GCF_028882275.1 - 17 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JARBUT010000001.1 (Nocardiopsis sp. N85)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	T1PKS	82,629	140,203

NZ_JARBUT010000010.1 (Nocardiopsis sp. N85)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	NRPS	185,520	237,617	High	coelibactin	NRPS:Type I

NZ_JARBUT010000011.1 (Nocardiopsis sp. N85)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	azole-containing-RiPP,lanthipeptide-class-v	86,686	163,357	Low	pristinin A3	ribosomal:RiPP

NZ_JARBUT010000012.1 (Nocardiopsis sp. N85)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	T1PKS	20,964	66,738	Low	uncialamycin	PKS

NZ_JARBUT010000014.1 (Nocardiopsis sp. N85)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	terpene	37,593	58,798

NZ_JARBUT010000016.1 (Nocardiopsis sp. N85)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	terpene-precursor	1	13,029
Region 8.2	butyrolactone	66,022	77,065

NZ_JARBUT010000020.1 (Nocardiopsis sp. N85)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	terpene-precursor	32,100	53,185

NZ_JARBUT010000021.1 (Nocardiopsis sp. N85)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	ectoine	87,307	97,711	Medium	ectoine	other:ectoine

NZ_JARBUT010000026.1 (Nocardiopsis sp. N85)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	lassopeptide	1	19,796

NZ_JARBUT010000031.1 (Nocardiopsis sp. N85)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 25.1	terpene-precursor	3,331	25,550

NZ_JARBUT010000033.1 (Nocardiopsis sp. N85)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 27.1	NI-siderophore	1,787	33,406	Low	nonactin/monactin/dinactin/trinactin/tetranactin	PKS

NZ_JARBUT010000004.1 (Nocardiopsis sp. N85)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 34.1	terpene	75,638	104,885	High	isorenieratene	terpene
Region 34.2	terpene-precursor	159,549	180,601
Region 34.3	lanthipeptide-class-i	236,752	262,217

NZ_JARBUT010000006.1 (Nocardiopsis sp. N85)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 43.1	lanthipeptide-class-i	9,110	33,019

NZ_JARBUT010000009.1 (Nocardiopsis sp. N85)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 46.1	NRPS	1	47,280	Low	curacomycin	NRPS:Type I

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	T1PKS	82,629	140,203
Region 2.1	NRPS	185,520	237,617	High	coelibactin	NRPS:Type I
Region 3.1	azole-containing-RiPP,lanthipeptide-class-v	86,686	163,357	Low	pristinin A3	ribosomal:RiPP
Region 4.1	T1PKS	20,964	66,738	Low	uncialamycin	PKS
Region 6.1	terpene	37,593	58,798
Region 8.1	terpene-precursor	1	13,029
Region 8.2	butyrolactone	66,022	77,065
Region 13.1	terpene-precursor	32,100	53,185
Region 14.1	ectoine	87,307	97,711	Medium	ectoine	other:ectoine
Region 19.1	lassopeptide	1	19,796
Region 25.1	terpene-precursor	3,331	25,550
Region 27.1	NI-siderophore	1,787	33,406	Low	nonactin/monactin/dinactin/trinactin/tetranactin	PKS
Region 34.1	terpene	75,638	104,885	High	isorenieratene	terpene
Region 34.2	terpene-precursor	159,549	180,601
Region 34.3	lanthipeptide-class-i	236,752	262,217
Region 43.1	lanthipeptide-class-i	9,110	33,019
Region 46.1	NRPS	1	47,280	Low	curacomycin	NRPS:Type I

No secondary metabolite regions were found in these records:: NZ_JARBUT010000013.1 (Nocardiopsis sp. N85); NZ_JARBUT010000015.1 (Nocardiopsis sp. N85); NZ_JARBUT010000017.1 (Nocardiopsis sp. N85); NZ_JARBUT010000018.1 (Nocardiopsis sp. N85); NZ_JARBUT010000019.1 (Nocardiopsis sp. N85); NZ_JARBUT010000002.1 (Nocardiopsis sp. N85); NZ_JARBUT010000022.1 (Nocardiopsis sp. N85); NZ_JARBUT010000023.1 (Nocardiopsis sp. N85); NZ_JARBUT010000024.1 (Nocardiopsis sp. N85); NZ_JARBUT010000025.1 (Nocardiopsis sp. N85); NZ_JARBUT010000027.1 (Nocardiopsis sp. N85); NZ_JARBUT010000028.1 (Nocardiopsis sp. N85); NZ_JARBUT010000029.1 (Nocardiopsis sp. N85); NZ_JARBUT010000003.1 (Nocardiopsis sp. N85); NZ_JARBUT010000030.1 (Nocardiopsis sp. N85); NZ_JARBUT010000032.1 (Nocardiopsis sp. N85); NZ_JARBUT010000034.1 (Nocardiopsis sp. N85); NZ_JARBUT010000035.1 (Nocardiopsis sp. N85); NZ_JARBUT010000036.1 (Nocardiopsis sp. N85); NZ_JARBUT010000037.1 (Nocardiopsis sp. N85); NZ_JARBUT010000038.1 (Nocardiopsis sp. N85); NZ_JARBUT010000039.1 (Nocardiopsis sp. N85); NZ_JARBUT010000040.1 (Nocardiopsis sp. N85); NZ_JARBUT010000041.1 (Nocardiopsis sp. N85); NZ_JARBUT010000042.1 (Nocardiopsis sp. N85); NZ_JARBUT010000043.1 (Nocardiopsis sp. N85); NZ_JARBUT010000044.1 (Nocardiopsis sp. N85); NZ_JARBUT010000045.1 (Nocardiopsis sp. N85); NZ_JARBUT010000046.1 (Nocardiopsis sp. N85); NZ_JARBUT010000005.1 (Nocardiopsis sp. N85); NZ_JARBUT010000007.1 (Nocardiopsis sp. N85); NZ_JARBUT010000008.1 (Nocardiopsis sp. N85)

Compact view

NZ_JARBUT010000001.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 82,629 - 140,203 nt. (total: 57,575 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

PWG71_RS00460: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

PWG71_RS00590: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

PWG71_RS00490: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PWG71_RS00495: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

PWG71_RS00500: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.69	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.69	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.23 out of 29.51

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.15 out of 29.51

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.26 out of 27.04

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.91 out of 28.19

Confidence: medium

Additional weak hits (17):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.12 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.45 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.26 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.07 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.73 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.69 out of 26.85

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.67 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.60 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.69 out of 30.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.41 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.25 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.61 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.61 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.87 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.52 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.64 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.71 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 82628 - 140203:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (Me-mal) + (Me-ccmal)
Non-colinear ordering:: PWG71_RS00490 + PWG71_RS00495 + PWG71_RS00500

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PWG71_RS00490: mmal

PKS_AT (524..828): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 196.6
Ethylmalonyl-CoA: 186.2
Methoxymalonyl-CoA: 155.5
2-Methylbutyryl-CoA: 136.2
trans-1,2-CPDA: 108.8
Propionyl-CoA: 105.2
CHC-CoA: 103.1
Malonyl-CoA: 87.5
Isobutyryl-CoA: 82.2
Benzoyl-CoA: 43.9
Acetyl-CoA: 35.3
inactive: 30.5
3-Methylbutyryl-CoA: 26.4
fatty_acid: 19.7

PWG71_RS00495: mmal

PKS_AT (563..861): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Malonyl-CoA: 87.5%; Methoxymalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 187.2
Ethylmalonyl-CoA: 180.0
Methoxymalonyl-CoA: 156.2
2-Methylbutyryl-CoA: 117.6
trans-1,2-CPDA: 114.9
Propionyl-CoA: 91.4
CHC-CoA: 80.0
Malonyl-CoA: 78.2
Isobutyryl-CoA: 61.2
Benzoyl-CoA: 49.2
Acetyl-CoA: 31.4
inactive: 24.1
3-Methylbutyryl-CoA: 11.9
fatty_acid: 11.4

PWG71_RS00500: mmal

PKS_AT (572..867): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 70.8%; Methoxymalonyl-CoA: 66.7%; Ethylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 144.3
Methoxymalonyl-CoA: 127.6
Ethylmalonyl-CoA: 126.9
2-Methylbutyryl-CoA: 94.7
Propionyl-CoA: 83.4
trans-1,2-CPDA: 77.1
CHC-CoA: 76.9
Isobutyryl-CoA: 50.8
Malonyl-CoA: 46.7
fatty_acid: 41.3
3-Methylbutyryl-CoA: 35.8
Benzoyl-CoA: 35.5
Acetyl-CoA: 32.1
inactive: 10.7

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
DosR	Hypoxia stress response regulator
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_JARBUT010000010.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 185,520 - 237,617 nt. (total: 52,098 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

PWG71_RS16270: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

PWG71_RS16325: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

PWG71_RS16390: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Hydrolases: esterase hydrolase

PWG71_RS16290: thioesterase

smcogs: SMCOG1004: thioesterase

PWG71_RS16320: isochorismatase

smcogs: SMCOG1027: isochorismatase

PWG71_RS16345: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

PWG71_RS16400: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: decarboxylase

PWG71_RS16380: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Ligases: ligase synthase

PWG71_RS16220: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

PWG71_RS16310: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PWG71_RS16315: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PWG71_RS16340: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000324.5	0.68	NRPS	coelibactin	Streptomyces coelicolor A3(2)
BGC0002493.3	0.65	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000324.5	0.68	NRPS	coelibactin	Streptomyces coelicolor A3(2)
BGC0002493.3	0.65	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.19 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.19 out of 20.97

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.42 out of 29.38

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.23 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.23 out of 20.97

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.65 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.36 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.11 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.65 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.11 out of 28.19

Confidence: medium

Additional weak hits (43):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.43 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.69 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.71 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.54 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.99 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.29 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.99 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.59 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.60 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.96 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.03 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.49 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.78 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.31 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.92 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.69 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.15 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.38 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 25.40 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.41 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.05 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.44 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 14.99 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.56 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.59 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.41 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.93 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.24 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.68 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 19.56 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.34 out of 32.74

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.37 out of 30.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.19 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.95 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.08 out of 27.18

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.34 out of 28.14

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.60 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.39 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.75 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.04 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 185519 - 237617:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Cys) + (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PWG71_RS16305: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (538..934): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVAFDLSVYDGNSLLSGDYGFGGATEGSIWSIH
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

PWG71_RS16310: X - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (550..941): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TVLAFDMSVFDANCLLGGDLALGGMTEAAIHSTL
Nearest Stachelhaus code(s):: Ser DLFNLGLIHK (79% 8Å match); Ala DMFNVGLIHK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1608..1991): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVHDGNTLVSGDVALGGATEASIWSNA
Nearest Stachelhaus code(s):: Cys DLWNLSLIWK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

PWG71_RS16315: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..439): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NASLFTMVSPGGSLQVGGSQQVFGMAEGLNNYTP
Nearest Stachelhaus code(s):: diOH-Bz TMPSQGVVNK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
FuR variant 1	Ferric Uptake Regulator
ZuR variant 1	Zinc-responsive repressor

NZ_JARBUT010000011.1 - Region 1 - azole-containing-RiPP,lanthipeptide-class-v

Download region GenBank file

Download region SVG

Location: 86,686 - 163,357 nt. (total: 76,672 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
lanthipeptide-class-v: (APH and HopA1)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

PWG71_RS16900: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

PWG71_RS17070: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: acetyltransferase methyltransferase

PWG71_RS16955: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

PWG71_RS17090: methyltransferase

smcogs: SMCOG1248: methyltransferase

Lyases: cyclase dehydratase

PWG71_RS16930: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

PWG71_RS17015: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

PWG71_RS17035: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002303.3	0.39	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0000542.3	0.29	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.29	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001579.4	0.28	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000515.4	0.28	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0001618.3	0.27	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0000506.4	0.27	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000514.5	0.27	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0000605.5	0.27	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0000527.5	0.27	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002303.3	0.56	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0001146.5	0.54	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001145.5	0.53	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001226.4	0.53	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.52	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002311.3	0.51	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0000603.5	0.51	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000606.5	0.51	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0002700.2	0.50	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002115.3	0.49	ribosomal	streptamidine	Streptomyces albidoflavus J1074

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.98 out of 23.43

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.27 out of 30.11

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.11 out of 23.43

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.75 out of 23.05

Confidence: medium

Additional weak hits (29):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.28 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.50 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.75 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.01 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.78 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.63 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.64 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.44 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.64 out of 21.55

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.61 out of 29.51

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.12 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.15 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.71 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.97 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.04 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.87 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.00 out of 23.43

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.04 out of 27.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 25.75

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.94 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.01 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.89 out of 31.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.17 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.01 out of 23.43

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.58 out of 28.14

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Lanthipeptides

RREFinder

TFBS Finder

Azole RiPPs

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 15 - 85; Score: 26.6

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
CelR	Cellobiose uptake repressor

Core peptide predictions

No core peptides found.

NZ_JARBUT010000012.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 20,964 - 66,738 nt. (total: 45,775 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

PWG71_RS17625: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: acetyltransferase acylase

PWG71_RS17535: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

PWG71_RS17615: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Lyases: hydratase

PWG71_RS17570: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000056.3	0.55	PKS	esperamicin	Actinomadura verrucosospora

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000056.3	0.55	PKS	esperamicin	Actinomadura verrucosospora

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (20):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.00 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.78 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.44 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.50 out of 32.74

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.41 out of 33.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.21 out of 21.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.18 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.37 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.19 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.45 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.79 out of 30.22

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.93 out of 36.54

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.06 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.39 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.04 out of 24.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.23 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.45 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

PWG71_RS17615: mal

PKS_AT (615..848): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 83.9
Methoxymalonyl-CoA: 46.6
Methylmalonyl-CoA: 35.7
inactive: 22.3
Isobutyryl-CoA: 18.9
Propionyl-CoA: 16.7
Acetyl-CoA: 8.2
Ethylmalonyl-CoA: 7.5
fatty_acid: 7.0
2-Methylbutyryl-CoA: 2.9
CHC-CoA: 2.2
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
OsdR	Development and stress management regulator

NZ_JARBUT010000014.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 37,593 - 58,798 nt. (total: 21,206 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

PWG71_RS19360: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

PWG71_RS19355: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Isomerases: isomerase

PWG71_RS19380: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.79	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000657.5	0.74	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0002283.2	0.48	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002554.2	0.34	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0001903.3	0.32	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0000391.5	0.30	NRPS	methylpendolmycin, pendolmycin	Marinactinospora thermotolerans
BGC0002666.2	0.28	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0001298.4	0.28	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.79	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000657.5	0.74	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0002283.2	0.48	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002554.2	0.34	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0001903.3	0.32	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0000391.5	0.30	NRPS	methylpendolmycin, pendolmycin	Marinactinospora thermotolerans
BGC0002666.2	0.28	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0001298.4	0.28	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

PWG71_RS19355: T1TS

Domain 1 (79 - 395): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.60 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

Additional weak hits (6):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.90 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.96 out of 20.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.42 out of 39.62

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.72 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.23 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_JARBUT010000016.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1 - 13,029 nt. (total: 13,029 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

PWG71_RS20535: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

PWG71_RS20540: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: dehydratase

PWG71_RS20555: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: isomerase

PWG71_RS20545: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: synthase synthetase

PWG71_RS20510: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

PWG71_RS20515: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002493.3	0.53	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0002474.2	0.52	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001444.5	0.51	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0001850.4	0.50	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001817.5	0.47	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000278.3	0.46	PKS	urdamycin	Streptomyces fradiae
BGC0000936.5	0.46	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002493.3	0.53	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0002474.2	0.52	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001444.5	0.51	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0001850.4	0.50	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001817.5	0.47	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000278.3	0.46	PKS	urdamycin	Streptomyces fradiae
BGC0000936.5	0.46	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

PWG71_RS20515: PT_FPPS_like

Domain 1 (51 - 330): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.36 out of 25.31

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 25.31

Confidence: medium

Additional weak hits (4):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.90 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.48 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.41 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_JARBUT010000016.1 - Region 2 - butyrolactone

Download region GenBank file

Download region SVG

Location: 66,022 - 77,065 nt. (total: 11,044 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

PWG71_RS20810: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Hydrolases: hydrolase

PWG71_RS20815: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Translocases: transport

PWG71_RS20805: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

PWG71_RS20830: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.75	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.57	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.51	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001458.4	0.39	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0002578.2	0.39	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002284.3	0.37	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002138.2	0.36	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0001489.3	0.35	PKS	6-hydroxymellein	Cladonia uncialis subsp. uncialis
BGC0000275.4	0.34	PKS	tetracenomycin C	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.75	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.57	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.51	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001458.4	0.39	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0002578.2	0.39	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002284.3	0.37	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002138.2	0.36	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0001489.3	0.35	PKS	6-hydroxymellein	Cladonia uncialis subsp. uncialis
BGC0000275.4	0.34	PKS	tetracenomycin C	Streptomyces glaucescens

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 29.75 out of 30.22

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

Additional weak hits (10):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.40 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.21 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.34 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.29 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.59 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.27 out of 30.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.90 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.89 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.33 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
ClgR	Caseinolytic protease gene regulator

NZ_JARBUT010000020.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 32,100 - 53,185 nt. (total: 21,086 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

PWG71_RS23015: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

PWG71_RS23030: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: carbamoyltransferase phosphorylase

PWG71_RS23025: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

PWG71_RS23075: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

Ligases: synthase synthetase

PWG71_RS23045: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

PWG71_RS23085: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001521.3	0.42	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0002343.3	0.41	other (other), ribosomal	ammosester A, ammosester B, ammosester C, ammosamaic acid cogener	Streptomyces uncialis
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0001529.5	0.40	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001521.3	0.42	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0002343.3	0.41	other (other), ribosomal	ammosester A, ammosester B, ammosester C, ammosamaic acid cogener	Streptomyces uncialis
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0001529.5	0.40	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

PWG71_RS23045: PT_FPPS_like

Domain 1 (53 - 359): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.11 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.53 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.93 out of 29.65

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.33 out of 24.78

Confidence: medium

Additional weak hits (8):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.78 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.34 out of 28.14

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.86 out of 27.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.97 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.29 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.95 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.66 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response
OsdR	Development and stress management regulator

NZ_JARBUT010000021.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 87,307 - 97,711 nt. (total: 10,405 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

PWG71_RS23745: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000853.3	0.70	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.70	other (ectoine)	ectoine	Streptomyces sp.
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000860.3	0.60	other (other)	ectoine	Methylarcula marina
BGC0000859.3	0.55	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.55	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.51	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.48	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000853.3	0.70	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.70	other (ectoine)	ectoine	Streptomyces sp.
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000860.3	0.60	other (other)	ectoine	Methylarcula marina
BGC0000859.3	0.55	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.55	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.51	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.48	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.74 out of 23.79

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.30 out of 25.31

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (7):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.81 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.26 out of 32.74

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.85 out of 30.97

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.03 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.96 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

NZ_JARBUT010000026.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1 - 19,796 nt. (total: 19,796 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

PWG71_RS25925: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase

PWG71_RS25970: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

PWG71_RS25960: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.56	ribosomal	albusnodin	Streptomyces albus
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0001184.4	0.43	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002064.2	0.42	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001307.3	0.41	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0002425.3	0.41	ribosomal	stlassin	Streptomyces sp.
BGC0001940.3	0.40	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000579.4	0.39	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083
BGC0000904.5	0.37	other (other)	FR-900098	Streptomyces rubellomurinus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.56	ribosomal	albusnodin	Streptomyces albus
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0001184.4	0.43	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002064.2	0.42	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001307.3	0.41	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0002425.3	0.41	ribosomal	stlassin	Streptomyces sp.
BGC0001940.3	0.40	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000579.4	0.39	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083
BGC0000904.5	0.37	other (other)	FR-900098	Streptomyces rubellomurinus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.16 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

Additional weak hits (5):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.83 out of 27.78

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.98 out of 29.51

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.56 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.67 out of 30.25

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.57 out of 30.98

Confidence: weak

Lasso peptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A

NZ_JARBUT010000031.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 3,331 - 25,550 nt. (total: 22,220 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: peptidase

PWG71_RS27675: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: lyase

PWG71_RS27705: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: synthetase

PWG71_RS27665: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002245.2	0.44	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5
BGC0002318.2	0.42	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000906.3	0.40	other (other)	heme D1	Heliophilum fasciatum
BGC0000905.5	0.39	other (other)	heme D1	Heliobacillus mobilis
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000903.3	0.39	other (other)	fluorometabolite	Streptomyces cattleya
BGC0001529.5	0.38	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000688.4	0.38	terpene	copalyl diphosphate	Diaporthe amygdali
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002245.2	0.44	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5
BGC0002318.2	0.42	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000906.3	0.40	other (other)	heme D1	Heliophilum fasciatum
BGC0000905.5	0.39	other (other)	heme D1	Heliobacillus mobilis
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000903.3	0.39	other (other)	fluorometabolite	Streptomyces cattleya
BGC0001529.5	0.38	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000688.4	0.38	terpene	copalyl diphosphate	Diaporthe amygdali
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

PWG71_RS27665: PT_FPPS_like

Domain 1 (422 - 720): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 25.46 out of 29.51

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.04 out of 20.97

Confidence: medium

Additional weak hits (9):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.46 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.33 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.60 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.88 out of 21.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.21 out of 27.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.52 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.04 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.85 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
DosR	Hypoxia stress response regulator

NZ_JARBUT010000033.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 1,787 - 33,406 nt. (total: 31,620 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

PWG71_RS28165: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Lyases: decarboxylase

PWG71_RS28150: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

PWG71_RS28160: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.67	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0001478.5	0.64	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.62	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.61	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0002073.3	0.60	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001499.5	0.58	other (other)	aerobactin	Pantoea ananatis
BGC0001713.5	0.57	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0000947.5	0.57	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000295.5	0.56	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001531.5	0.55	other (other)	bisucaberin B	Tenacibaculum mesophilum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.67	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0001478.5	0.64	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.62	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.61	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0002073.3	0.60	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001499.5	0.58	other (other)	aerobactin	Pantoea ananatis
BGC0001713.5	0.57	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0000947.5	0.57	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000295.5	0.56	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001531.5	0.55	other (other)	bisucaberin B	Tenacibaculum mesophilum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.71 out of 36.53

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.67 out of 20.01

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.93 out of 23.79

Confidence: medium

Additional weak hits (3):

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.40 out of 36.53

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.83 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.76 out of 26.85

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
ArgR	Regulator of arginine biosynthesis genes
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_JARBUT010000004.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 75,638 - 104,885 nt. (total: 29,248 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

PWG71_RS07785: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

PWG71_RS07815: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

PWG71_RS07780: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: transport

PWG71_RS07840: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.74	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.68	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.68	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.65	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.65	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000656.5	0.55	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000640.3	0.51	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000630.3	0.51	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.74	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.68	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.68	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.65	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.65	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000656.5	0.55	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000640.3	0.51	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000630.3	0.51	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

PWG71_RS07780: PT_FPPS_like

Domain 1 (66 - 358): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

PWG71_RS07790: PT_phytoene_like

Domain 1 (18 - 310): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

PWG71_RS07820: Lycopene_cycl

Domain 1 (5 - 380): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 22.37 out of 23.79

Confidence: strong

Additional weak hits (16):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.16 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.57 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.00 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.35 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.28 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.03 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.15 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.26 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.01 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.99 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.48 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.63 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.07 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.19 out of 29.25

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JARBUT010000004.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 159,549 - 180,601 nt. (total: 21,053 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase synthetase

PWG71_RS08135: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

PWG71_RS08175: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000643.3	0.41	terpene	carotenoid	Brevundimonas vesicularis
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001684.3	0.38	other (other)	N-acyloxyacyl glutamine	Klebsiella variicola
BGC0001660.3	0.37	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001226.4	0.37	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000639.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000643.3	0.41	terpene	carotenoid	Brevundimonas vesicularis
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001684.3	0.38	other (other)	N-acyloxyacyl glutamine	Klebsiella variicola
BGC0001660.3	0.37	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001226.4	0.37	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000639.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

PWG71_RS08175: PT_FPPS_like

Domain 1 (48 - 348): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.23 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.36 out of 28.19

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

Additional weak hits (18):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.93 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.77 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.24 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.81 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.50 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.41 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.58 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.05 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.80 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.26 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.52 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.23 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.28 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.99 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.43 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.80 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.13 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.65 out of 27.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_JARBUT010000004.1 - Region 3 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 236,752 - 262,217 nt. (total: 25,466 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

PWG71_RS08475: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

PWG71_RS08480: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001289.5	0.47	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.45	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0002120.3	0.37	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000529.5	0.36	ribosomal	microbisporicin A2	Microbispora corallina
BGC0001513.3	0.33	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001366.5	0.32	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0002294.3	0.31	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0000877.5	0.30	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0001387.5	0.29	other (other)	nucleocidin	Streptomyces calvus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001289.5	0.47	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.45	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0002120.3	0.37	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000529.5	0.36	ribosomal	microbisporicin A2	Microbispora corallina
BGC0001513.3	0.33	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001366.5	0.32	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0002294.3	0.31	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0000877.5	0.30	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0001387.5	0.29	other (other)	nucleocidin	Streptomyces calvus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.50 out of 24.78

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (18):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.77 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.85 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.40 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.52 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.52 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.66 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.50 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.42 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.67 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.42 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.61 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.50 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.84 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.82 out of 27.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.30 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.61 out of 31.73

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 159 - 254; Score: 64.9

TFBS definitions

Regulator	Description
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_JARBUT010000006.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 9,110 - 33,019 nt. (total: 23,910 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

PWG71_RS10405: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

PWG71_RS10410: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.74	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.51	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0000544.4	0.41	ribosomal	planosporicin	Planomonospora alba
BGC0000559.4	0.40	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0002668.2	0.38	ribosomal	cesin A	Clostridium estertheticum
BGC0000529.5	0.36	ribosomal	microbisporicin A2	Microbispora corallina
BGC0002448.2	0.27	NRPS	Q6402A	Streptomyces violaceusniger
BGC0000993.4	0.25	NRPS, PKS	FR901228	Chromobacterium violaceum
BGC0000106.5	0.21	PKS	naphthomycin A	Streptomyces sp. CS

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.74	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.51	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0000544.4	0.41	ribosomal	planosporicin	Planomonospora alba
BGC0000559.4	0.40	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0002668.2	0.38	ribosomal	cesin A	Clostridium estertheticum
BGC0000529.5	0.36	ribosomal	microbisporicin A2	Microbispora corallina
BGC0002448.2	0.27	NRPS	Q6402A	Streptomyces violaceusniger
BGC0000993.4	0.25	NRPS, PKS	FR901228	Chromobacterium violaceum
BGC0000106.5	0.21	PKS	naphthomycin A	Streptomyces sp. CS

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for PWG71_RS10410

PWG71_RS10415

Leader:

MSTLLADRTDTGLVPLGRDRALRTTTTDPFDLDLRVEVPVVDQSLWSM

Core:

TNDGCGQTCQSACAPSCTDNG

Core with dehydrations:

DhbNDGCysGQDhbCysQDhaACysAPDhaCysDhbDNG

antiSMASH-DB 4.0 matches for PWG71_RS10415

100.0%

NZ_JARBUT010000006.1:

Lanthipeptides: PWG71_RS10415_lanthipeptide

1

TNDGCGQTCQSACAPSCTDNG

21

TNDGCGQTCQSACAPSCTDNG

1

TNDGCGQTCQSACAPSCTDNG

21

85.7%

NZ_JACHJO010000003.1:

Lanthipeptides: FHS13_RS04620_lanthipeptide

1

TNDGCGQTCQSACAPSCTDNG

21

TNDGCG+TCQSAC+PSCT+NG

1

TNDGCGKTCQSACSPSCTNNG

21

85.7%

NZ_KB906860.1:

Lanthipeptides: G011_RS0113190_lanthipeptide

1

TNDGCGQTCQSACAPSCTDNG

21

TNDGCGQTC+SAC PSCT NG

1

TNDGCGQTCESACTPSCTQNG

21

with 177 more sequence matches

Only the first 10 are displayed here.

81.0%

NC_018524.1and 1 other:

NC_018524.1 Lanthipeptides: B005_RS19840_lanthipeptide

Lanthipeptides: B005_RS19840_lanthipeptide

1

TNDGCGQTCQSACAPSCTDNG

21

TNDGCGQTC++AC SCTDNG

1

TNDGCGQTCETACTQSCTDNG

21

70.8%

NZ_CP051627.1and 5 others:

NZ_CP051627.1 Lanthipeptides: FOF52_RS10295_lanthipeptideNZ_CP051627.1 Lanthipeptides: FOF52_RS10295_lanthipeptideNZ_KQ950184.1 Lanthipeptides: AC529_RS15570_lanthipeptideNZ_KQ950184.1 Lanthipeptides: AC529_RS15570_lanthipeptideNZ_KQ950184.1 Lanthipeptides: AC529_RS15570_lanthipeptide

Lanthipeptides: FOF52_RS10295_lanthipeptide

1

TNDGCGQTCQSACAPSCTDNG

21

TNDGCG+TC++AC PSCTDNG

4

TNDGCGKTCETACTPSCTDNG

24

65.2%

NZ_VWVS01000013.1:

Lanthipeptides: FYW99_RS17710_lanthipeptide

1

TNDGCGQTCQSACAPSCT

18

TNDGCGQTCQ+AC SCT

1

TNDGCGQTCQTACTNSCT

18

60.9%

NZ_JACHGT010000013.1and 1 other:

NZ_JACHGT010000013.1 Lanthipeptides: HNR73_RS27205_lanthipeptide

Lanthipeptides: HNR73_RS27205_lanthipeptide

1

TNDGCGQTCQSACAPSC

17

TNDGCGQTCQSAC+ +C

6

TNDGCGQTCQSACSTTC

22

59.1%

NZ_KQ257877.1and 1 other:

NZ_KQ257877.1 Lanthipeptides: IQ64_RS44800_lanthipeptide

Lanthipeptides: IQ64_RS44800_lanthipeptide

1

TNDGCGQTCQSACAPS

16

T DGCGQTCQSAC+ S

4

TGDGCGQTCQSACSNS

19

57.1%

NZ_JADMLH010000005.1:

Lanthipeptides: IT780_RS15200_lanthipeptide

1

TNDGCGQTCQSACA

14

TNDGCG TC SACA

5

TNDGCGSTCASACA

18

56.5%

NZ_CP054916.1and 1 other:

NZ_CP054916.1 Lanthipeptides: HUT19_RS32830_lanthipeptide

Lanthipeptides: HUT19_RS32830_lanthipeptide

1

TNDGCGQTCQSACAPSC

17

T+DGCGQTCQSAC+ +C

6

TDDGCGQTCQSACSTTC

22

55.6%

NZ_BMRB01000002.1and 1 other:

NZ_CP031087.1 Lanthipeptides: Actkin_RS21245_lanthipeptide

Lanthipeptides: IEY98_RS16230_lanthipeptide

1

TNDGCGQTCQSACAPSCTD

19

+NDGCG TC SACA SCTD

6

SNDGCGHTCDSACAASCTD

24

54.5%

NZ_CP026652.1and 1 other:

NZ_CP026652.1 Lanthipeptides: C4B68_RS00400_lanthipeptide

Lanthipeptides: C4B68_RS00400_lanthipeptide

1

TNDGCGQTCQSAC

13

TNDGCG TCQSAC

6

TNDGCGSTCQSAC

18

54.5%

NZ_CP086322.1and 1 other:

NZ_CP086322.1 Lanthipeptides: K9S39_RS30905_lanthipeptide

Lanthipeptides: K9S39_RS30905_lanthipeptide

1

TNDGCGQTCQSACAPS

16

T DGCGQTC+SAC+ S

4

TGDGCGQTCESACSNS

19

MIBiG 4.0 matches for PWG71_RS10415

25.0%

BGC0000517.4 (BAB04173.1):

Lanthipeptide: haloduracin β or haloduracin α

2

NDGCGQTCQSACAPSC

17

N G T C PSC

12

NKGAYCTLTVECMPSC

27

20.0%

BGC0002110.3 (QKV49893.1):

Lanthipeptide: birimositide

2

NDGCGQTCQSACAPSC

17

N+G T C P+C

14

NNGGWCTLTKECQPNC

29

11.8%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

11

SACAPSC

17

S C P C

5

SLCTPGC

11

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.26 out of 27.78

Confidence: medium

Additional weak hits (21):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.17 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.46 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.42 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.60 out of 30.22

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.57 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.12 out of 36.53

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.87 out of 32.93

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.31 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.34 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.99 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.93 out of 27.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.25 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.87 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.32 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.53 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.86 out of 33.14

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 23.72 out of 30.12

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

PWG71_RS10415 - Class I

Cleavage pHMM score: -3.20

RODEO score: 23

Monoisotopic mass: 1941.7 Da

Molecular weight: 1943.0 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 1961.0 Da N = 1

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 147 - 238; Score: 44.7

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria

NZ_JARBUT010000009.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 47,280 nt. (total: 47,280 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

PWG71_RS14260: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

PWG71_RS14360: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: hydrolase

PWG71_RS14300: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

PWG71_RS14395: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase

PWG71_RS14305: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PWG71_RS14310: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.75 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.46 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (17):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.47 out of 20.97

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.92 out of 32.74

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.44 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.99 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.84 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.41 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.64 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.94 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.93 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.57 out of 23.43

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.19 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.17 out of 18.57

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.40 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.03 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 47280:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Phe - D-Val - Val) + (Tyr - D-Lys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PWG71_RS14305: Phe - Val - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (15..405): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LTQAFDASVFEMTLMVAGEYNGYGPTETTVCATM
Nearest Stachelhaus code(s):: Tyr DASTIAGVCK (79% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1059..1451): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDAATYEVFVLTGGESNVYGPTETTTYATT
Nearest Stachelhaus code(s):: Val or aIle DAYFLGVTFK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2557..2957): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: FDGSFDAATHETFLWTGGEVHVYGPTETTTFATC
Nearest Stachelhaus code(s):: Ile or aIle DAYFWGVTFK (85% 8Å match); Ile DAYFWGVTFK (82% 8Å match); Val DAYFWGVTFK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

PWG71_RS14310: Tyr - Lys

Search NORINE for peptide: strict or relaxed

AMP-binding (496..878): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDASVAEVTLLVAGEYNAYGPTEATVCTTM
Nearest Stachelhaus code(s):: Tyr DAATVAAVCK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1548..1945): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MAYAFDASWDPVDVTVGAEHNFYGPTENTVNSTV
Nearest Stachelhaus code(s):: Lys DADDGGFVDK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems