	NRPS, PKS	ikarugamycin	Streptomyces sp. ZJ306

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for LUU90_RS09270

LUU90_RS09270

Leader:

MKSNTNTTEATTVEQEVIDLGDVVTLTE

Full core:

GSKKKAGTEDKRYAYR

Putative macrolactam:

GSKKKAGTE

antiSMASH-DB 4.0 matches for LUU90_RS09270

100.0%

NZ_JAJQMN010000004.1:

Lassopeptides: LUU90_RS09270_lassopeptide

1

GSKKKAGTEDKRYAYR

16

GSKKKAGTEDKRYAYR

1

GSKKKAGTEDKRYAYR

16

50.0%

NZ_CP099837.1and 1 other:

NZ_VWVS01000004.1 Lassopeptides: FYW99_RS14025_lassopeptide

Lassopeptides: NE857_RS19160_lassopeptide

1

GSKKKAGTEDKRYAYR

16

G+ ++G+EDKRY Y+

1

GTSSRSGSEDKRYKYQ

16

50.0%

NZ_JALMDK010000004.1:

Lassopeptides: MZC64_RS16090_lassopeptide

1

GSKKKAGTEDKRYAYR

16

G + ++G EDKRY Y+

1

GGQPQSGPEDKRYFYQ

16

with 2 more sequence matches

43.8%

NZ_CP095749.1and 1 other:

NZ_NDXL01000003.1 Lassopeptides: B7024_RS40450_lassopeptide

Lassopeptides: MOV08_RS20945_lassopeptide

8

TEDKRYAY

15

TEDKRY Y

7

TEDKRYQY

14

41.2%

NZ_CP009922.3and 2 others:

NZ_CP092497.1 Lassopeptides: MJQ72_RS19710_lassopeptideNZ_KB913032.1 Lassopeptides: AMYAL_RS49625_lassopeptide

Lassopeptides: SXIM_RS20210_lassopeptide

5

KAGTEDKRYAY

15

K +EDKR AY

4

KGSSEDKRRAY

14

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.40 out of 27.78

Confidence: medium

Additional weak hits (8):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.16 out of 29.51

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.33 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.39 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.81 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.09 out of 29.65

Confidence: weak

Lasso peptides

TFBS Finder

Core peptide predictions

LUU90_RS09270 - Class II: Cleavage pHMM score: 6.50; RODEO score: 20; Monoisotopic mass: 1839.0 Da; Molecular weight: 1840.0 Da; Number of bridges: 0

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAJQMN010000005.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 301,946 - 332,528 nt. (total: 30,583 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

LUU90_RS11365: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: aminotransferase

LUU90_RS11400: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase

LUU90_RS11335: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

LUU90_RS11350: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: decarboxylase

LUU90_RS11360: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.71	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0001478.5	0.66	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.64	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.62	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0002620.2	0.59	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0001453.5	0.56	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.56	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002073.3	0.55	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0000244.4	0.55	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0002464.3	0.55	other (other)	alcaligin	Bordetella pertussis Tohama I

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.71	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0001478.5	0.66	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.64	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.62	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0002620.2	0.59	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0001453.5	0.56	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.56	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002073.3	0.55	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0000244.4	0.55	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0002464.3	0.55	other (other)	alcaligin	Bordetella pertussis Tohama I

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.11 out of 23.79

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.57 out of 36.53

Confidence: medium

Additional weak hits (8):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.27 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 20.37 out of 31.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.98 out of 32.74

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.59 out of 30.98

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism

NZ_JAJQMN010000005.1 - Region 2 - ectoine

Download region GenBank file

Download region SVG

Location: 345,352 - 355,753 nt. (total: 10,402 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

LUU90_RS11500: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.81	other (other)	ectoine	Streptomyces anulatus
BGC0000852.5	0.71	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000860.3	0.60	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000855.3	0.55	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.55	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.51	other (other)	ectoine	Methylophaga alcalica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.81	other (other)	ectoine	Streptomyces anulatus
BGC0000852.5	0.71	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000860.3	0.60	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000855.3	0.55	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.55	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.51	other (other)	ectoine	Methylophaga alcalica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (1):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.80 out of 26.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_JAJQMN010000007.1 - Region 1 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 258,928 - 271,928 nt. (total: 13,001 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

LUU90_RS15280: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

LUU90_RS15290: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

LUU90_RS15305: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

LUU90_RS15310: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.36	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000844.5	0.36	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001151.5	0.34	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0000843.5	0.33	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001909.3	0.32	PKS	strobilurin A	Strobilurus tenacellus
BGC0001617.3	0.31	terpene	hirsutene	Stereum hirsutum FP-91666 SS1
BGC0002070.3	0.31	PKS	SEK90, pentangumycin	Saccharothrix espanaensis DSM 44229
BGC0002081.3	0.29	PKS	streptoketide A, streptoketide B, streptoketide C, S2502, S2507, UWM5	Streptomyces sp. Tue6314
BGC0000893.5	0.29	NRPS	chloramphenicol	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.36	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000844.5	0.36	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001151.5	0.34	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0000843.5	0.33	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001909.3	0.32	PKS	strobilurin A	Strobilurus tenacellus
BGC0001617.3	0.31	terpene	hirsutene	Stereum hirsutum FP-91666 SS1
BGC0002070.3	0.31	PKS	SEK90, pentangumycin	Saccharothrix espanaensis DSM 44229
BGC0002081.3	0.29	PKS	streptoketide A, streptoketide B, streptoketide C, S2502, S2507, UWM5	Streptomyces sp. Tue6314
BGC0000893.5	0.29	NRPS	chloramphenicol	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.60 out of 23.79

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.92 out of 29.65

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.97 out of 24.78

Confidence: medium

Additional weak hits (4):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.26 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.94 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response

NZ_JAJQMN010000008.1 - Region 1 - t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 162,269 - 205,503 nt. (total: 43,235 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

LUU90_RS16695: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: aminotransferase glycosyltransferase

LUU90_RS16590: sugar transferase

smcogs: SMCOG1146: sugar transferase

LUU90_RS16665: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

LUU90_RS16685: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

LUU90_RS16700: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: esterase

LUU90_RS16570: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Lyases: decarboxylase dehydratase

LUU90_RS16605: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

LUU90_RS16690: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

LUU90_RS16610: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

LUU90_RS16630: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

LUU90_RS16660: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000898.5	0.54	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0001651.3	0.53	other (other)	legionaminic acid	Tannerella forsythia 92A2
BGC0000791.3	0.51	saccharide	O-antigen	Cronobacter sakazakii
BGC0000899.4	0.50	saccharide	desosamine	Streptomyces narbonensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000898.5	0.54	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0001651.3	0.53	other (other)	legionaminic acid	Tannerella forsythia 92A2
BGC0000791.3	0.51	saccharide	O-antigen	Cronobacter sakazakii
BGC0000899.4	0.50	saccharide	desosamine	Streptomyces narbonensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.95 out of 23.79

Confidence: medium

Additional weak hits (18):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.34 out of 26.85

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.14 out of 32.93

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.87 out of 31.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.66 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.69 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.56 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.38 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.62 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.11 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.24 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.92 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.73 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.77 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

LUU90_RS16610: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (8..438): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GSVLFDAGLSQTTGANTGGYLMYGLTEA-FRSTY
Nearest Stachelhaus code(s):: Asp DASTATMFRK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism