GCF_027942015.1 - 29 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CP115936.1 (Streptomyces goshikiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS-like,T1PKS	164,534	212,984
Region 1.2	NRPS,terpene	216,468	277,163	Low	azetidomonamide A/azetidomonamide B	NRPS:Type I
Region 1.3	lanthipeptide-class-iii,terpene	401,983	429,070
Region 1.4	NRPS,T1PKS,NAPAA,transAT-PKS,terpene	587,030	705,998	High	weishanmycin	NRPS:Type I+PKS
Region 1.5	T1PKS	711,671	902,918	High	linearmycin A/linearmycin B/linearmycin C/linearmycin C	PKS:Type I
Region 1.6	RRE-containing,azole-containing-RiPP	922,620	957,206
Region 1.7	hglE-KS,terpene-precursor,T1PKS,terpene	1,292,084	1,350,702
Region 1.8	NI-siderophore	2,802,210	2,831,991	High	desferrioxamin B/desferrioxamine E	other:other
Region 1.9	lanthipeptide-class-i	3,246,967	3,271,636
Region 1.10	lanthipeptide-class-i	3,928,654	3,953,226
Region 1.11	terpene-precursor	4,886,389	4,907,462
Region 1.12	NI-siderophore	5,446,733	5,479,752
Region 1.13	hydrogen-cyanide	5,601,088	5,614,020	Low	aborycin	ribosomal:RiPP
Region 1.14	RiPP-like	5,667,758	5,679,056	Low	14-hydroxyisochainin	PKS:Modular type I
Region 1.15	terpene	5,745,498	5,767,714
Region 1.16	terpene	6,036,136	6,063,017	Medium	hopene	terpene
Region 1.17	lanthipeptide-class-iii,lanthipeptide-class-ii	6,187,392	6,213,248
Region 1.18	T1PKS	6,407,353	6,486,947	Medium	aldgamycin J/aldgamycin K/aldgamycin P/aldgamycin E	PKS
Region 1.19	lanthipeptide-class-iii	6,518,587	6,541,223	High	SapB	ribosomal:RiPP:Lanthipeptide
Region 1.20	melanin	6,621,388	6,649,018	Low	melanin	other:other
Region 1.21	NI-siderophore,T3PKS,T2PKS	6,708,141	6,819,416	Medium	spore pigment	PKS
Region 1.22	terpene	6,821,054	6,842,091
Region 1.23	terpene-precursor	6,847,517	6,868,641
Region 1.24	NRPS	7,039,306	7,099,314	Low	leupeptin Pr/leupeptin Ac	NRPS:Type I

NZ_CP115937.1 (Streptomyces goshikiensis)

Region	Type	From	To
Region 2.1	T1PKS	79,234	125,551
Region 2.2	butyrolactone	335,730	346,701
Region 2.3	butyrolactone	385,395	396,372
Region 2.4	lanthipeptide-class-i	418,489	443,072

NZ_CP115938.1 (Streptomyces goshikiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	T1PKS,butyrolactone,NRPS-like,other,arylpolyene	47,196	159,230	Medium	neocarzinostatin	PKS:Iterative type I

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS-like,T1PKS	164,534	212,984
Region 1.2	NRPS,terpene	216,468	277,163	Low	azetidomonamide A/azetidomonamide B	NRPS:Type I
Region 1.3	lanthipeptide-class-iii,terpene	401,983	429,070
Region 1.4	NRPS,T1PKS,NAPAA,transAT-PKS,terpene	587,030	705,998	High	weishanmycin	NRPS:Type I+PKS
Region 1.5	T1PKS	711,671	902,918	High	linearmycin A/linearmycin B/linearmycin C/linearmycin C	PKS:Type I
Region 1.6	RRE-containing,azole-containing-RiPP	922,620	957,206
Region 1.7	hglE-KS,terpene-precursor,T1PKS,terpene	1,292,084	1,350,702
Region 1.8	NI-siderophore	2,802,210	2,831,991	High	desferrioxamin B/desferrioxamine E	other:other
Region 1.9	lanthipeptide-class-i	3,246,967	3,271,636
Region 1.10	lanthipeptide-class-i	3,928,654	3,953,226
Region 1.11	terpene-precursor	4,886,389	4,907,462
Region 1.12	NI-siderophore	5,446,733	5,479,752
Region 1.13	hydrogen-cyanide	5,601,088	5,614,020	Low	aborycin	ribosomal:RiPP
Region 1.14	RiPP-like	5,667,758	5,679,056	Low	14-hydroxyisochainin	PKS:Modular type I
Region 1.15	terpene	5,745,498	5,767,714
Region 1.16	terpene	6,036,136	6,063,017	Medium	hopene	terpene
Region 1.17	lanthipeptide-class-iii,lanthipeptide-class-ii	6,187,392	6,213,248
Region 1.18	T1PKS	6,407,353	6,486,947	Medium	aldgamycin J/aldgamycin K/aldgamycin P/aldgamycin E	PKS
Region 1.19	lanthipeptide-class-iii	6,518,587	6,541,223	High	SapB	ribosomal:RiPP:Lanthipeptide
Region 1.20	melanin	6,621,388	6,649,018	Low	melanin	other:other
Region 1.21	NI-siderophore,T3PKS,T2PKS	6,708,141	6,819,416	Medium	spore pigment	PKS
Region 1.22	terpene	6,821,054	6,842,091
Region 1.23	terpene-precursor	6,847,517	6,868,641
Region 1.24	NRPS	7,039,306	7,099,314	Low	leupeptin Pr/leupeptin Ac	NRPS:Type I
Region 2.1	T1PKS	79,234	125,551
Region 2.2	butyrolactone	335,730	346,701
Region 2.3	butyrolactone	385,395	396,372
Region 2.4	lanthipeptide-class-i	418,489	443,072
Region 3.1	T1PKS,butyrolactone,NRPS-like,other,arylpolyene	47,196	159,230	Medium	neocarzinostatin	PKS:Iterative type I

No secondary metabolite regions were found in these records:: NZ_CP115939.1 (Streptomyces goshikiensis); NZ_CP115940.1 (Streptomyces goshikiensis)

Compact view

NZ_CP115936.1 - Region 1 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 164,534 - 212,984 nt. (total: 48,451 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

PET44_RS01025: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Lyases: dehydratase

PET44_RS00990: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

PET44_RS00975: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.59	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001273.3	0.58	PKS	asperlactone	Aspergillus ochraceus
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001273.3	0.62	PKS	asperlactone	Aspergillus ochraceus
BGC0001268.4	0.62	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 28.31 out of 30.12

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 25.83 out of 35.63

Confidence: medium

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 28.35 out of 35.63

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.62 out of 29.72

Confidence: medium

Additional weak hits (11):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.29 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.62 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.81 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.47 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.86 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.76 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.75 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.59 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.84 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.94 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 164533 - 212984:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA - ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PET44_RS00975: AHBA - mal

CAL_domain (171..484): AHBA

minowa: AHBA

Prediction, score:

AHBA: 116.6
shikimic_acid: 68.7
fatty_acid: 0.0
NH2: 0.0
Acetyl-CoA: 0.0

PKS_AT (1208..1499): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.5
inactive: 95.6
Methoxymalonyl-CoA: 62.1
Methylmalonyl-CoA: 51.9
Isobutyryl-CoA: 41.6
Ethylmalonyl-CoA: 21.5
Propionyl-CoA: 21.0
Acetyl-CoA: 20.1
Benzoyl-CoA: 14.1
fatty_acid: 9.2
trans-1,2-CPDA: 8.0
2-Methylbutyryl-CoA: 4.1
CHC-CoA: 1.3
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
NrtR	NAD synthesis repressor
NtrC	Nitrogen regulatory protein C
OsdR	Development and stress management regulator

NZ_CP115936.1 - Region 2 - NRPS,terpene

Download region GenBank file

Download region SVG

Location: 216,468 - 277,163 nt. (total: 60,696 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

PET44_RS01180: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

PET44_RS01195: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

PET44_RS01205: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

PET44_RS01330: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

PET44_RS01360: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: acetyltransferase methyltransferase

PET44_RS01190: methyltransferase

smcogs: SMCOG1089: methyltransferase

PET44_RS01270: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

PET44_RS01370: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

PET44_RS01250: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

PET44_RS01275: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

PET44_RS01335: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase

PET44_RS01200: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PET44_RS01220: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000683.3	0.61	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001746.3	0.47	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0001181.4	0.45	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002075.3	0.42	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001873.3	0.39	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001825.4	0.37	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.37	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.36	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.35	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.35	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000683.3	0.85	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001746.3	0.77	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0001181.4	0.76	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001873.3	0.71	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

PET44_RS01335: T1TS

Domain 1 (3 - 314): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.27 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.43 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.77 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.20 out of 24.78

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.08 out of 25.31

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.08 out of 18.57

Confidence: medium

Additional weak hits (14):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 26.85

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.90 out of 33.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.82 out of 20.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.71 out of 32.74

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.90 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.30 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.87 out of 27.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.48 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.29 out of 29.65

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.84 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.12 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.59 out of 36.53

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.29 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 216467 - 277163:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - Pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 216467 - 263658:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - Pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PET44_RS01200: Ser - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (456..869): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEVNLYGPTETTVDVSS
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1522..1921): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWQAFDISFQESFLITCGEENQYGPTETHVVTAY
Nearest Stachelhaus code(s):: Pro DMQFISQVVK (85% 8Å match); Hpr DIQYIAQVVK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP115936.1 - Region 3 - lanthipeptide-class-iii,terpene

Download region GenBank file

Download region SVG

Location: 401,983 - 429,070 nt. (total: 27,088 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

PET44_RS02115: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

PET44_RS02155: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

PET44_RS02185: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: methyltransferase

PET44_RS02145: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

PET44_RS02150: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Translocases: permease

PET44_RS02140: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	0.34	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000551.5	0.34	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001910.4	0.33	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000513.3	0.33	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000518.3	0.32	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000519.4	0.31	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.31	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002111.3	0.31	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0001197.5	0.31	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000496.5	0.31	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001910.4	0.49	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002103.2	0.49	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0002700.2	0.49	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000551.5	0.48	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001483.4	0.48	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000513.3	0.47	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000518.3	0.47	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000496.5	0.47	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.46	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.46	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

PET44_RS02150: T1TS

Domain 1 (5 - 324): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.86 out of 21.84

Confidence: medium

Additional weak hits (14):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.30 out of 29.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.36 out of 32.74

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.36 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.66 out of 30.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.03 out of 25.88

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.32 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.41 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.45 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.20 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.48 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.81 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.59 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.53 out of 36.53

Confidence: weak

Lanthipeptides

Terpene

TFBS Finder

Core peptide predictions

No core peptides found.

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP115936.1 - Region 4 - NAPAA,NRPS,T1PKS,terpene,transAT-PKS

Download region GenBank file

Download region SVG

Location: 587,030 - 705,998 nt. (total: 118,969 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NAPAA: (AMP-binding and TIGR02353)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

PET44_RS03020: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

PET44_RS03025: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

PET44_RS03030: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

PET44_RS03080: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

PET44_RS03090: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

PET44_RS03100: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

PET44_RS03190: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acetyltransferase acylase methyltransferase

PET44_RS02970: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

PET44_RS03155: methyltransferase

smcogs: SMCOG1089: methyltransferase

PET44_RS03175: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

PET44_RS03195: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

PET44_RS03210: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

PET44_RS03225: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase

PET44_RS03115: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase hydratase

PET44_RS03135: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

PET44_RS03200: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

PET44_RS03230: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase

PET44_RS03035: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PET44_RS03085: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

PET44_RS03110: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PET44_RS03120: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PET44_RS03130: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

PET44_RS03140: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PET44_RS03205: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

Translocases: transport

PET44_RS03050: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	1.93	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001823.4	1.56	NRPS, PKS	weishanmycin	Streptomyces sp. CB02120-2
BGC0001132.4	1.30	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	1.30	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	1.29	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	1.28	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	1.28	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	1.25	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000658.3	1.25	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001135.5	1.21	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001823.4	0.90	NRPS, PKS	weishanmycin	Streptomyces sp. CB02120-2
BGC0000658.3	0.85	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001273.3	0.77	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002365.2	0.72	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001043.4	0.72	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001556.5	0.70	NRPS, PKS	combamide	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

PET44_RS03230: T1TS

Domain 1 (41 - 420): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 24.03 out of 25.31

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.21 out of 23.79

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.52 out of 29.72

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.53 out of 23.79

Confidence: medium

Additional weak hits (8):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.06 out of 25.88

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.51 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.08 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.62 out of 26.12

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.13 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.46 out of 30.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 8, location 587029 - 705998:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (mal - Me-ccmal - ccmal - mal) + (Cys) + (X) + (ccmal - Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PET44_RS03035: mal - Orn

Search NORINE for peptide: strict or relaxed

PKS_AT (550..852): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; CE-Malonyl-CoA: 54.2%; Acetyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 108.8
Methylmalonyl-CoA: 106.4
Methoxymalonyl-CoA: 102.0
Ethylmalonyl-CoA: 73.4
Isobutyryl-CoA: 67.6
Propionyl-CoA: 60.2
2-Methylbutyryl-CoA: 56.0
Acetyl-CoA: 52.5
CHC-CoA: 48.4
trans-1,2-CPDA: 48.3
fatty_acid: 47.1
Benzoyl-CoA: 36.2
3-Methylbutyryl-CoA: 32.1
inactive: 28.5

AMP-binding (2336..2753): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LAWAFDVFTGDREFIVGSDINSYGLTEATVDSAC
Nearest Stachelhaus code(s):: Orn DVGEIGSVDK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

PET44_RS03070: X

AMP-binding (46..421): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

PET44_RS03110: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (968..1373): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDLSVFDGNSFLSGDVSLGGATEAAVWSNY
Nearest Stachelhaus code(s):: Cys DLFNFSLVWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

PET44_RS03140: D-Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (17..413): D-Ala

nrpys: D-Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FTAYFDLSMSELHAVFCGEDNLYGPTEASVACTG
Nearest Stachelhaus code(s):: D-Ala DLSHVCLVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

PET44_RS03175: mal

PKS_AT (4..284): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 102.7
inactive: 43.6
Methylmalonyl-CoA: 30.0
Methoxymalonyl-CoA: 27.6
Propionyl-CoA: 20.2
Acetyl-CoA: 17.5
fatty_acid: 17.1
Isobutyryl-CoA: 15.0
Benzoyl-CoA: 8.5
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PET44_RS03195: mal

PKS_AT (6..279): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 61.1
Methoxymalonyl-CoA: 43.4
Propionyl-CoA: 34.7
Methylmalonyl-CoA: 32.4
fatty_acid: 30.4
inactive: 27.5
2-Methylbutyryl-CoA: 21.8
CHC-CoA: 20.7
trans-1,2-CPDA: 13.9
Ethylmalonyl-CoA: 12.8
Benzoyl-CoA: 12.8
Isobutyryl-CoA: 10.3
Acetyl-CoA: 7.8
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C

NZ_CP115936.1 - Region 5 - T1PKS

Download region GenBank file

Download region SVG

Location: 711,671 - 902,918 nt. (total: 191,248 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

PET44_RS03380: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

PET44_RS03405: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

PET44_RS03460: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

PET44_RS03470: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: PPTase acylase transferase

PET44_RS03325: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

PET44_RS03340: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

PET44_RS03360: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

PET44_RS03375: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

PET44_RS03390: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase

PET44_RS03355: thioesterase

smcogs: SMCOG1004: thioesterase

PET44_RS03455: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

PET44_RS03350: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PET44_RS03385: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PET44_RS03395: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PET44_RS03400: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PET44_RS03410: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PET44_RS03415: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PET44_RS03420: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002072.3	0.99	PKS	linearmycin A, linearmycin B, linearmycin C, linearmycin C	Streptomyces sp. Mg1
BGC0002355.2	0.81	PKS, other (other)	tetrafibricin	Streptomyces neyagawaensis
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002357.3	0.72	PKS, other (other)	neomediomycin B	Streptomyces sp. RK95-74
BGC0000052.5	0.71	PKS	ECO-02301	Streptomyces aizunensis
BGC0002356.3	0.69	PKS, other (other)	mediomycin A	Streptomyces blastmyceticus
BGC0001662.4	0.69	PKS	mediomycin A	Kitasatospora mediocidica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002072.3	0.99	PKS	linearmycin A, linearmycin B, linearmycin C, linearmycin C	Streptomyces sp. Mg1
BGC0002355.2	0.81	PKS, other (other)	tetrafibricin	Streptomyces neyagawaensis
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002357.3	0.72	PKS, other (other)	neomediomycin B	Streptomyces sp. RK95-74
BGC0000052.5	0.71	PKS	ECO-02301	Streptomyces aizunensis
BGC0002356.3	0.69	PKS, other (other)	mediomycin A	Streptomyces blastmyceticus
BGC0001662.4	0.69	PKS	mediomycin A	Kitasatospora mediocidica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.40 out of 26.85

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.90 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.83 out of 26.33

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.68 out of 30.12

Confidence: medium

Additional weak hits (16):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.27 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.16 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.30 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.09 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.49 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.12 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.87 out of 39.62

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.84 out of 32.74

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.34 out of 26.12

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.68 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 24.44 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.32 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.08 out of 32.38

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 10, location 711670 - 902918:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - ohmal - ccmal - ohmal - ccmal - ohmal - ohmal) + (ccmal - ohmal) + (ccmal - ohmal - ohmal - ccmal) + (Me-ohmal) + (ohmal - ccmal - ccmal) + (ccmal - ccmal - ccmal) + (Me-ohmal - Me-ohmal) + (ccmal - redmal - ccmal - ccmal) + (ccmal - ccmal - Me-ccmal)
Non-colinear ordering:: PET44_RS03420 + PET44_RS03415 + PET44_RS03410 + PET44_RS03405 + PET44_RS03400 + PET44_RS03395 + PET44_RS03390 + PET44_RS03385 + PET44_RS03380

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PET44_RS03350: X

AMP-binding (15..371): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NRNLHQYGLSMIDACVGAALDSYGSTELGNISFA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

PET44_RS03375: pk

PKS_AT (34..269): pk

ATSignature: (unknown)

No matches above 50%

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PET44_RS03380: mal - mal - mmal

PKS_AT (584..874): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 235.1
inactive: 104.3
Methoxymalonyl-CoA: 63.1
Methylmalonyl-CoA: 56.9
Propionyl-CoA: 37.0
Benzoyl-CoA: 24.7
Ethylmalonyl-CoA: 20.7
Acetyl-CoA: 19.5
Isobutyryl-CoA: 17.7
trans-1,2-CPDA: 14.9
CHC-CoA: 12.6
fatty_acid: 11.8
2-Methylbutyryl-CoA: 10.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (2316..2602): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 224.8
inactive: 105.8
Methoxymalonyl-CoA: 62.6
Methylmalonyl-CoA: 52.6
Propionyl-CoA: 31.9
Benzoyl-CoA: 22.4
Isobutyryl-CoA: 21.8
CHC-CoA: 19.3
Ethylmalonyl-CoA: 17.7
Acetyl-CoA: 16.8
fatty_acid: 11.6
2-Methylbutyryl-CoA: 8.6
trans-1,2-CPDA: 4.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (4038..4337): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 223.4
Ethylmalonyl-CoA: 215.7
Methoxymalonyl-CoA: 181.4
2-Methylbutyryl-CoA: 148.9
trans-1,2-CPDA: 133.6
Propionyl-CoA: 116.9
Malonyl-CoA: 113.4
CHC-CoA: 110.4
Isobutyryl-CoA: 98.0
Benzoyl-CoA: 74.9
Acetyl-CoA: 59.8
3-Methylbutyryl-CoA: 58.1
fatty_acid: 45.4
inactive: 39.5

PET44_RS03385: mal - mal - mal - mal

PKS_AT (591..889): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 223.4
inactive: 113.0
Methoxymalonyl-CoA: 72.4
Methylmalonyl-CoA: 62.8
Propionyl-CoA: 42.1
Ethylmalonyl-CoA: 33.2
Isobutyryl-CoA: 30.1
Acetyl-CoA: 28.3
Benzoyl-CoA: 24.7
trans-1,2-CPDA: 16.9
fatty_acid: 16.0
CHC-CoA: 15.6
2-Methylbutyryl-CoA: 14.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (2396..2695): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.1
inactive: 107.8
Methoxymalonyl-CoA: 57.1
Methylmalonyl-CoA: 47.0
Isobutyryl-CoA: 31.3
Propionyl-CoA: 23.8
Acetyl-CoA: 22.6
Benzoyl-CoA: 20.2
Ethylmalonyl-CoA: 16.9
CHC-CoA: 9.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (4482..4767): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 239.3
inactive: 115.3
Methoxymalonyl-CoA: 65.1
Methylmalonyl-CoA: 60.2
Propionyl-CoA: 42.4
Benzoyl-CoA: 26.9
Ethylmalonyl-CoA: 24.2
Isobutyryl-CoA: 20.7
trans-1,2-CPDA: 16.8
CHC-CoA: 16.6
Acetyl-CoA: 15.9
2-Methylbutyryl-CoA: 15.7
fatty_acid: 10.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (6208..6493): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 243.3
inactive: 113.5
Methoxymalonyl-CoA: 63.2
Methylmalonyl-CoA: 53.3
Propionyl-CoA: 40.1
Benzoyl-CoA: 23.1
Ethylmalonyl-CoA: 20.6
Isobutyryl-CoA: 16.4
Acetyl-CoA: 16.4
CHC-CoA: 15.1
trans-1,2-CPDA: 11.9
2-Methylbutyryl-CoA: 9.9
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PET44_RS03390: mmal - mmal

PKS_AT (560..859): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 225.4
Ethylmalonyl-CoA: 217.2
Methoxymalonyl-CoA: 182.0
2-Methylbutyryl-CoA: 155.0
trans-1,2-CPDA: 131.5
Propionyl-CoA: 117.9
Malonyl-CoA: 113.3
CHC-CoA: 108.0
Isobutyryl-CoA: 103.7
Benzoyl-CoA: 79.2
3-Methylbutyryl-CoA: 66.0
Acetyl-CoA: 62.5
inactive: 41.9
fatty_acid: 37.5

PKS_AT (2124..2423): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 226.5
Ethylmalonyl-CoA: 219.6
Methoxymalonyl-CoA: 183.3
2-Methylbutyryl-CoA: 159.7
trans-1,2-CPDA: 126.7
Propionyl-CoA: 115.9
Malonyl-CoA: 115.7
CHC-CoA: 109.8
Isobutyryl-CoA: 106.5
Benzoyl-CoA: 77.6
3-Methylbutyryl-CoA: 62.7
Acetyl-CoA: 61.2
inactive: 40.9
fatty_acid: 37.1

PET44_RS03395: mal - mal - mal

PKS_AT (573..861): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 235.4
inactive: 107.7
Methoxymalonyl-CoA: 59.8
Methylmalonyl-CoA: 55.1
Propionyl-CoA: 33.8
Isobutyryl-CoA: 23.8
Benzoyl-CoA: 19.3
Ethylmalonyl-CoA: 18.2
Acetyl-CoA: 15.5
CHC-CoA: 13.8
fatty_acid: 13.0
2-Methylbutyryl-CoA: 11.3
trans-1,2-CPDA: 7.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (2338..2623): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 233.6
inactive: 105.7
Methoxymalonyl-CoA: 63.3
Methylmalonyl-CoA: 56.9
Propionyl-CoA: 37.4
Ethylmalonyl-CoA: 23.7
Benzoyl-CoA: 23.5
Acetyl-CoA: 18.3
Isobutyryl-CoA: 17.9
CHC-CoA: 15.0
fatty_acid: 11.1
trans-1,2-CPDA: 10.4
2-Methylbutyryl-CoA: 7.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (4086..4371): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 231.8
inactive: 115.3
Methoxymalonyl-CoA: 72.9
Methylmalonyl-CoA: 60.7
Propionyl-CoA: 38.1
Benzoyl-CoA: 31.7
Ethylmalonyl-CoA: 21.2
Isobutyryl-CoA: 21.1
CHC-CoA: 19.4
Acetyl-CoA: 17.4
trans-1,2-CPDA: 13.8
2-Methylbutyryl-CoA: 13.4
fatty_acid: 12.1
3-Methylbutyryl-CoA: 0.0

PET44_RS03400: mal - mal - mal

PKS_AT (573..861): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 232.1
inactive: 106.6
Methoxymalonyl-CoA: 62.6
Methylmalonyl-CoA: 56.2
Propionyl-CoA: 34.9
Benzoyl-CoA: 24.0
Ethylmalonyl-CoA: 23.0
CHC-CoA: 19.9
Isobutyryl-CoA: 18.9
Acetyl-CoA: 17.0
fatty_acid: 12.7
2-Methylbutyryl-CoA: 12.3
trans-1,2-CPDA: 10.7
3-Methylbutyryl-CoA: 0.0

PKS_AT (2128..2413): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 238.8
inactive: 109.5
Methoxymalonyl-CoA: 70.7
Methylmalonyl-CoA: 61.9
Propionyl-CoA: 43.4
Benzoyl-CoA: 27.8
Ethylmalonyl-CoA: 24.6
Isobutyryl-CoA: 21.9
CHC-CoA: 19.3
Acetyl-CoA: 16.8
fatty_acid: 15.0
trans-1,2-CPDA: 14.5
2-Methylbutyryl-CoA: 13.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (3904..4195): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 216.8
inactive: 95.1
Methoxymalonyl-CoA: 62.0
Methylmalonyl-CoA: 46.8
Propionyl-CoA: 34.1
Ethylmalonyl-CoA: 21.8
Isobutyryl-CoA: 21.6
Benzoyl-CoA: 18.3
Acetyl-CoA: 17.9
CHC-CoA: 13.7
2-Methylbutyryl-CoA: 11.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PET44_RS03405: mmal

PKS_AT (560..859): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 224.1
Ethylmalonyl-CoA: 216.9
Methoxymalonyl-CoA: 182.1
2-Methylbutyryl-CoA: 153.9
trans-1,2-CPDA: 129.1
Propionyl-CoA: 114.7
Malonyl-CoA: 112.7
CHC-CoA: 103.2
Isobutyryl-CoA: 91.4
Benzoyl-CoA: 78.6
Acetyl-CoA: 68.4
3-Methylbutyryl-CoA: 59.7
fatty_acid: 37.6
inactive: 36.7

PET44_RS03410: mal - mal - mal - mal

PKS_AT (571..856): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 242.5
inactive: 111.6
Methoxymalonyl-CoA: 70.3
Methylmalonyl-CoA: 63.1
Propionyl-CoA: 43.8
Benzoyl-CoA: 25.9
Ethylmalonyl-CoA: 23.9
Isobutyryl-CoA: 21.5
CHC-CoA: 18.5
fatty_acid: 15.2
Acetyl-CoA: 14.9
trans-1,2-CPDA: 14.0
2-Methylbutyryl-CoA: 12.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (2398..2683): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 231.4
inactive: 99.7
Methoxymalonyl-CoA: 61.0
Methylmalonyl-CoA: 51.9
Propionyl-CoA: 37.2
Benzoyl-CoA: 23.6
Ethylmalonyl-CoA: 17.5
Acetyl-CoA: 16.4
CHC-CoA: 14.6
Isobutyryl-CoA: 14.2
trans-1,2-CPDA: 13.5
2-Methylbutyryl-CoA: 9.8
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3905..4191): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 239.9
inactive: 110.7
Methoxymalonyl-CoA: 69.7
Methylmalonyl-CoA: 60.9
Propionyl-CoA: 44.8
Benzoyl-CoA: 23.5
Isobutyryl-CoA: 22.8
Ethylmalonyl-CoA: 21.4
Acetyl-CoA: 20.3
CHC-CoA: 17.3
2-Methylbutyryl-CoA: 16.8
fatty_acid: 10.4
trans-1,2-CPDA: 8.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (5361..5648): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 233.7
inactive: 102.8
Methoxymalonyl-CoA: 61.7
Methylmalonyl-CoA: 53.6
Propionyl-CoA: 38.7
Benzoyl-CoA: 22.1
Acetyl-CoA: 18.5
Ethylmalonyl-CoA: 17.2
Isobutyryl-CoA: 15.0
CHC-CoA: 13.6
2-Methylbutyryl-CoA: 12.3
trans-1,2-CPDA: 10.2
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PET44_RS03415: mal - mal

PKS_AT (579..862): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 237.3
inactive: 118.5
Methoxymalonyl-CoA: 70.5
Methylmalonyl-CoA: 60.7
Propionyl-CoA: 39.5
Benzoyl-CoA: 25.3
Ethylmalonyl-CoA: 22.0
Isobutyryl-CoA: 18.8
CHC-CoA: 18.5
fatty_acid: 17.3
Acetyl-CoA: 17.2
2-Methylbutyryl-CoA: 14.8
trans-1,2-CPDA: 13.7
3-Methylbutyryl-CoA: 0.0

PKS_AT (2355..2639): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 232.6
inactive: 109.9
Methoxymalonyl-CoA: 67.7
Methylmalonyl-CoA: 54.6
Propionyl-CoA: 36.3
Benzoyl-CoA: 24.1
CHC-CoA: 19.2
Isobutyryl-CoA: 19.0
Acetyl-CoA: 16.1
Ethylmalonyl-CoA: 13.5
fatty_acid: 12.2
trans-1,2-CPDA: 10.3
2-Methylbutyryl-CoA: 7.5
3-Methylbutyryl-CoA: 0.0

PET44_RS03420: mal - mal - mal - mal - mal - mal - mal

PKS_AT (722..1016): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 233.4
inactive: 136.7
Methoxymalonyl-CoA: 60.9
Methylmalonyl-CoA: 55.6
Propionyl-CoA: 33.0
Benzoyl-CoA: 22.9
Isobutyryl-CoA: 20.0
Acetyl-CoA: 18.5
trans-1,2-CPDA: 13.5
2-Methylbutyryl-CoA: 10.6
Ethylmalonyl-CoA: 10.1
CHC-CoA: 8.6
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2256..2545): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 231.7
inactive: 106.6
Methoxymalonyl-CoA: 64.5
Methylmalonyl-CoA: 56.8
Propionyl-CoA: 38.0
Benzoyl-CoA: 22.1
Isobutyryl-CoA: 21.4
Ethylmalonyl-CoA: 18.5
2-Methylbutyryl-CoA: 17.6
Acetyl-CoA: 16.3
CHC-CoA: 15.3
trans-1,2-CPDA: 12.8
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3786..4075): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 226.0
inactive: 107.6
Methoxymalonyl-CoA: 56.0
Methylmalonyl-CoA: 48.5
Propionyl-CoA: 33.6
Benzoyl-CoA: 23.6
Isobutyryl-CoA: 16.5
Acetyl-CoA: 16.4
Ethylmalonyl-CoA: 12.9
2-Methylbutyryl-CoA: 10.6
CHC-CoA: 10.4
trans-1,2-CPDA: 10.3
fatty_acid: 9.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (5568..5855): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 234.7
inactive: 105.4
Methoxymalonyl-CoA: 64.4
Methylmalonyl-CoA: 54.9
Propionyl-CoA: 37.4
Benzoyl-CoA: 23.2
Isobutyryl-CoA: 17.4
Ethylmalonyl-CoA: 16.5
CHC-CoA: 15.5
Acetyl-CoA: 14.0
2-Methylbutyryl-CoA: 13.9
trans-1,2-CPDA: 13.0
fatty_acid: 11.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (7075..7365): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 230.4
inactive: 109.6
Methoxymalonyl-CoA: 62.2
Methylmalonyl-CoA: 57.4
Propionyl-CoA: 36.3
Benzoyl-CoA: 24.8
Ethylmalonyl-CoA: 18.1
Isobutyryl-CoA: 17.8
Acetyl-CoA: 15.8
CHC-CoA: 15.7
2-Methylbutyryl-CoA: 12.5
trans-1,2-CPDA: 12.2
fatty_acid: 10.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (8857..9142): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 242.0
inactive: 108.8
Methoxymalonyl-CoA: 63.8
Methylmalonyl-CoA: 52.6
Propionyl-CoA: 39.0
Benzoyl-CoA: 25.0
Ethylmalonyl-CoA: 19.7
Isobutyryl-CoA: 18.5
Acetyl-CoA: 15.4
CHC-CoA: 11.7
trans-1,2-CPDA: 9.8
2-Methylbutyryl-CoA: 7.5
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (10368..10655): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 234.9
inactive: 108.6
Methoxymalonyl-CoA: 61.4
Methylmalonyl-CoA: 50.2
Propionyl-CoA: 33.5
Benzoyl-CoA: 24.5
Acetyl-CoA: 20.5
Isobutyryl-CoA: 16.1
Ethylmalonyl-CoA: 15.2
trans-1,2-CPDA: 9.9
fatty_acid: 9.8
CHC-CoA: 9.6
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP115936.1 - Region 6 - RRE-containing,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 922,620 - 957,206 nt. (total: 34,587 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

PET44_RS03600: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

PET44_RS03725: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

PET44_RS03735: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: hydrolase

PET44_RS03625: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

PET44_RS03700: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Lyases: dehydratase

PET44_RS03665: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001146.5	0.37	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000603.5	0.36	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0001928.2	0.35	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.35	other (other)	bacilysin	Bacillus sp. CS93
BGC0001472.5	0.34	ribosomal	berninamycin A	Streptomyces bernensis
BGC0001145.5	0.34	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000607.5	0.34	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001860.4	0.33	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000569.5	0.33	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0000606.5	0.33	ribosomal	lactazole	Streptomyces lactacystinaeus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001860.4	0.52	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0001146.5	0.50	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001928.2	0.50	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000603.5	0.50	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0002120.3	0.49	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001472.5	0.49	ribosomal	berninamycin A	Streptomyces bernensis
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.63 out of 27.04

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.30 out of 24.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 10 - 89; Score: 60.7; RRE type: Heterocycloanthracin_C_RRE; Location: 10 - 97; Score: 40.6
: RRE type: Thiopeptide_F_RRE; Location: 10 - 89; Score: 60.7; RRE type: Heterocycloanthracin_C_RRE; Location: 10 - 97; Score: 40.6

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
OsdR	Development and stress management regulator

Core peptide predictions

No core peptides found.

NZ_CP115936.1 - Region 7 - T1PKS,hglE-KS,terpene,terpene-precursor

Download region GenBank file

Download region SVG

Location: 1,292,084 - 1,350,702 nt. (total: 58,619 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)
terpene-precursor: (PT_FPPS_like and not PT_HPP)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

PET44_RS05295: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

PET44_RS05345: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

PET44_RS05410: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: glycosyltransferase methyltransferase

PET44_RS05325: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

PET44_RS05400: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase hydrolase

PET44_RS05290: putative esterase

smcogs: SMCOG1104: putative esterase

PET44_RS05320: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

PET44_RS05370: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: cyclase hydratase

PET44_RS05350: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

PET44_RS05405: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase synthetase

PET44_RS05245: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

PET44_RS05270: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

PET44_RS05305: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PET44_RS05310: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

PET44_RS05235: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001201.3	0.63	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001911.3	0.59	terpene	raimonol	Streptomyces anulatus
BGC0001276.3	0.58	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.58	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.56	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001910.4	0.56	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001310.5	0.55	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.62	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.59	PKS	ACT-Toxin II	Alternaria alternata
BGC0001201.3	0.57	terpene	eremophilene	Sorangium cellulosum So ce56

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Terpene cluster 1 (1,293,014 - 1,314,049):

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

PET44_RS05270: PT_FPPS_like

Domain 1 (45 - 341): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Terpene cluster 2 (1,329,580 - 1,350,702):

Product predictions:

No product predictions

Genes with terpene domains:

PET44_RS05405: T1TS

Domain 1 (15 - 324): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (19):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.13 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.88 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.50 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.12 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.34 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.83 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.43 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.82 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.86 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.90 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.70 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.44 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.73 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.34 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.75 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.19 out of 24.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.79 out of 25.88

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Terpene

TFBS Finder

NRPS/PKS substrate predictions

PET44_RS05305: mal

PKS_AT (1212..1501): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 84.6
Methoxymalonyl-CoA: 36.1
Methylmalonyl-CoA: 25.2
inactive: 24.4
Propionyl-CoA: 21.5
fatty_acid: 19.1
CHC-CoA: 8.9
Ethylmalonyl-CoA: 7.1
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PET44_RS05310: pk

PKS_AT (635..846): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 12.6
Methylmalonyl-CoA: 11.0
Malonyl-CoA: 6.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_CP115936.1 - Region 8 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 2,802,210 - 2,831,991 nt. (total: 29,782 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

PET44_RS11995: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

PET44_RS12025: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

PET44_RS12045: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: carboxylase transferase

PET44_RS12010: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

PET44_RS12015: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Lyases: decarboxylase

PET44_RS12040: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase

PET44_RS12020: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Translocases: transporter

PET44_RS12115: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001453.5	0.75	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.75	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002690.2	0.60	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001453.5	0.75	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.75	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002690.2	0.60	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.77 out of 36.53

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 26.85

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

Additional weak hits (5):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.29 out of 33.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.71 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.48 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP115936.1 - Region 9 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 3,246,967 - 3,271,636 nt. (total: 24,670 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

PET44_RS14030: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

PET44_RS14035: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001289.5	0.55	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.55	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.53	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.53	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000544.4	0.51	ribosomal	planosporicin	Planomonospora alba
BGC0000584.5	0.47	ribosomal	colicin V	Escherichia coli
BGC0001727.3	0.46	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000506.4	0.46	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001289.5	0.55	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.55	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.53	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.53	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000544.4	0.51	ribosomal	planosporicin	Planomonospora alba
BGC0000584.5	0.47	ribosomal	colicin V	Escherichia coli
BGC0001727.3	0.46	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000506.4	0.46	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (13):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.88 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.89 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.40 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.23 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.01 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.63 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.78 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.91 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.61 out of 24.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.14 out of 27.04

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.84 out of 20.01

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 177 - 270; Score: 59.5

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein

NZ_CP115936.1 - Region 10 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 3,928,654 - 3,953,226 nt. (total: 24,573 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

PET44_RS17240: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: methyltransferase

PET44_RS17225: methyltransferase

smcogs: SMCOG1248: methyltransferase

Lyases: cyclase dehydratase

PET44_RS17250: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

PET44_RS17255: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.57	ribosomal	penisin	Paenibacillus ehimensis
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0000541.5	0.54	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.54	ribosomal	paenicidin B	Paenibacillus terrae
BGC0002316.2	0.50	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000538.3	0.47	ribosomal	nisin Z	Lactococcus lactis
BGC0002635.2	0.46	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000556.5	0.46	ribosomal	streptin	Streptococcus pyogenes
BGC0000528.5	0.45	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.57	ribosomal	penisin	Paenibacillus ehimensis
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0000541.5	0.54	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.54	ribosomal	paenicidin B	Paenibacillus terrae
BGC0002316.2	0.50	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000538.3	0.47	ribosomal	nisin Z	Lactococcus lactis
BGC0002635.2	0.46	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000556.5	0.46	ribosomal	streptin	Streptococcus pyogenes
BGC0000528.5	0.45	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.08 out of 27.04

Confidence: medium

Additional weak hits (11):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.90 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.53 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.45 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.37 out of 30.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.52 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.19 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.19 out of 29.65

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.20 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 30.11

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.24 out of 35.63

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 158 - 251; Score: 48.8

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP115936.1 - Region 11 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 4,886,389 - 4,907,462 nt. (total: 21,074 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

PET44_RS21860: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Ligases: synthetase

PET44_RS21810: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000678.5	0.35	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000664.5	0.35	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.34	terpene	carotenoid	Myxococcus xanthus
BGC0000644.3	0.34	terpene	carotenoid	Dietzia sp. CQ4
BGC0000666.5	0.34	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0000665.5	0.34	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000678.5	0.35	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000664.5	0.35	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.34	terpene	carotenoid	Myxococcus xanthus
BGC0000644.3	0.34	terpene	carotenoid	Dietzia sp. CQ4
BGC0000666.5	0.34	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0000665.5	0.34	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

PET44_RS21810: PT_FPPS_like

Domain 1 (61 - 353): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.99 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.88 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.57 out of 27.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.40 out of 30.98

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_CP115936.1 - Region 12 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 5,446,733 - 5,479,752 nt. (total: 33,020 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

PET44_RS24315: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

PET44_RS24265: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

PET44_RS24320: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002470.2	0.51	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002470.2	0.51	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 22.22 out of 23.05

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.68 out of 23.43

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.93 out of 27.18

Confidence: medium

Additional weak hits (14):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.33 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.11 out of 23.43

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 25.75

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.09 out of 29.25

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.95 out of 23.43

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.69 out of 27.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.92 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.59 out of 18.57

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.56 out of 24.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.23 out of 27.18

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NZ_CP115936.1 - Region 13 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 5,601,088 - 5,614,020 nt. (total: 12,933 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

PET44_RS24845: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

PET44_RS24855: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Hydrolases: deaminase peptidase

PET44_RS24835: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

PET44_RS24875: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002436.2	0.37	other (other)	coformycin	Streptomyces citricolor
BGC0002285.2	0.35	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001007.5	0.31	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001006.5	0.30	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0000595.3	0.29	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000971.5	0.26	NRPS, PKS	cinnabaramide A	Streptomyces cinnabarigriseus
BGC0001114.5	0.25	NRPS, PKS	thailanstatin A	Burkholderia thailandensis
BGC0001041.4	0.25	NRPS, PKS	salinosporamide A	Salinispora tropica CNB-440
BGC0002588.2	0.24	other (other)	enduracididine	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002436.2	0.37	other (other)	coformycin	Streptomyces citricolor
BGC0002285.2	0.35	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001007.5	0.31	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001006.5	0.30	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0000595.3	0.29	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000971.5	0.26	NRPS, PKS	cinnabaramide A	Streptomyces cinnabarigriseus
BGC0001114.5	0.25	NRPS, PKS	thailanstatin A	Burkholderia thailandensis
BGC0001041.4	0.25	NRPS, PKS	salinosporamide A	Salinispora tropica CNB-440
BGC0002588.2	0.24	other (other)	enduracididine	uncultured bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 19.46 out of 20.01

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.66 out of 27.18

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.29 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP115936.1 - Region 14 - RiPP-like

Download region GenBank file

Download region SVG

Location: 5,667,758 - 5,679,056 nt. (total: 11,299 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase

PET44_RS25135: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000306.5	0.31	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0000565.5	0.31	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis
BGC0002387.2	0.30	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002064.2	0.30	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001377.5	0.28	PKS	uncialamycin	Streptomyces uncialis
BGC0000874.5	0.28	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0002788.2	0.27	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0000529.5	0.26	ribosomal	microbisporicin A2	Microbispora corallina
BGC0001395.5	0.26	other (other)	teichomycin A1	Actinoplanes teichomyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000306.5	0.31	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0000565.5	0.31	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis
BGC0002387.2	0.30	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002064.2	0.30	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001377.5	0.28	PKS	uncialamycin	Streptomyces uncialis
BGC0000874.5	0.28	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0002788.2	0.27	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0000529.5	0.26	ribosomal	microbisporicin A2	Microbispora corallina
BGC0001395.5	0.26	other (other)	teichomycin A1	Actinoplanes teichomyceticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.62 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.73 out of 27.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CP115936.1 - Region 15 - terpene

Download region GenBank file

Download region SVG

Location: 5,745,498 - 5,767,714 nt. (total: 22,217 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

PET44_RS25455: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Lyases: cyclase

PET44_RS25485: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

PET44_RS25495: cobaltochelatase subunit CobN

smcogs: SMCOG1263: cobaltochelatase subunit CobN

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0001972.4	0.44	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000520.5	0.37	ribosomal	lacticin 3147 A1, lacticin 3147 A2	Lactococcus lactis
BGC0000517.4	0.37	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0001229.4	0.36	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0001210.5	0.36	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002698.2	0.35	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001606.3	0.35	PKS	gibepyrone-A	Fusarium fujikuroi IMI 58289

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0001972.4	0.44	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000520.5	0.37	ribosomal	lacticin 3147 A1, lacticin 3147 A2	Lactococcus lactis
BGC0000517.4	0.37	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0001229.4	0.36	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0001210.5	0.36	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002698.2	0.35	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001606.3	0.35	PKS	gibepyrone-A	Fusarium fujikuroi IMI 58289

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

PET44_RS25485: T1TS + T1TS

Domain 1 (2 - 325): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (326 - 706): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.15 out of 26.85

Confidence: medium

Additional weak hits (6):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.96 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.45 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.73 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.48 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.56 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.82 out of 30.98

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP115936.1 - Region 16 - terpene

Download region GenBank file

Download region SVG

Location: 6,036,136 - 6,063,017 nt. (total: 26,882 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

PET44_RS26665: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

PET44_RS26700: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: aminotransferase methyltransferase transferase

PET44_RS26645: methyltransferase

smcogs: SMCOG1089: methyltransferase

PET44_RS26660: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

PET44_RS26725: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Ligases: synthetase

PET44_RS26705: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.67	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000638.3	0.47	terpene	carotenoid	Pantoea ananatis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.67	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000638.3	0.47	terpene	carotenoid	Pantoea ananatis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

PET44_RS26690: PT_phytoene_like

Domain 1 (19 - 285): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

PET44_RS26695: PT_phytoene_like

Domain 1 (7 - 305): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

PET44_RS26705: PT_FPPS_like

Domain 1 (94 - 386): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

PET44_RS26710: T2TS

Domain 1 (70 - 691): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

Additional weak hits (4):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.88 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.78 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.96 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
MexT	Global virulence regulator

NZ_CP115936.1 - Region 17 - lanthipeptide-class-ii,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 6,187,392 - 6,213,248 nt. (total: 25,857 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

PET44_RS27350: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Lyases: cyclase

PET44_RS27380: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.36	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0002700.2	0.34	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000496.5	0.34	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000554.4	0.34	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000519.4	0.34	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002111.3	0.30	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000626.3	0.30	ribosomal	thuricin	Bacillus thuringiensis
BGC0000553.3	0.30	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000546.3	0.30	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0001391.3	0.29	ribosomal	thusin	Bacillus thuringiensis serovar rongseni

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0002700.2	0.48	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000496.5	0.48	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000554.4	0.48	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000519.4	0.48	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.46	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002699.2	0.46	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000546.3	0.45	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0002111.3	0.45	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000626.3	0.45	ribosomal	thuricin	Bacillus thuringiensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for PET44_RS27380

allorf_6203263_6203391

Leader:

MGRSGGRAELCGG

allorf_6203263_6203391

Leader:

MGRSGGRAELCGG

Shared core:

AGGSVCRVVRSCGRGPGCPVRERPDGGRG

Core with dehydrations:

AGGDhaVCysRVVRDhaCysGRGPGCysPVRERPDGGRG

antiSMASH-DB 4.0 matches for allorf_6203263_6203391

100.0%

NZ_CP011664.1and 3 others:

NZ_CP011664.1 Lanthipeptides: allorf_6647043_6647171_lanthipeptideNZ_CP115936.1 Lanthipeptides: allorf_6203263_6203391_lanthipeptideNZ_CP115936.1 Lanthipeptides: allorf_6203263_6203391_lanthipeptide

Lanthipeptides: allorf_6647043_6647171_lanthipeptide

1

AGGSVCRVVRSCGRGPGCPVRERPDGGRG

29

AGGSVCRVVRSCGRGPGCPVRERPDGGRG

1

AGGSVCRVVRSCGRGPGCPVRERPDGGRG

29

48.3%

NZ_BMVE01000002.1and 1 other:

NZ_BMVE01000002.1 Lanthipeptides: allorf_0866858_0866956_lanthipeptide

Lanthipeptides: allorf_0866858_0866956_lanthipeptide

1

AGGSVCRVVRSCGR

14

AGGSVCRVVRSCGR

1

AGGSVCRVVRSCGR

14

37.9%

NZ_JAFLQY010000003.1and 5 others:

NZ_JAFLQY010000003.1 Lanthipeptides: allorf_5560051_5560125_lanthipeptideNZ_LWLD01000012.1 Lanthipeptides: allorf_256609_256683_lanthipeptideNZ_LWLD01000012.1 Lanthipeptides: allorf_256609_256683_lanthipeptideNZ_NNBM01000001.1 Lanthipeptides: allorf_251917_251991_lanthipeptideNZ_NNBM01000001.1 Lanthipeptides: allorf_251917_251991_lanthipeptide

Lanthipeptides: allorf_5560051_5560125_lanthipeptide

1

AGGSVCRVVRS

11

AGGSVCRVVRS

1

AGGSVCRVVRS

11

with 4 more sequence matches

31.0%

NZ_LISX01000002.1and 3 others:

NZ_LISX01000002.1 Lanthipeptides: allorf_740933_741067_lanthipeptideNZ_LISX01000002.1 Lanthipeptides: allorf_740933_741067_lanthipeptideNZ_LISX01000002.1 Lanthipeptides: allorf_740933_741067_lanthipeptide

Lanthipeptides: allorf_740933_741067_lanthipeptide

6

CRVVRSCGRGPGCPVRERP

24

CR RS GR P R P

4

CRAGRSAGRTKHIPQRSTP

22

28.1%

NZ_CP031746.1:

Lanthipeptides: allorf_1813979_1814164_lanthipeptide

15

GPGCPVRERPDGGRG

29

G GCPV RP G G

17

GAGCPVTWRPGDGIG

31

27.6%

NZ_LT629701.1:

Lanthipeptides: allorf_1160331_1160426_lanthipeptide

3

GSVCRVVRSCGR

14

G+V R VRSC R

4

GTVVRAVRSCER

15

17.9%

NZ_QRDO01000002.1:

Lanthipeptides: allorf_1072387_1072554_lanthipeptide

6

CRVVRSCGRGPGCPVR

21

CRV +SC G P +

11

CRVPQSCALHAGMPTK

26

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (2):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.61 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_6203263_6203391 - Class II: Cleavage pHMM score: -3.20; RODEO score: 0; Monoisotopic mass: 2860.4 Da; Molecular weight: 2862.2 Da; Number of bridges: 2
allorf_6203263_6203391 - Class II: Cleavage pHMM score: -3.20; RODEO score: 0; Monoisotopic mass: 2860.4 Da; Molecular weight: 2862.2 Da; Number of bridges: 2

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP115936.1 - Region 18 - T1PKS

Download region GenBank file

Download region SVG

Location: 6,407,353 - 6,486,947 nt. (total: 79,595 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase reductase

PET44_RS28295: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

PET44_RS28300: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

PET44_RS28330: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

PET44_RS28385: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

PET44_RS28395: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

PET44_RS28460: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

Transferases: acylase aminotransferase glycosyltransferase methyltransferase transferase

PET44_RS28275: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

PET44_RS28315: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

PET44_RS28350: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

PET44_RS28380: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

PET44_RS28390: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

PET44_RS28465: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase

PET44_RS28305: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

PET44_RS28310: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

PET44_RS28340: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

PET44_RS28360: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PET44_RS28365: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

PET44_RS28370: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PET44_RS28375: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

PET44_RS28425: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000047.5	0.87	PKS	10,11-dihydro-8-deoxy-12,13-deepoxy-12,13-dihydrochalcomycin	Streptomyces sp. KCTC 0041BP
BGC0001396.5	0.83	PKS	aldgamycin J, aldgamycin K, aldgamycin P, aldgamycin E	Streptomyces sp. A1(2016)
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000035.5	0.72	PKS	chalcomycin A	Streptomyces bikiniensis
BGC0000041.3	0.69	PKS	oronofacic acid	Pseudomonas syringae
BGC0000166.5	0.66	PKS	tylactone	Streptomyces fradiae
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000047.5	0.87	PKS	10,11-dihydro-8-deoxy-12,13-deepoxy-12,13-dihydrochalcomycin	Streptomyces sp. KCTC 0041BP
BGC0001396.5	0.83	PKS	aldgamycin J, aldgamycin K, aldgamycin P, aldgamycin E	Streptomyces sp. A1(2016)
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000035.5	0.72	PKS	chalcomycin A	Streptomyces bikiniensis
BGC0000041.3	0.69	PKS	oronofacic acid	Pseudomonas syringae
BGC0000166.5	0.66	PKS	tylactone	Streptomyces fradiae
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.41 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.26 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.05 out of 28.19

Confidence: medium

Additional weak hits (11):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.74 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.62 out of 29.25

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.23 out of 20.01

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.60 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.15 out of 36.54

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.79 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.22 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 28, location 6407352 - 6486947:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (pk - Me-ohmal - pk) + (ccmal) + (Me-ccmal - Me-redmal) + (Me-ohmal) + (mal)
Non-colinear ordering:: PET44_RS28360 + PET44_RS28365 + PET44_RS28370 + PET44_RS28375 + PET44_RS28380

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PET44_RS28360: pk - mmal - pk

PKS_AT (523..816): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; Methylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 181.8
Ethylmalonyl-CoA: 159.7
Methoxymalonyl-CoA: 151.1
CHC-CoA: 109.1
trans-1,2-CPDA: 98.1
2-Methylbutyryl-CoA: 96.9
Malonyl-CoA: 92.9
Propionyl-CoA: 83.8
Isobutyryl-CoA: 73.8
Benzoyl-CoA: 46.6
fatty_acid: 44.1
inactive: 29.0
3-Methylbutyryl-CoA: 26.3
Acetyl-CoA: 24.7

PKS_AT (1533..1827): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 205.2
Ethylmalonyl-CoA: 194.1
Methoxymalonyl-CoA: 168.2
2-Methylbutyryl-CoA: 123.2
CHC-CoA: 107.3
trans-1,2-CPDA: 106.1
Propionyl-CoA: 104.0
Malonyl-CoA: 101.7
Isobutyryl-CoA: 74.0
Benzoyl-CoA: 54.3
fatty_acid: 45.2
Acetyl-CoA: 41.0
3-Methylbutyryl-CoA: 35.5
inactive: 23.9

PKS_AT (3029..3325): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; Methylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 181.5
Ethylmalonyl-CoA: 162.3
Methoxymalonyl-CoA: 151.8
CHC-CoA: 109.7
trans-1,2-CPDA: 98.7
2-Methylbutyryl-CoA: 98.4
Malonyl-CoA: 94.1
Propionyl-CoA: 84.4
Isobutyryl-CoA: 72.9
Benzoyl-CoA: 46.9
fatty_acid: 43.2
inactive: 28.6
3-Methylbutyryl-CoA: 27.5
Acetyl-CoA: 24.6

PET44_RS28365: mal

PKS_AT (565..860): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 216.2
inactive: 109.6
Methoxymalonyl-CoA: 71.4
Methylmalonyl-CoA: 68.3
Propionyl-CoA: 50.0
Isobutyryl-CoA: 34.5
Ethylmalonyl-CoA: 28.4
Acetyl-CoA: 26.7
CHC-CoA: 25.5
fatty_acid: 24.8
2-Methylbutyryl-CoA: 22.4
trans-1,2-CPDA: 21.4
Benzoyl-CoA: 13.5
3-Methylbutyryl-CoA: 11.7

PET44_RS28370: mmal - mmal

PKS_AT (576..870): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 207.2
Ethylmalonyl-CoA: 197.0
Methoxymalonyl-CoA: 171.7
2-Methylbutyryl-CoA: 130.2
CHC-CoA: 113.3
Malonyl-CoA: 112.6
Propionyl-CoA: 112.2
trans-1,2-CPDA: 110.1
Isobutyryl-CoA: 77.7
Benzoyl-CoA: 60.1
fatty_acid: 52.1
Acetyl-CoA: 47.4
3-Methylbutyryl-CoA: 34.6
inactive: 31.9

PKS_AT (2063..2357): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 208.1
Ethylmalonyl-CoA: 197.8
Methoxymalonyl-CoA: 171.9
2-Methylbutyryl-CoA: 133.1
CHC-CoA: 115.3
Propionyl-CoA: 114.2
Malonyl-CoA: 113.2
trans-1,2-CPDA: 109.4
Isobutyryl-CoA: 79.7
Benzoyl-CoA: 58.9
fatty_acid: 54.4
Acetyl-CoA: 47.0
3-Methylbutyryl-CoA: 35.6
inactive: 29.0

PET44_RS28375: mmal

PKS_AT (565..859): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.4
Ethylmalonyl-CoA: 197.9
Methoxymalonyl-CoA: 167.3
2-Methylbutyryl-CoA: 125.3
CHC-CoA: 111.3
Propionyl-CoA: 106.0
trans-1,2-CPDA: 105.6
Malonyl-CoA: 104.9
Isobutyryl-CoA: 75.3
Benzoyl-CoA: 52.1
fatty_acid: 49.8
Acetyl-CoA: 42.4
3-Methylbutyryl-CoA: 35.6
inactive: 24.0

PET44_RS28380: mal

PKS_AT (578..888): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.2
inactive: 106.1
Methoxymalonyl-CoA: 69.3
Methylmalonyl-CoA: 57.5
Propionyl-CoA: 37.7
Isobutyryl-CoA: 22.8
Benzoyl-CoA: 19.7
Acetyl-CoA: 17.5
Ethylmalonyl-CoA: 16.2
2-Methylbutyryl-CoA: 13.5
fatty_acid: 9.4
CHC-CoA: 5.7
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
ZuR variant 1	Zinc-responsive repressor

NZ_CP115936.1 - Region 19 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 6,518,587 - 6,541,223 nt. (total: 22,637 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

PET44_RS28695: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.82	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.69	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.61	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.60	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.53	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000546.3	0.50	ribosomal	SAL-2242	Streptomyces albidoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.82	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.69	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.61	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.60	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.53	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000546.3	0.50	ribosomal	SAL-2242	Streptomyces albidoflavus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for PET44_RS28655

PET44_RS28650

Leader:

MTLLDLQSMETPKEETTEAAH

Core:

GGGGGSRASLLLCGDSSLSITTCN

Core with dehydrations:

GGGGGDhaRADhaLLLCysGDDhaDhaLDhaIDhbDhbCysN

antiSMASH-DB 4.0 matches for PET44_RS28650

100.0%

NZ_BMVE01000003.1and 16 others:

NZ_BMVL01000005.1 Lanthipeptides: IE257_RS16230_lanthipeptideNZ_CP011664.1 Lanthipeptides: M444_RS30240_lanthipeptideNZ_CP020039.1 Lanthipeptides: B4U39_RS34445_lanthipeptideNZ_CP020555.1 Lanthipeptides: B6R96_RS03515_lanthipeptideNZ_CP029189.1 Lanthipeptides: DEJ51_RS31910_lanthipeptideNZ_CP030286.1 Lanthipeptides: DRB89_RS16930_lanthipeptideNZ_CP033581.1 Lanthipeptides: EES41_RS31595_lanthipeptideNZ_CP034350.1 Lanthipeptides: D1J60_RS32970_lanthipeptideNZ_CP115936.1 Lanthipeptides: PET44_RS28650_lanthipeptideNZ_JAFLQY010000003.1 Lanthipeptides: J0X20_RS29030_lanthipeptideNZ_JAINUL010000001.1 Lanthipeptides: K7B10_RS06210_lanthipeptideNZ_JANAVF010000017.1 Lanthipeptides: NLX94_RS31205_lanthipeptideNZ_LIVP01000027.1 Lanthipeptides: AMK15_RS28680_lanthipeptideNZ_LWLD01000038.1 Lanthipeptides: A6A28_RS28600_lanthipeptideNZ_ML123038.1 Lanthipeptides: EES37_RS30340_lanthipeptideNZ_NNBM01000002.1 Lanthipeptides: CG724_RS07855_lanthipeptide

Lanthipeptides: IE248_RS10435_lanthipeptide

1

GGGGGSRASLLLCGDSSLSITTCN

24

GGGGGSRASLLLCGDSSLSITTCN

1

GGGGGSRASLLLCGDSSLSITTCN

24

91.7%

NZ_JACHJG010000001.1:

Lanthipeptides: FHS38_RS02665_lanthipeptide

1

GGGGGSRASLLLCGDSSLSITTCN

24

GGGGGSRASLLLCGDSSLS+ TCN

1

GGGGGSRASLLLCGDSSLSVVTCN

24

83.3%

NZ_BBOK01000011.1and 28 others:

NZ_BEWD01000001.1 Lanthipeptides: Sru02f_RS01660_lanthipeptideNZ_BMSL01000016.1 Lanthipeptides: IE215_RS23330_lanthipeptideNZ_BMUC01000023.1 Lanthipeptides: IE172_RS32210_lanthipeptideNZ_BMVQ01000005.1 Lanthipeptides: IE283_RS17035_lanthipeptideNZ_BMWI01000025.1 Lanthipeptides: IE253_RS33945_lanthipeptideNZ_CM002280.1 Lanthipeptides: M877_RS44575_lanthipeptideNZ_CP012382.1 Lanthipeptides: SAM23877_RS30085_lanthipeptideNZ_CP012949.1 Lanthipeptides: SAM40697_RS29010_lanthipeptideNZ_CP018047.1 Lanthipeptides: BBN63_RS03065_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS34495_lanthipeptideNZ_CP043959.1 Lanthipeptides: F3L20_RS19105_lanthipeptideNZ_CP045547.1 Lanthipeptides: GEV49_RS05730_lanthipeptideNZ_CP048397.1 Lanthipeptides: SSPS47_RS31455_lanthipeptideNZ_CP054939.1 Lanthipeptides: HUT14_RS29815_lanthipeptideNZ_CP094918.1 Lanthipeptides: MTR79_RS16715_lanthipeptideNZ_GG657756.1 Lanthipeptides: SSPG_RS05020_lanthipeptideNZ_GG657758.1 Lanthipeptides: SSRG_RS03855_lanthipeptideNZ_JAAIFS010000001.1 Lanthipeptides: GUR47_RS02255_lanthipeptideNZ_JACHEM010000005.1 Lanthipeptides: HNQ79_RS11445_lanthipeptideNZ_KZ195574.1 Lanthipeptides: B9W62_RS05695_lanthipeptideNZ_LT629768.1 Lanthipeptides: BLU60_RS34110_lanthipeptideNZ_MQUH01000025.1 Lanthipeptides: BSZ07_RS33280_lanthipeptideNZ_RAII01000001.1 Lanthipeptides: EBH12_RS10360_lanthipeptideNZ_RSEG01000006.1 Lanthipeptides: EIA57_RS12710_lanthipeptideNZ_SOAV01000001.1 Lanthipeptides: EV562_RS04520_lanthipeptideNZ_VIUV01000020.1 Lanthipeptides: FB570_RS34060_lanthipeptideNZ_WHZR01000001.1 Lanthipeptides: STPH1_RS04005_lanthipeptideNZ_WXVT01000001.1 Lanthipeptides: STPH2_RS03995_lanthipeptide

Lanthipeptides: APK71_RS25550_lanthipeptide

5

GSRASLLLCGDSSLSITTCN

24

GSRASLLLCGDSSLSITTCN

2

GSRASLLLCGDSSLSITTCN

21

with 100 more sequence matches

Only the first 10 are displayed here.

83.3%

NZ_CP102509.1:

Lanthipeptides: JIW86_RS37035_lanthipeptide

3

GGGSRASLLLCGDSSLSITTCN

24

GGGSRASLLLCGDSSLS+TTC+

2

GGGSRASLLLCGDSSLSLTTCH

23

83.3%

NZ_JAGGOI010000031.1:

Lanthipeptides: J7E87_RS22160_lanthipeptide

4

GGSRASLLLCGDSSLSITTCN

24

GGSRASLLLCGDSSLS+TTCN

1

GGSRASLLLCGDSSLSVTTCN

21

81.5%

NZ_CP023701.1and 2 others:

NZ_CP043638.1 Lanthipeptides: F1D59_RS34930_lanthipeptideNZ_CP116355.1 Lanthipeptides: KPP03845_RS32700_lanthipeptide

Lanthipeptides: CP968_RS29065_lanthipeptide

3

GGGSRASLLLCGDSSLSITTCN

24

GGGSRASLLLCGDSSLSITTCN

6

GGGSRASLLLCGDSSLSITTCN

27

79.2%

NC_018750.1and 77 others:

NC_018750.1 Lanthipeptides: SVEN_RS32110_lanthipeptideNZ_BBNO01000003.1 Lanthipeptides: TU31_RS37940_lanthipeptideNZ_BMSV01000002.1 Lanthipeptides: IE106_RS06150_lanthipeptideNZ_BMTO01000007.1 Lanthipeptides: IE136_RS15615_lanthipeptideNZ_BMTP01000009.1 Lanthipeptides: IE109_RS18470_lanthipeptideNZ_BMTU01000009.1 Lanthipeptides: IE118_RS22890_lanthipeptideNZ_BMUN01000001.1 Lanthipeptides: IE238_RS00740_lanthipeptideNZ_CP007699.2 Lanthipeptides: T261_RS39185_lanthipeptideNZ_CP009754.1 Lanthipeptides: NI25_RS05015_lanthipeptideNZ_CP015866.1 Lanthipeptides: Spa2297_RS27800_lanthipeptideNZ_CP017157.1 Lanthipeptides: SL103_RS15895_lanthipeptideNZ_CP019457.1 Lanthipeptides: BXT88_RS03410_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS35355_lanthipeptideNZ_CP019779.1 Lanthipeptides: STRMOE7_RS03775_lanthipeptideNZ_CP023691.1 Lanthipeptides: CP981_RS03050_lanthipeptideNZ_CP023700.1 Lanthipeptides: CP969_RS04700_lanthipeptideNZ_CP027299.1 Lanthipeptides: C1N79_RS34970_lanthipeptideNZ_CP029042.1 Lanthipeptides: DDE74_RS03525_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029541.1 Lanthipeptides: DKG71_RS05245_lanthipeptideNZ_CP034279.1 Lanthipeptides: EIZ62_RS28660_lanthipeptideNZ_CP034353.1 Lanthipeptides: D1J63_RS04900_lanthipeptideNZ_CP039123.1 Lanthipeptides: E5N77_RS35250_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS09720_lanthipeptideNZ_CP046905.1 Lanthipeptides: GPZ77_RS32930_lanthipeptideNZ_CP047140.1 Lanthipeptides: GLX30_RS11420_lanthipeptideNZ_CP050976.1 Lanthipeptides: HEP86_RS04470_lanthipeptideNZ_CP054920.1 Lanthipeptides: HUT15_RS04615_lanthipeptideNZ_CP060825.1 Lanthipeptides: IAG43_RS32355_lanthipeptideNZ_CP074111.1 Lanthipeptides: KE639_RS31630_lanthipeptideNZ_CP084681.1 Lanthipeptides: KI385_RS00885_lanthipeptideNZ_CP085300.1 Lanthipeptides: LJA35_RS05220_lanthipeptideNZ_CP086217.1 Lanthipeptides: LJ741_RS03435_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS09690_lanthipeptideNZ_CP098437.1 Lanthipeptides: NCG97_RS34740_lanthipeptideNZ_CP099468.1 Lanthipeptides: NFX46_RS16770_lanthipeptideNZ_CP101137.1 Lanthipeptides: M6G08_RS24535_lanthipeptideNZ_CP102332.1 Lanthipeptides: NRO40_RS01140_lanthipeptideNZ_CP102609.1 Lanthipeptides: NUT86_RS03980_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33560_lanthipeptideNZ_CP114202.1 Lanthipeptides: STRLI_RS35870_lanthipeptideNZ_CP114203.1 Lanthipeptides: STRNI_RS37360_lanthipeptideNZ_CP114205.1 Lanthipeptides: STRTU_RS33380_lanthipeptideNZ_JACHJE010000006.1 Lanthipeptides: FHS32_RS15850_lanthipeptideNZ_JACHJI010000005.1 Lanthipeptides: FHS37_RS15430_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACWAA010000001.1 Lanthipeptides: ICA23_RS00800_lanthipeptideNZ_JADMLH010000003.1 Lanthipeptides: IT780_RS09875_lanthipeptideNZ_JAFEJA010000002.1 Lanthipeptides: JE024_RS34830_lanthipeptideNZ_JAGPYC010000033.1 Lanthipeptides: KBZ00_RS31440_lanthipeptideNZ_JAHLXF010000022.1 Lanthipeptides: KQY13_RS30555_lanthipeptideNZ_JAIHBQ010000001.1 Lanthipeptides: K4902_RS04515_lanthipeptideNZ_JAJJMU010000026.1 Lanthipeptides: LOC25_RS31275_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAPKNL010000004.1 Lanthipeptides: OSI21_RS07750_lanthipeptideNZ_JH993790.1 Lanthipeptides: STRVIR_RS0131905_lanthipeptideNZ_KN039948.1 Lanthipeptides: FM21_RS29525_lanthipeptideNZ_LIPF01000004.1 Lanthipeptides: AMK11_RS16660_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVX01000004.1 Lanthipeptides: AMK29_RS15650_lanthipeptideNZ_LIWB01000010.1 Lanthipeptides: AMK33_RS24360_lanthipeptideNZ_LIYH01000004.1 Lanthipeptides: AMK26_RS17765_lanthipeptideNZ_MPOH02000012.1 Lanthipeptides: BM536_RS17150_lanthipeptideNZ_NBCN01000003.1 Lanthipeptides: BKD26_RS06570_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_RAIF01000032.1 Lanthipeptides: EBH09_RS35480_lanthipeptideNZ_SOPG01000008.1 Lanthipeptides: E0I08_RS17090_lanthipeptide

Lanthipeptides: SVEN_RS32110_lanthipeptide

5

GSRASLLLCGDSSLSITTCN

24

GSRASLLLCGDSSLS+TTCN

2

GSRASLLLCGDSSLSVTTCN

21

79.2%

NZ_CP048835.1:

Lanthipeptides: C8250_RS00390_lanthipeptide

4

GGSRASLLLCGDSSLSITTCN

24

GGSRASLLLCG+SSLS+TTCN

1

GGSRASLLLCGNSSLSVTTCN

21

79.2%

NZ_QGGR01000008.1:

Lanthipeptides: BC793_RS19230_lanthipeptide

4

GGSRASLLLCGDSSLSITTCN

24

GGS+ASLLLCGDSSLS+TTCN

1

GGSQASLLLCGDSSLSVTTCN

21

77.8%

NZ_CP020042.1and 9 others:

NZ_CP023202.1 Lanthipeptides: SXIN_RS23100_lanthipeptideNZ_CP023692.1 Lanthipeptides: CP980_RS04735_lanthipeptideNZ_CP028158.1 Lanthipeptides: C6361_RS04660_lanthipeptideNZ_CP028159.1 Lanthipeptides: C6W10_RS01185_lanthipeptideNZ_FNHI01000003.1 Lanthipeptides: BLT82_RS06465_lanthipeptideNZ_JAGPXX010000007.1 Lanthipeptides: KBZ10_RS10785_lanthipeptideNZ_JAPNLM010000003.1 Lanthipeptides: OTB16_RS07305_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptide

Lanthipeptides: B4U46_RS32710_lanthipeptide

3

GGGSRASLLLCGDSSLSITTCN

24

GGGSRASLLLCGDSSLS+TTCN

6

GGGSRASLLLCGDSSLSVTTCN

27

75.0%

NZ_BNCA01000002.1and 1 other:

NZ_CP049782.1 Lanthipeptides: G7Z12_RS34445_lanthipeptide

Lanthipeptides: IE314_RS02760_lanthipeptide

5

GSRASLLLCGDSSLSITTCN

24

GSRASLLLCGDSSLS++TCN

2

GSRASLLLCGDSSLSVSTCN

21

75.0%

NZ_CP007574.1and 6 others:

NZ_CP007574.1 Lanthipeptides: DC74_RS36920_lanthipeptideNZ_CP026094.1 Lanthipeptides: SE95_RS37250_lanthipeptideNZ_CP104098.1 Lanthipeptides: N1H47_RS36625_lanthipeptideNZ_CP104098.1 Lanthipeptides: N1H47_RS36625_lanthipeptideNZ_CP119144.1 Lanthipeptides: P0D74_RS03260_lanthipeptideNZ_CP119144.1 Lanthipeptides: P0D74_RS03260_lanthipeptide

Lanthipeptides: DC74_RS36920_lanthipeptide

5

GSRASLLLCGDSSLSITTCN

24

GSRASLLLCGDSSLS+TTC

5

GSRASLLLCGDSSLSVTTCK

24

75.0%

NZ_CP036455.1:

Lanthipeptides: EKD16_RS17975_lanthipeptide

4

GGSRASLLLCGDSSLSITTCN

24

GS ASLLLCGDSSLS+TTCN

1

AGSEASLLLCGDSSLSLTTCN

21

MIBiG 4.0 matches for PET44_RS28650

45.8%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

5

GSRASLLLCGDSSLSITTCN

24

GS+ SLL+C SSLS+ C

2

GSQVSLLVCEYSSLSVVLCT

21

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.55 out of 26.85

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.35 out of 20.01

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.34 out of 31.73

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

PET44_RS28650 - Class III

Cleavage pHMM score: 20.90

RODEO score: 0

Monoisotopic mass: 2099.0 Da

Molecular weight: 2100.3 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2118.3 Da N = 1; 2136.3 Da N = 2; 2154.4 Da N = 3; 2172.4 Da N = 4; 2190.4 Da N = 5

TFBS definitions

Regulator	Description

NZ_CP115936.1 - Region 20 - melanin

Download region GenBank file

Download region SVG

Location: 6,621,388 - 6,649,018 nt. (total: 27,631 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

PET44_RS29115: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

PET44_RS29120: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

PET44_RS29125: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acetyltransferase

PET44_RS29175: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: esterase protease

PET44_RS29155: putative esterase

smcogs: SMCOG1104: putative esterase

PET44_RS29185: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: decarboxylase

PET44_RS29215: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000912.3	0.79	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.69	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000908.3	0.62	other (other)	melanin	Streptomyces avermitilis
BGC0002284.3	0.45	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000662.5	0.44	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000889.5	0.44	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000885.3	0.43	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001592.5	0.42	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000912.3	0.79	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.69	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000908.3	0.62	other (other)	melanin	Streptomyces avermitilis
BGC0002284.3	0.45	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000662.5	0.44	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000889.5	0.44	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000885.3	0.43	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001592.5	0.42	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.17 out of 24.78

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (8):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.93 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.77 out of 24.78

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response

NZ_CP115936.1 - Region 21 - NI-siderophore,T2PKS,T3PKS

Download region GenBank file

Download region SVG

Location: 6,708,141 - 6,819,416 nt. (total: 111,276 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxidoreductase oxygenase

PET44_RS29535: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

PET44_RS29670: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

PET44_RS29845: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

PET44_RS29880: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acetyltransferase methyltransferase

PET44_RS29540: methyltransferase

smcogs: SMCOG1089: methyltransferase

PET44_RS29675: Methylation

MITE: MITE0000155Methylation (identity: 70.10%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

PET44_RS29720: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

PET44_RS29730: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: deacetylase

PET44_RS29640: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Lyases: cyclase

PET44_RS29810: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

PET44_RS29815: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: ligase synthase

PET44_RS29680: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

PET44_RS29825: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

PET44_RS29830: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PET44_RS29965: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease transport

PET44_RS29580: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

PET44_RS29600: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	1.11	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.45	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000272.3	0.43	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.42	PKS	spore pigment	Streptomyces avermitilis
BGC0000528.5	0.41	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000215.5	0.40	PKS	curamycin	Streptomyces cyaneus
BGC0002127.3	0.38	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000194.5	0.38	PKS	actinorhodin	Streptomyces coelicolor A3(2)
BGC0000221.5	0.38	PKS	erdacin	uncultured soil bacterium V167
BGC0001592.5	0.37	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.82	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000272.3	0.74	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.73	PKS	spore pigment	Streptomyces avermitilis
BGC0000215.5	0.72	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001513.3	0.61	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.59	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002164.2	0.58	NRPS	peramine	Epichloe festucae
BGC0001831.3	0.58	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001197.5	0.56	PKS	frankiamicin	Frankia sp. EAN1pec

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.29 out of 27.04

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.57 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.07 out of 23.79

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

Additional weak hits (52):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.00 out of 18.57

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.55 out of 29.72

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.97 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.93 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.77 out of 28.19

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.10 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.11 out of 27.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.92 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.32 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.41 out of 18.57

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.33 out of 30.97

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.25 out of 39.62

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.19 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.19 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.28 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.46 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.96 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.25 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.04 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.01 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.21 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.14 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.46 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.04 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.51 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.90 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.77 out of 18.57

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.93 out of 27.04

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.18 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.78 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.21 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.77 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.19 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.92 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.63 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.39 out of 20.01

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.60 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.00 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.58 out of 29.38

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.56 out of 32.93

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.69 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.08 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.82 out of 36.53

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.65 out of 31.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.45 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.26 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.63 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.35 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.05 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

PET44_RS29965: X

AMP-binding (29..443): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NFVVFGMVMGNAYGIMAGSSICYGMTETSPVSTQ
Nearest Stachelhaus code(s):: Abu or Ival DMGFIAGVVK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 6746873 to 6819416
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

PET44_RS29670: OXY (Score: 61.0; E-value: 2.5e-19)
PET44_RS29810: CYC C4-C21/C2-C23|C2-C19 (Score: 149.6; E-value: 6.3e-47)
PET44_RS29815: CYC C9-C14 (Score: 237.5; E-value: 1.1e-73)
PET44_RS29820: ACP (Score: 55.5; E-value: 1e-17)
PET44_RS29825: CLF (Score: 541.2; E-value: 3.2e-165)
PET44_RS29830: KS (Score: 712.1; E-value: 4.7e-217)
PET44_RS29835: CYC C5-C18 (Score: 212.1; E-value: 4.9e-66)
PET44_RS29845: OXY (Score: 286.0; E-value: 1.4e-87)
PET44_RS29880: OXY (Score: 280.0; E-value: 9.6e-86)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

NZ_CP115936.1 - Region 22 - terpene

Download region GenBank file

Download region SVG

Location: 6,821,054 - 6,842,091 nt. (total: 21,038 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

PET44_RS30020: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Lyases: cyclase

PET44_RS30025: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.49	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.46	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000674.5	0.42	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.37	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002721.2	0.36	saccharide	α-hydroxynitrile glucoside, β-hydroxynitrile glucoside, γ-hydroxynitrile glucoside	Hordeum vulgare subsp. vulgare
BGC0000665.5	0.35	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000286.3	0.33	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001782.3	0.33	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.49	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.46	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000674.5	0.42	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.37	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002721.2	0.36	saccharide	α-hydroxynitrile glucoside, β-hydroxynitrile glucoside, γ-hydroxynitrile glucoside	Hordeum vulgare subsp. vulgare
BGC0000665.5	0.35	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000286.3	0.33	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001782.3	0.33	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

PET44_RS30025: T1TS

Domain 1 (4 - 323): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.79 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.21 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (7):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.51 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.84 out of 28.14

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.63 out of 27.18

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.34 out of 27.04

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP115936.1 - Region 23 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 6,847,517 - 6,868,641 nt. (total: 21,125 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

PET44_RS30180: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

PET44_RS30165: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

PET44_RS30150: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthetase

PET44_RS30125: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001075.5	0.38	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0001483.4	0.37	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001521.3	0.36	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002535.2	0.35	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0002514.3	0.34	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0000648.3	0.34	terpene	carotenoid	Myxococcus xanthus
BGC0002719.2	0.33	NRPS	thanafactin A	Pseudomonas fluorescens
BGC0002805.2	0.33	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0002591.2	0.33	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0002012.4	0.32	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001075.5	0.38	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0001483.4	0.37	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001521.3	0.36	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002535.2	0.35	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0002514.3	0.34	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0000648.3	0.34	terpene	carotenoid	Myxococcus xanthus
BGC0002719.2	0.33	NRPS	thanafactin A	Pseudomonas fluorescens
BGC0002805.2	0.33	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0002591.2	0.33	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0002012.4	0.32	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

PET44_RS30125: PT_FPPS_like

Domain 1 (53 - 352): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (12):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.71 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.28 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.17 out of 36.54

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.80 out of 24.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.14 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.37 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.36 out of 21.84

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.75 out of 39.62

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 14.74 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_CP115936.1 - Region 24 - NRPS

Download region GenBank file

Download region SVG

Location: 7,039,306 - 7,099,314 nt. (total: 60,009 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

PET44_RS31255: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

PET44_RS31290: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: acyltransferase aminotransferase

PET44_RS31145: aminotransferase

smcogs: SMCOG1019: aminotransferase

PET44_RS31175: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: deaminase hydrolase

PET44_RS31170: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

PET44_RS31265: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: lyase

PET44_RS31125: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

PET44_RS31135: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

PET44_RS31150: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PET44_RS31160: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

PET44_RS31185: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.10 out of 23.79

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

Additional weak hits (15):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.50 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.07 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.13 out of 27.04

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.21 out of 20.01

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.37 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.67 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.14 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.39 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.68 out of 28.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.36 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.51 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.45 out of 36.54

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.24 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 37, location 7039305 - 7099314:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Thr - Ser) + (Hpr - Pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PET44_RS31150: X

AMP-binding (264..661): X

nrpys: Orn, Lys, Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HTQAFDSFIDQPDCVFGGEVSIYGATECSIGSVE
Nearest Stachelhaus code(s):: Arg DAEDVGVIGK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

PET44_RS31160: X

AMP-binding (560..961): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RFMTFDDSALEWQVVSSGEHNTWGATEVSIDSTT
Nearest Stachelhaus code(s):: Ser DVWHVSLIDK (62% 8Å match); Gly DILQVGMIWK (53% 8Å match)
Stachelhaus code match:: 60% (weak)

PET44_RS31175: Thr - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (486..896): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1567..1968): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

PET44_RS31185: Hpr - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (504..915): Hpr

nrpys: Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: pip (Hpr)

Stachelhaus prediction details:

Stachelhaus sequence:: MAHCFDFSVEEAFAIQGGEHNVYGPAETHGVTMY
Nearest Stachelhaus code(s):: Hpr DFQFLGVAVK (74% 8Å match); dmePip DVLFIGVGCK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1588..1999): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWETFDVSTQEAYAVQAGEENHYGPAETHVTTGF
Nearest Stachelhaus code(s):: Pro DVQYVAHVTK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP115937.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 79,234 - 125,551 nt. (total: 46,318 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

PET44_RS32715: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase

PET44_RS32680: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: deaminase

PET44_RS32675: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Ligases: synthase

PET44_RS32720: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.98 out of 26.85

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.43 out of 23.79

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.09 out of 26.33

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.94 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.37 out of 23.79

Confidence: medium

Additional weak hits (15):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.39 out of 27.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 23.43

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.25 out of 32.74

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.82 out of 31.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.25 out of 35.63

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.69 out of 30.98

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 32.93

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.85 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.68 out of 33.14

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.36 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 79233 - 125551:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PET44_RS32715: mmal

PKS_AT (545..840): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Malonyl-CoA: 70.8%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 147.5
Ethylmalonyl-CoA: 134.7
Methoxymalonyl-CoA: 124.8
Malonyl-CoA: 105.2
Isobutyryl-CoA: 91.2
2-Methylbutyryl-CoA: 85.3
trans-1,2-CPDA: 81.7
Propionyl-CoA: 76.6
Acetyl-CoA: 54.2
CHC-CoA: 47.3
Benzoyl-CoA: 44.2
3-Methylbutyryl-CoA: 43.3
fatty_acid: 42.8
inactive: 37.9

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP115937.1 - Region 2 - butyrolactone

Download region GenBank file

Download region SVG

Location: 335,730 - 346,701 nt. (total: 10,972 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase

PET44_RS33810: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Lyases: dehydratase

PET44_RS33785: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

PET44_RS33780: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.71	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000231.5	0.43	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0002578.2	0.42	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.40	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.39	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.39	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000253.4	0.39	PKS	oviedomycin	Streptomyces antibioticus
BGC0000271.5	0.38	PKS	spore pigment	Streptomyces avermitilis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.71	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000231.5	0.43	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0002578.2	0.42	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.40	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.39	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.39	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000253.4	0.39	PKS	oviedomycin	Streptomyces antibioticus
BGC0000271.5	0.38	PKS	spore pigment	Streptomyces avermitilis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.48 out of 23.43

Confidence: medium

Additional weak hits (11):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.24 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.44 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.76 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.51 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.61 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.17 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.50 out of 27.04

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.59 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.19 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
ToxT	Regulator of MSHA biosynthesis

NZ_CP115937.1 - Region 3 - butyrolactone

Download region GenBank file

Download region SVG

Location: 385,395 - 396,372 nt. (total: 10,978 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

PET44_RS34010: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: ligase

PET44_RS34015: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.78	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.69	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002276.2	0.59	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002193.2	0.56	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001166.5	0.56	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002578.2	0.47	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000851.5	0.45	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0001928.2	0.41	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.78	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.69	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002276.2	0.59	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002193.2	0.56	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001166.5	0.56	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002578.2	0.47	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000851.5	0.45	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0001928.2	0.41	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.96 out of 20.97

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.84 out of 30.12

Confidence: medium

Additional weak hits (10):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.69 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.04 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.73 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.23 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.10 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.98 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.93 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.51 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.33 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.23 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
OsdR	Development and stress management regulator

NZ_CP115937.1 - Region 4 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 418,489 - 443,072 nt. (total: 24,584 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

PET44_RS34195: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

PET44_RS34200: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.57	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.53	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0002316.2	0.50	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000556.5	0.50	ribosomal	streptin	Streptococcus pyogenes
BGC0000542.3	0.48	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000506.4	0.48	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000559.4	0.48	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000544.4	0.48	ribosomal	planosporicin	Planomonospora alba
BGC0001727.3	0.45	ribosomal	paenilan	Paenibacillus polymyxa E681

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.57	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.53	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0002316.2	0.50	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000556.5	0.50	ribosomal	streptin	Streptococcus pyogenes
BGC0000542.3	0.48	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000506.4	0.48	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000559.4	0.48	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000544.4	0.48	ribosomal	planosporicin	Planomonospora alba
BGC0001727.3	0.45	ribosomal	paenilan	Paenibacillus polymyxa E681

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for PET44_RS34200

PET44_RS34185

Leader:

MTAVLIEPIVRDLVMDDFDLDVRIAVSADFETA

Core:

EAGFSNWYSCKSTCVRECLGLSINGCN

Core with dehydrations:

EAGFDhaNWYDhaCysKDhaDhbCysVRECysLGLDhaINGCysN

antiSMASH-DB 4.0 matches for PET44_RS34185

100.0%

NZ_CP011665.1and 1 other:

NZ_CP115937.1 Lanthipeptides: PET44_RS34185_lanthipeptide

Lanthipeptides: M444_RS41790_lanthipeptide

1

EAGFSNWYSCKSTCVRECLGLSINGCN

27

EAGFSNWYSCKSTCVRECLGLSINGCN

1

EAGFSNWYSCKSTCVRECLGLSINGCN

27

96.3%

NZ_ML123039.1:

Lanthipeptides: EES37_RS36545_lanthipeptide

1

EAGFSNWYSCKSTCVRECLGLSINGCN

27

EAGFSNWYSCKSTCVRECLG+SINGCN

1

EAGFSNWYSCKSTCVRECLGISINGCN

27

92.6%

NZ_NNBM01000006.1:

Lanthipeptides: CG724_RS19165_lanthipeptide

1

EAGFSNWYSCKSTCVRECLGLSINGCN

27

EAGFSNWYSCKSTCVR CLG+SINGCN

1

EAGFSNWYSCKSTCVRSCLGVSINGCN

27

with 9 more sequence matches

88.9%

NZ_JAFLQY010000001.1and 1 other:

NZ_LWLD01000003.1 Lanthipeptides: A6A28_RS38475_lanthipeptide

Lanthipeptides: J0X20_RS00335_lanthipeptide

1

EAGFSNWYSCKSTCVRECLGLSINGCN

27

EAGFSNWYSCKSTCVRECLG+SIN C+

1

EAGFSNWYSCKSTCVRECLGVSINRCH

27

40.6%

NZ_CP102509.1:

Lanthipeptides: JIW86_RS16015_lanthipeptide

1

EAGFSNWYSCKSTCVREC

18

E GFSNWYSCK TC C

2

EGGFSNWYSCKGTCASYC

19

29.6%

NZ_FNGF01000002.1and 1 other:

NZ_FNGF01000002.1 Lanthipeptides: BLS99_RS09595_lanthipeptide

Lanthipeptides: BLS99_RS09595_lanthipeptide

2

AGFS-NWYSCKSTCVR

16

AGFS +WY+C C

1

AGFSCSWYTCSKCCTH

16

29.0%

NZ_FNAD01000006.1and 1 other:

NZ_FNAD01000006.1 Lanthipeptides: BLQ63_RS27805_lanthipeptide

Lanthipeptides: BLQ63_RS27805_lanthipeptide

3

GFS-NWYSCKSTC

14

GFS +WYSC+ TC

1

GFSCSWYSCRGTC

13

27.6%

NZ_CP030771.1:

Lanthipeptides: C9F11_RS36615_lanthipeptide

5

SNWYSCKSTC

14

SNW SCK TC

4

SNWLSCKGTC

13

25.0%

NZ_FOPA01000013.1:

Lanthipeptides: allorf_32163_32318_lanthipeptide

8

YSCKSTCVREC

18

Y+CKSTC C

9

YTCKSTCTCAC

19

22.2%

NZ_LDCN01000003.1:

Lanthipeptides: allorf_808935_809114_lanthipeptide

8

YSCKSTCVRECLGLSINGC

26

+CKSTC C + GC

12

VTCKSTCTCVCTAMCTPGC

30

21.6%

NZ_FNAD01000006.1:

Lanthipeptides: BLQ63_RS12455_lanthipeptide

1

EAGFS-NWYSCKSTC

14

E+GFS +WY+C C

13

ESGFSCSWYTCSQCC

27

12.7%

NZ_CP011020.1:

Lanthipeptides: allorf_1834656_1834892_lanthipeptide

3

GFSNWYSCKSTCVRECL

19

GF+ SCK T V E

13

GFTGLTSCKETLVLEPF

29

MIBiG 4.0 matches for PET44_RS34185

17.6%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

12

STCVRECLGLSINGCN

27

S C C ++ GCN

5

SLCTPGCKTGALMGCN

20

14.8%

BGC0000563.4 (AEA03263.1):

Lanthipeptide: venezuelin

17

ECLGL

21

EC+GL

4

ECVGL

8

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.05 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.21 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.85 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.37 out of 26.12

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.28 out of 27.04

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.00 out of 24.78

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

PET44_RS34185 - Class I

Cleavage pHMM score: 2.70

RODEO score: 21

Monoisotopic mass: 2850.3 Da

Molecular weight: 2852.2 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 2870.2 Da N = 1

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 143 - 232; Score: 39.8

TFBS definitions

Regulator	Description

NZ_CP115938.1 - Region 1 - NRPS-like,T1PKS,arylpolyene,butyrolactone,other

Download region GenBank file

Download region SVG

Location: 47,196 - 159,230 nt. (total: 112,035 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
butyrolactone: AfsA
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

PET44_RS34895: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

PET44_RS34900: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

PET44_RS34955: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

PET44_RS34965: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

PET44_RS34975: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

PET44_RS34985: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

PET44_RS34990: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

PET44_RS34995: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

PET44_RS35045: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

PET44_RS35135: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

PET44_RS35145: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

PET44_RS35190: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

PET44_RS35200: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

PET44_RS35225: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

Transferases: acylase acyltransferase aminotransferase methyltransferase

PET44_RS34885: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

PET44_RS34950: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

PET44_RS34960: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

PET44_RS35020: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

PET44_RS35040: methyltransferase

smcogs: SMCOG1089: methyltransferase

PET44_RS35065: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: hydrolase phosphatase

PET44_RS35130: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

PET44_RS35210: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: dehydratase lyase

PET44_RS34845: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

PET44_RS35095: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

PET44_RS35110: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

PET44_RS35115: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

PET44_RS35125: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

PET44_RS35000: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

PET44_RS35010: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PET44_RS35055: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PET44_RS35080: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PET44_RS35100: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

PET44_RS35150: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PET44_RS35155: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PET44_RS35215: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Translocases: transporter

PET44_RS35030: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.73	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000850.5	0.73	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002099.3	0.70	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002084.4	0.69	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002164.2	0.65	NRPS	peramine	Epichloe festucae
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.70	PKS	esperamicin	Actinomadura verrucosospora
BGC0000850.5	0.69	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (17):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.99 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.43 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.33 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.88 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.29 out of 27.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.17 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.57 out of 30.98

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 47195 - 159230:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpg)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 79125 - 120922:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpg)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PET44_RS34885: mal

PKS_AT (620..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Propionyl-CoA: 58.3%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 87.9
Methoxymalonyl-CoA: 52.9
Methylmalonyl-CoA: 42.2
inactive: 36.1
Propionyl-CoA: 30.0
Ethylmalonyl-CoA: 26.8
Isobutyryl-CoA: 15.0
trans-1,2-CPDA: 14.4
fatty_acid: 10.7
Benzoyl-CoA: 6.7
2-Methylbutyryl-CoA: 2.2
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PET44_RS35010: Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (9..407): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDSAFGVSTYEVHVLTGGDRAMYGSTEVSSFAAY
Nearest Stachelhaus code(s):: ohMan NVYHLGMVFK (74% 8Å match); Hpg NVYHLGMLFK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

PET44_RS35055: X

AMP-binding (28..425): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SWYPFGYSLAAPVNTSAGEADGLGSSETYHIFLS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

PET44_RS35080: X

AMP-binding (14..388): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SRMG------SFYSVVAGELNVYGTTEIGHALLA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

PET44_RS35150: X

AMP-binding (107..355): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QATLYGFSVLQRDGGCGGDHDGYGLSEAGPNVAL
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein