GCF_026795775.1 - 16 region(s)

Download region SVG

Location: 1 - 22,545 nt. (total: 22,545 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOF23_RS00055: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: peptidase

MOF23_RS00045: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Ligases: ligase

MOF23_RS00005: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.58	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.58	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.77 out of 26.06

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.93 out of 29.25

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.34 out of 28.19

Confidence: medium

Additional weak hits (2):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.85 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.25 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

MOF23_RS00005: Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (463..848): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDASVWQWHFFAGGEIHGYGPTEATVDAAF
Nearest Stachelhaus code(s):: Glu DAWHFGGVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
MogR	Repressor of flagellar motility genes
SypG	Regulator of biofilm formation and host colonization
ZuR variant 1	Zinc-responsive repressor

NZ_JALAWW010000001.1 - Region 2 - terpene

Download region SVG

Location: 97,005 - 118,903 nt. (total: 21,899 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOF23_RS00530: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000313.4	0.36	NRPS	beauvericin	Beauveria bassiana
BGC0002316.2	0.36	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001535.3	0.34	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002255.3	0.29	PKS	lijiquinone	Ascomycota sp. F53
BGC0001496.3	0.29	ribosomal	actinokineosin	Actinokineospora spheciospongiae
BGC0001920.4	0.29	ribosomal	siamycin I	Streptomyces sp.
BGC0001674.5	0.29	ribosomal	MS-271	Streptomyces mirabilis
BGC0002669.2	0.28	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0001736.3	0.27	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000663.5	0.27	terpene	hopene	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000313.4	0.36	NRPS	beauvericin	Beauveria bassiana
BGC0002316.2	0.36	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001535.3	0.34	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002255.3	0.29	PKS	lijiquinone	Ascomycota sp. F53
BGC0001496.3	0.29	ribosomal	actinokineosin	Actinokineospora spheciospongiae
BGC0001920.4	0.29	ribosomal	siamycin I	Streptomyces sp.
BGC0001674.5	0.29	ribosomal	MS-271	Streptomyces mirabilis
BGC0002669.2	0.28	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0001736.3	0.27	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000663.5	0.27	terpene	hopene	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

MOF23_RS00535: T2TS

Domain 1 (4 - 629): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.34 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.70 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.91 out of 27.78

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.50 out of 27.78

Confidence: medium

Additional weak hits (5):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.86 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.62 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.69 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.69 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes

NZ_JALAWW010000001.1 - Region 3 - T3PKS

Download region SVG

Location: 168,038 - 209,135 nt. (total: 41,098 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOF23_RS01060: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase methyltransferase

MOF23_RS01010: isoprenylcysteine carboxyl methyltransferase

smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

MOF23_RS01045: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Ligases: synthase

MOF23_RS01015: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001831.3	0.51	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000282.3	0.49	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001962.3	0.45	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001847.2	0.44	other (other)	1-carbapen-2-em-3-carboxylic acid	Pectobacterium carotovorum
BGC0001475.4	0.43	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002332.2	0.42	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000509.4	0.37	ribosomal	epilancin 15x	Staphylococcus epidermidis
BGC0001882.3	0.36	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001831.3	0.51	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000282.3	0.49	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001962.3	0.45	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001847.2	0.44	other (other)	1-carbapen-2-em-3-carboxylic acid	Pectobacterium carotovorum
BGC0001475.4	0.43	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002332.2	0.42	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000509.4	0.37	ribosomal	epilancin 15x	Staphylococcus epidermidis
BGC0001882.3	0.36	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.87 out of 29.72

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.65 out of 29.38

Confidence: medium

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 28.05 out of 32.74

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.84 out of 29.38

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.89 out of 23.79

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.91 out of 27.55

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.73 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.14 out of 28.19

Confidence: medium

Additional weak hits (7):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.31 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.59 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.03 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.46 out of 32.74

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.18 out of 25.75

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.01 out of 24.78

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
FuR variant 1	Ferric Uptake Regulator
FuR variant 2	Ferric Uptake Regulator
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
ZuR variant 1	Zinc-responsive repressor

NZ_JALAWW010000001.1 - Region 4 - terpene-precursor

Download region SVG

Location: 385,743 - 406,633 nt. (total: 20,891 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

MOF23_RS02135: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: carboxylase

MOF23_RS02205: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

MOF23_RS02170: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

MOF23_RS02175: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000895.5	0.41	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001605.3	0.38	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000639.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000895.5	0.41	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001605.3	0.38	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000639.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

MOF23_RS02175: PT_FPPS_like

Domain 1 (33 - 296): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: IPP, DMAPP → FPP

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.05 out of 27.55

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.69 out of 21.55

Confidence: strong

Additional weak hits (2):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.59 out of 29.25

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 20.50 out of 30.12

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
GnfM	Regulator of nitrogen-fixation genes

NZ_JALAWW010000001.1 - Region 5 - RiPP-like

Download region SVG

Location: 523,685 - 534,041 nt. (total: 10,357 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001638.4	0.41	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0002322.3	0.36	ribosomal	citrocin	Citrobacter pasteurii
BGC0000504.5	0.35	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.5	0.35	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002698.2	0.34	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000626.3	0.32	ribosomal	thuricin	Bacillus thuringiensis
BGC0000538.3	0.32	ribosomal	nisin Z	Lactococcus lactis
BGC0000487.5	0.31	ribosomal	carnocyclin	Carnobacterium maltaromaticum
BGC0000521.3	0.31	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis
BGC0000539.5	0.31	ribosomal	nukacin ISK-1	Staphylococcus warneri

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001638.4	0.41	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0002322.3	0.36	ribosomal	citrocin	Citrobacter pasteurii
BGC0000504.5	0.35	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.5	0.35	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002698.2	0.34	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000626.3	0.32	ribosomal	thuricin	Bacillus thuringiensis
BGC0000538.3	0.32	ribosomal	nisin Z	Lactococcus lactis
BGC0000487.5	0.31	ribosomal	carnocyclin	Carnobacterium maltaromaticum
BGC0000521.3	0.31	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis
BGC0000539.5	0.31	ribosomal	nukacin ISK-1	Staphylococcus warneri

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.07 out of 32.38

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.60 out of 27.18

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.62 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_JALAWW010000002.1 - Region 1 - NRPS

Download region SVG

Location: 226,322 - 291,713 nt. (total: 65,392 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer oxidoreductase

MOF23_RS05860: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

MOF23_RS05865: flavodoxin

smcogs: SMCOG1134: flavodoxin

Transferases: PPTase aminotransferase

MOF23_RS05715: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

MOF23_RS05720: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase hydrolase

MOF23_RS05655: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

MOF23_RS05740: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

MOF23_RS05745: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOF23_RS05750: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOF23_RS05755: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOF23_RS05765: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOF23_RS05770: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOF23_RS05835: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000433.5	0.70	NRPS	surfactin	Bacillus velezensis FZB42

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000433.5	0.70	NRPS	surfactin	Bacillus velezensis FZB42

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.27 out of 26.06

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.88 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.42 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.74 out of 27.78

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.01 out of 23.79

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.64 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.88 out of 27.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.26 out of 24.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.87 out of 28.19

Confidence: medium

Additional weak hits (9):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.74 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.22 out of 28.14

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 30.11

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.54 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.15 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.41 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.59 out of 39.62

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.51 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 226321 - 291713:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Glu - Leu - D-Leu) + (Val) + (Asp) + (D-Leu) + (Leu)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MOF23_RS05745: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LHVSFDAFTFDAFALFGGEINCYGPTEGTVFATA
Nearest Stachelhaus code(s):: Leu DAFFLGCVFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOF23_RS05750: Asp - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (12..415): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YWFSFDLGYTSPKLVLGGEINHYGPTEATIGAIA
Nearest Stachelhaus code(s):: Asp DLTKVGHIGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1057..1445): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDASIWEPFLLTGGDVNNYGPTENTVVATS
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOF23_RS05765: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNGGFDAGTFEGWLIIGGDWNGYGPTENTTFSTS
Nearest Stachelhaus code(s):: Val DAFWIGGTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

MOF23_RS05770: Glu - Leu - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (466..867): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: LSLAFDASVKQADGLIGGETNVYGPTETCVDASV
Nearest Stachelhaus code(s):: Glu DAKDLGVVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1510..1908): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: TETSFDAFMFDGMIMFGGELHMYGPSESTVFATY
Nearest Stachelhaus code(s):: Leu DAFMMGMVFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2938): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDASIWEPFLLTGGDVNNYGPTENTVVATS
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JALAWW010000004.1 - Region 1 - lassopeptide

Download region SVG

Location: 160,874 - 183,406 nt. (total: 22,533 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucosidase hydrolase

MOF23_RS08810: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

MOF23_RS08870: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

MOF23_RS08875: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Translocases: permease

MOF23_RS08835: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002312.2	0.52	ribosomal	ubonodin	Burkholderia ubonensis
BGC0001552.3	0.52	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001634.3	0.51	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0002298.2	0.51	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0002289.2	0.50	ribosomal	Leepeptin	Streptomyces leeuwenhoekii
BGC0002825.2	0.49	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406
BGC0002064.2	0.47	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0002322.3	0.47	ribosomal	citrocin	Citrobacter pasteurii
BGC0002285.2	0.47	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000903.3	0.44	other (other)	fluorometabolite	Streptomyces cattleya

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002312.2	0.52	ribosomal	ubonodin	Burkholderia ubonensis
BGC0001552.3	0.52	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001634.3	0.51	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0002298.2	0.51	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0002289.2	0.50	ribosomal	Leepeptin	Streptomyces leeuwenhoekii
BGC0002825.2	0.49	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406
BGC0002064.2	0.47	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0002322.3	0.47	ribosomal	citrocin	Citrobacter pasteurii
BGC0002285.2	0.47	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000903.3	0.44	other (other)	fluorometabolite	Streptomyces cattleya

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.96 out of 30.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.01 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.04 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.18 out of 28.19

Confidence: medium

Additional weak hits (4):

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 30.11

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.08 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.73 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 25.12 out of 31.73

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 9 - 87; Score: 74.2; RRE type: Thurincin_rSAM_RRE; Location: 26 - 84; Score: 26.4

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JALAWW010000004.1 - Region 2 - CDPS

Download region SVG

Location: 225,216 - 245,962 nt. (total: 20,747 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

MOF23_RS09125: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002103.2	0.90	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000470.6	0.37	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0001157.6	0.37	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.37	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0000469.6	0.36	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0001556.5	0.32	NRPS, PKS	combamide	Streptomyces sp.
BGC0000306.5	0.31	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0001334.5	0.31	other (other)	caldoniamide A, cladoniamide B, cladoniamide C7, cladoniamide D, cladoniamide E, cladoniamide F, cladoniamide G	Streptomyces uncialis
BGC0001337.5	0.31	other (other)	lazarimide A, lazarimide B, lazarimide C	uncultured bacterium
BGC0001148.5	0.30	NRPS, ribosomal	pheganomycin	Streptomyces cirratus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002103.2	0.90	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000470.6	0.37	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0001157.6	0.37	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.37	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0000469.6	0.36	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0001556.5	0.32	NRPS, PKS	combamide	Streptomyces sp.
BGC0000306.5	0.31	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0001334.5	0.31	other (other)	caldoniamide A, cladoniamide B, cladoniamide C7, cladoniamide D, cladoniamide E, cladoniamide F, cladoniamide G	Streptomyces uncialis
BGC0001337.5	0.31	other (other)	lazarimide A, lazarimide B, lazarimide C	uncultured bacterium
BGC0001148.5	0.30	NRPS, ribosomal	pheganomycin	Streptomyces cirratus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.26 out of 27.04

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
DasR	N-acetylglucosamine dependent repressor

NZ_JALAWW010000006.1 - Region 1 - NRPS,betalactone,transAT-PKS

Download region SVG

Location: 1 - 81,967 nt. (total: 81,967 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
betalactone: (HMGL-like and AMP-binding)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOF23_RS09785: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acetyltransferase acylase carboxylase transferase

MOF23_RS09770: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

MOF23_RS09795: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

MOF23_RS09815: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

MOF23_RS09830: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

MOF23_RS09845: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Lyases: hydratase

MOF23_RS09810: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

MOF23_RS09750: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOF23_RS09755: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOF23_RS09790: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOF23_RS09805: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

MOF23_RS09850: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MOF23_RS09855: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOF23_RS09860: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001103.5	1.26	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0002135.2	1.21	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.19	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000402.4	1.19	NRPS	paenilarvin A, paenilarvin B, paenilarvin C	Paenibacillus larvae subsp. larvae DSM 25430
BGC0001128.4	1.15	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	1.14	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	1.12	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	1.11	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.09	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	1.07	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000402.4	0.81	NRPS	paenilarvin A, paenilarvin B, paenilarvin C	Paenibacillus larvae subsp. larvae DSM 25430
BGC0001103.5	0.80	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001090.5	0.72	NRPS, PKS	bacillomycin D	Bacillus velezensis FZB42
BGC0001050.5	0.71	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.56 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.86 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.21 out of 26.06

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.92 out of 26.06

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.60 out of 21.55

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.53 out of 20.97

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.23 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.44 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.54 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.41 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.03 out of 26.06

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.28 out of 23.79

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.72 out of 27.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 23.04 out of 24.78

Confidence: strong

Additional weak hits (9):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.18 out of 26.06

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.44 out of 20.47

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.05 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.38 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.75 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.25 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.51 out of 30.25

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.26 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.00 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 81967:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Tyr) + (Ile) + (fatty_acid - mal - Asn - D-Tyr) + (D-Asn - Gln - Pro - D-Asn) + (Thr)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MOF23_RS09750: Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (285..679): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: TWRFFDGFLTSTIITLAGEANEYGPTENSVATTV
Nearest Stachelhaus code(s):: Tyr DGTITAEVAK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

MOF23_RS09755: Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (481..874): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LNSGFDAVTFEGFLYVGGEHNIYGPTENTTFSTF
Nearest Stachelhaus code(s):: Ile DAFFYGITFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOF23_RS09790: X

AMP-binding (13..445): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NNIVF-GCVLGAHGIMAGSTIAYGQTEASPVITQ
Nearest Stachelhaus code(s):: Z-ahmohOrn FGLHIASTCK (56% 8Å match); Ile DGLFIGIPVK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

MOF23_RS09845: mal

PKS_AT (6..291): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 80.9
inactive: 33.8
Methoxymalonyl-CoA: 21.3
Methylmalonyl-CoA: 13.0
Propionyl-CoA: 12.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOF23_RS09850: fatty_acid - Asn

Search NORINE for peptide: strict or relaxed

CAL_domain (36..478): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 608.7
NH2: 19.5
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (2956..3351): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGEFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOF23_RS09855: Tyr - Asn - Gln - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (268..662): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: SWKYFDAFILNGSTVVGGENNEYGPTENSVVSTF
Nearest Stachelhaus code(s):: Tyr DALSVGEVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1779..2174): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGECNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3288..3693): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDASVQQADGLIGGETNVYGPTETCVDASL
Nearest Stachelhaus code(s):: Gln DAQDLGVVDK (100% 8Å match); Ile DAQDLGVVDK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4337..4733): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LYEAFDVCYQESFLIAAGEHNHYGPSETHVVTMY
Nearest Stachelhaus code(s):: Pro DVQFIAHVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOF23_RS09860: Asn - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (268..663): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGDFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1778..2177): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNNHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_JALAWW010000006.1 - Region 2 - NRPS,PKS-like,T3PKS,transAT-PKS

Download region SVG

Location: 136,045 - 250,883 nt. (total: 114,839 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T3PKS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
PKS-like: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

MOF23_RS10450: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MOF23_RS10470: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

MOF23_RS10505: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MOF23_RS10510: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MOF23_RS10515: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase protease

MOF23_RS10435: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

MOF23_RS10525: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: hydratase

MOF23_RS10480: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

MOF23_RS10485: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

MOF23_RS10455: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MOF23_RS10460: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOF23_RS10465: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MOF23_RS10475: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOF23_RS10490: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

MOF23_RS10495: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.36	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001164.3	1.30	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000205.3	1.28	PKS	bryostatin	Candidatus Endobugula sertula
BGC0001135.5	1.27	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001160.5	1.27	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001132.4	1.26	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	1.25	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	1.24	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001089.5	1.24	NRPS, PKS	bacillaene	Bacillus velezensis FZB42
BGC0002286.3	1.23	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001089.5	0.77	NRPS, PKS	bacillaene	Bacillus velezensis FZB42
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000205.3	0.65	PKS	bryostatin	Candidatus Endobugula sertula
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.77 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.88 out of 26.06

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.32 out of 30.25

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.20 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.90 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.25 out of 28.19

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 24.56 out of 24.78

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.85 out of 25.31

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.06 out of 28.19

Confidence: medium

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.82 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.86 out of 30.25

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.22 out of 20.01

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.52 out of 33.73

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.69 out of 27.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.54 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.81 out of 36.54

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 136044 - 250883:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - Gly - ccmal - ohmal - mal) + (ccmal - mal - ohmal - mal) + (Me-ccmal - ohmal - mal) + (Ala - ccmal - ccmal - Me-ccmal) + (mal - mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MOF23_RS10460: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (472..880): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TFLTFDVSISEGNFMVAGEDNIYGPTEASIYAAY
Nearest Stachelhaus code(s):: Ala DVSNMAIIYK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

MOF23_RS10475: fatty_acid - Gly

Search NORINE for peptide: strict or relaxed

CAL_domain (60..476): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 17.3
NH2: 10.5
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1159..1554): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDIAALELQALCGGEWNMFGPTETTIWSAV
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOF23_RS10505: mal

PKS_AT (4..284): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 76.1
inactive: 36.8
Methoxymalonyl-CoA: 29.0
Methylmalonyl-CoA: 20.3
Propionyl-CoA: 14.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOF23_RS10510: pk

PKS_AT (7..293): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 29.8
Malonyl-CoA: 23.1
Isobutyryl-CoA: 9.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOF23_RS10515: mal

PKS_AT (4..283): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 94.1
Methoxymalonyl-CoA: 45.7
inactive: 38.0
Methylmalonyl-CoA: 33.4
Propionyl-CoA: 24.7
Ethylmalonyl-CoA: 12.6
CHC-CoA: 12.4
2-Methylbutyryl-CoA: 9.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JALAWW010000010.1 - Region 1 - sactipeptide

Download region SVG

Location: 189,571 - 211,183 nt. (total: 21,613 nt) Show pHMM detection rules used

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Sactipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer

MOF23_RS17265: flavodoxin

smcogs: SMCOG1134: flavodoxin

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000602.5	0.88	ribosomal	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000514.5	0.38	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0001137.5	0.34	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002666.2	0.31	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0000310.5	0.30	NRPS	bacitracin	Bacillus licheniformis
BGC0000838.3	0.29	PKS	flexirubin	Flavobacterium johnsoniae UW101
BGC0001048.5	0.24	NRPS, PKS, saccharide	tallysomycin A, tallysomycin B	Streptoalloteichus hindustanus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000602.5	0.88	ribosomal	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000514.5	0.38	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0001137.5	0.34	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002666.2	0.31	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0000310.5	0.30	NRPS	bacitracin	Bacillus licheniformis
BGC0000838.3	0.29	PKS	flexirubin	Flavobacterium johnsoniae UW101
BGC0001048.5	0.24	NRPS, PKS, saccharide	tallysomycin A, tallysomycin B	Streptoalloteichus hindustanus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Sactipeptide predictions

Sactipeptide(s) for MOF23_RS17300

MOF23_RS17300

Leader:

MKKAVIVENK

Core:

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

antiSMASH-DB 4.0 matches for MOF23_RS17300

100.0%

NC_000964.3and 235 others:

NC_014479.1 Sactipeptides: BSUW23_RS18740_sactipeptideNC_014639.1 Sactipeptides: BATR1942_RS15950_sactipeptideNC_014976.1 Sactipeptides: BSN5_RS09700_sactipeptideNC_016047.1 Sactipeptides: GYO_RS41165_sactipeptideNC_017195.1 Sactipeptides: I33_RS18040_sactipeptideNC_017743.1 Sactipeptides: MY9_RS18920_sactipeptideNC_019896.1 Sactipeptides: A7A1_RS01935_sactipeptideNC_020244.1 Sactipeptides: C663_RS18295_sactipeptideNZ_BDDH01000003.1 Sactipeptides: A7P71_RS10610_sactipeptideNZ_CABIVP010000002.1 Sactipeptides: FY199_RS09010_sactipeptideNZ_CP007409.1 Sactipeptides: Q433_RS18950_sactipeptideNZ_CP009796.1 Sactipeptides: OB04_RS19085_sactipeptideNZ_CP011101.1 Sactipeptides: bslm_RS18365_sactipeptideNZ_CP011534.1 Sactipeptides: ABA10_RS18725_sactipeptideNZ_CP011802.1 Sactipeptides: D068_RS17505_sactipeptideNZ_CP016767.1 Sactipeptides: BCV50_RS14935_sactipeptideNZ_CP017072.1 Sactipeptides: BGM23_RS02945_sactipeptideNZ_CP017112.1 Sactipeptides: BS16045_RS19810_sactipeptideNZ_CP017313.1 Sactipeptides: BH660_RS14630_sactipeptideNZ_CP017314.1 Sactipeptides: BSBS38_RS19215_sactipeptideNZ_CP017676.1 Sactipeptides: BKN48_RS08085_sactipeptideNZ_CP018173.1 Sactipeptides: BAX60_RS03615_sactipeptideNZ_CP020367.1 Sactipeptides: BSK2_RS19060_sactipeptideNZ_CP020722.1 Sactipeptides: B7470_RS09560_sactipeptideNZ_CP020915.1 Sactipeptides: B9L64_RS11255_sactipeptideNZ_CP021169.1 Sactipeptides: B9N48_RS18685_sactipeptideNZ_CP021498.1 Sactipeptides: S101444_RS19170_sactipeptideNZ_CP021892.1 Sactipeptides: S100333_RS19720_sactipeptideNZ_CP021903.1 Sactipeptides: CD007_RS18975_sactipeptideNZ_CP021911.1 Sactipeptides: CDO84_RS18225_sactipeptideNZ_CP021921.1 Sactipeptides: S101392_RS19440_sactipeptideNZ_CP022391.1 Sactipeptides: CFK25_RS18875_sactipeptideNZ_CP022890.1 Sactipeptides: CJZ70_RS01210_sactipeptideNZ_CP023257.1 Sactipeptides: CLD04_RS19470_sactipeptideNZ_CP023409.1 Sactipeptides: Bateq7PJ16_RS20450_sactipeptideNZ_CP025941.1 Sactipeptides: C0W65_RS07300_sactipeptideNZ_CP026010.1 Sactipeptides: BS11774_RS03710_sactipeptideNZ_CP026030.1 Sactipeptides: C2H91_RS12110_sactipeptideNZ_CP026035.1 Sactipeptides: C2H96_RS13375_sactipeptideNZ_CP026036.1 Sactipeptides: C2H93_RS16885_sactipeptideNZ_CP026521.1 Sactipeptides: C1T29_RS22385_sactipeptideNZ_CP028201.1 Sactipeptides: C7M16_RS17535_sactipeptideNZ_CP028202.1 Sactipeptides: C7M17_RS17600_sactipeptideNZ_CP028217.1 Sactipeptides: C7M29_RS06900_sactipeptideNZ_CP028218.1 Sactipeptides: C7M30_RS12605_sactipeptideNZ_CP028812.1 Sactipeptides: DAE22_RS20770_sactipeptideNZ_CP029364.1 Sactipeptides: DIC78_RS12275_sactipeptideNZ_CP029461.1 Sactipeptides: DJ572_RS18795_sactipeptideNZ_CP029465.1 Sactipeptides: DKG76_RS19825_sactipeptideNZ_CP029609.1 Sactipeptides: DL538_RS20030_sactipeptideNZ_CP031675.1 Sactipeptides: DYS67_RS19275_sactipeptideNZ_CP031783.1 Sactipeptides: D0808_RS00710_sactipeptideNZ_CP031784.1 Sactipeptides: D0819_RS14700_sactipeptideNZ_CP032853.1 Sactipeptides: D9C10_RS17955_sactipeptideNZ_CP032855.1 Sactipeptides: D9C11_RS09165_sactipeptideNZ_CP035161.1 Sactipeptides: EQH88_RS19675_sactipeptideNZ_CP035167.1 Sactipeptides: EQJ08_RS19095_sactipeptideNZ_CP035226.1 Sactipeptides: EQW70_RS20085_sactipeptideNZ_CP035231.1 Sactipeptides: EQZ01_RS19685_sactipeptideNZ_CP035391.1 Sactipeptides: ES965_RS19370_sactipeptideNZ_CP035395.1 Sactipeptides: ES968_RS19740_sactipeptideNZ_CP035401.1 Sactipeptides: ETA19_RS19595_sactipeptideNZ_CP035402.1 Sactipeptides: ES969_RS19660_sactipeptideNZ_CP035403.1 Sactipeptides: ETA15_RS19805_sactipeptideNZ_CP035406.1 Sactipeptides: ETK61_RS20735_sactipeptideNZ_CP035413.1 Sactipeptides: ETL58_RS19505_sactipeptideNZ_CP039935.1 Sactipeptides: FCJ76_RS19255_sactipeptideNZ_CP045006.1 Sactipeptides: F9B13_RS01950_sactipeptideNZ_CP045425.1 Sactipeptides: GCU76_RS20710_sactipeptideNZ_CP045816.1 Sactipeptides: GII86_RS19920_sactipeptideNZ_CP045824.1 Sactipeptides: GII78_RS20125_sactipeptideNZ_CP046591.1 Sactipeptides: GO004_RS15965_sactipeptideNZ_CP046860.1 Sactipeptides: GPJ55_RS11605_sactipeptideNZ_CP047645.1 Sactipeptides: GSN02_RS19265_sactipeptideNZ_CP049924.1 Sactipeptides: G4G26_RS18960_sactipeptideNZ_CP050705.1 Sactipeptides: HCU65_RS18920_sactipeptideNZ_CP051462.1 Sactipeptides: HC662_RS19240_sactipeptideNZ_CP051464.1 Sactipeptides: HC660_RS18970_sactipeptideNZ_CP054050.1 Sactipeptides: HNV25_RS02005_sactipeptideNZ_CP054177.1 Sactipeptides: HR084_RS18935_sactipeptideNZ_CP054584.1 Sactipeptides: HT135_RS19775_sactipeptideNZ_CP060193.1 Sactipeptides: H7F27_RS02180_sactipeptideNZ_CP060417.1 Sactipeptides: H8S71_RS18495_sactipeptideNZ_CP061284.1 Sactipeptides: ICJ61_RS19715_sactipeptideNZ_CP061870.1 Sactipeptides: IE382_RS22305_sactipeptideNZ_CP062497.1 Sactipeptides: IHV08_RS19770_sactipeptideNZ_CP063276.1 Sactipeptides: IM743_RS18070_sactipeptideNZ_CP065858.1 Sactipeptides: I7X10_RS03370_sactipeptideNZ_CP069789.1 Sactipeptides: JR441_RS19085_sactipeptideNZ_CP070483.1 Sactipeptides: JQX68_RS19175_sactipeptideNZ_CP070976.1 Sactipeptides: JYG31_RS19675_sactipeptideNZ_CP071043.1 Sactipeptides: JS609_RS19245_sactipeptideNZ_CP073265.1 Sactipeptides: KCX77_RS18900_sactipeptideNZ_CP075344.1 Sactipeptides: KIL00_RS20100_sactipeptideNZ_CP076083.1 Sactipeptides: KFF76_RS18635_sactipeptideNZ_CP079759.1 Sactipeptides: KXZ66_RS19695_sactipeptideNZ_CP080508.1 Sactipeptides: K0V03_RS08595_sactipeptideNZ_CP089148.1 Sactipeptides: LRO88_RS20980_sactipeptideNZ_CP090125.1 Sactipeptides: LXE94_RS19505_sactipeptideNZ_CP093289.1 Sactipeptides: MNG38_RS19730_sactipeptideNZ_CP093546.1 Sactipeptides: MOW04_RS19180_sactipeptideNZ_CP095736.1 Sactipeptides: MX663_RS20090_sactipeptideNZ_CP096590.1 Sactipeptides: M0696_RS18995_sactipeptideNZ_CP096889.1 Sactipeptides: EFK13_RS19225_sactipeptideNZ_CP098738.1 Sactipeptides: NDR85_RS18965_sactipeptideNZ_CP100651.1 Sactipeptides: NLW79_RS19990_sactipeptideNZ_CP100752.1 Sactipeptides: NLV76_RS19060_sactipeptideNZ_CP101718.1 Sactipeptides: NPA28_RS19075_sactipeptideNZ_CP101936.1 Sactipeptides: NP434_RS18980_sactipeptideNZ_CP103352.1 Sactipeptides: NX823_RS19780_sactipeptideNZ_CP104878.1 Sactipeptides: N8A75_RS20105_sactipeptideNZ_CP107539.1 Sactipeptides: OEG95_RS19105_sactipeptideNZ_CP110264.1 Sactipeptides: OMK57_RS18975_sactipeptideNZ_CP114899.1 Sactipeptides: O6U12_RS19480_sactipeptideNZ_CP116773.1 Sactipeptides: PNF29_RS01990_sactipeptideNZ_FTMW01000001.1 Sactipeptides: BW968_RS02045_sactipeptideNZ_JAAUXF010000005.1 Sactipeptides: HC742_RS19325_sactipeptideNZ_JABRUZ010000003.1 Sactipeptides: HRF55_RS03085_sactipeptideNZ_JABRVH010000018.1 Sactipeptides: HRF53_RS09100_sactipeptideNZ_JABUKD010000002.1 Sactipeptides: HRW04_RS09345_sactipeptideNZ_JAEACL010000001.1 Sactipeptides: I5F14_RS00800_sactipeptideNZ_JAHVOC010000002.1 Sactipeptides: KXD37_RS07830_sactipeptideNZ_JAJFDG010000003.1 Sactipeptides: LJF29_RS11575_sactipeptideNZ_JAJHUI010000011.1 Sactipeptides: LK399_RS16325_sactipeptideNZ_JALAJC010000012.1 Sactipeptides: MOB18_RS16080_sactipeptideNZ_JALAKW010000005.1 Sactipeptides: MOB93_RS12665_sactipeptideNZ_JALAKZ010000001.1 Sactipeptides: MOB76_RS02240_sactipeptideNZ_JALALA010000011.1 Sactipeptides: MOB82_RS15020_sactipeptideNZ_JALALE010000020.1 Sactipeptides: MOB33_RS20855_sactipeptideNZ_JALALO010000006.1 Sactipeptides: MOB75_RS09230_sactipeptideNZ_JALAMD010000002.1 Sactipeptides: MOB22_RS02315_sactipeptideNZ_JALAME010000005.1 Sactipeptides: MOC02_RS13805_sactipeptideNZ_JALAMJ010000012.1 Sactipeptides: MOB80_RS16635_sactipeptideNZ_JALAMO010000007.1 Sactipeptides: MOB98_RS08535_sactipeptideNZ_JALAMR010000019.1 Sactipeptides: MOC09_RS17975_sactipeptideNZ_JALAMZ010000002.1 Sactipeptides: MOC43_RS01370_sactipeptideNZ_JALANN010000012.1 Sactipeptides: MOC49_RS18290_sactipeptideNZ_JALANX010000001.1 Sactipeptides: MOC25_RS03365_sactipeptideNZ_JALAPT010000001.1 Sactipeptides: MOC95_RS01580_sactipeptideNZ_JALAPV010000005.1 Sactipeptides: MOC91_RS13515_sactipeptideNZ_JALAPW010000003.1 Sactipeptides: MOD18_RS06235_sactipeptideNZ_JALAPX010000003.1 Sactipeptides: MOC97_RS06805_sactipeptideNZ_JALAPZ010000002.1 Sactipeptides: MOC81_RS03830_sactipeptideNZ_JALAQA010000008.1 Sactipeptides: MOD07_RS14955_sactipeptideNZ_JALAQC010000001.1 Sactipeptides: MOD00_RS01290_sactipeptideNZ_JALAQD010000002.1 Sactipeptides: MOD08_RS05770_sactipeptideNZ_JALAQE010000002.1 Sactipeptides: MOD19_RS04725_sactipeptideNZ_JALASB010000002.1 Sactipeptides: MOD42_RS03685_sactipeptideNZ_JALASC010000024.1 Sactipeptides: MOD69_RS20580_sactipeptideNZ_JALASM010000006.1 Sactipeptides: MOD51_RS10970_sactipeptideNZ_JALASR010000006.1 Sactipeptides: MOD87_RS10780_sactipeptideNZ_JALAST010000011.1 Sactipeptides: MOE17_RS14670_sactipeptideNZ_JALASW010000005.1 Sactipeptides: MOE15_RS06925_sactipeptideNZ_JALATC010000001.1 Sactipeptides: MOD56_RS03380_sactipeptideNZ_JALATD010000001.1 Sactipeptides: MOE02_RS03350_sactipeptideNZ_JALATE010000006.1 Sactipeptides: MOD98_RS11440_sactipeptideNZ_JALATF010000003.1 Sactipeptides: MOD44_RS09960_sactipeptideNZ_JALATG010000002.1 Sactipeptides: MOE16_RS03490_sactipeptideNZ_JALATJ010000007.1 Sactipeptides: MOD90_RS15770_sactipeptideNZ_JALATU010000001.1 Sactipeptides: MOE27_RS01985_sactipeptideNZ_JALATV010000005.1 Sactipeptides: MOD97_RS07020_sactipeptideNZ_JALAUA010000008.1 Sactipeptides: MOD32_RS16030_sactipeptideNZ_JALAUD010000001.1 Sactipeptides: MOE28_RS03345_sactipeptideNZ_JALAUJ010000006.1 Sactipeptides: MOE37_RS12685_sactipeptideNZ_JALAUK010000012.1 Sactipeptides: MOE38_RS11825_sactipeptideNZ_JALAUV010000003.1 Sactipeptides: MOE71_RS06545_sactipeptideNZ_JALAUW010000015.1 Sactipeptides: MOE83_RS13210_sactipeptideNZ_JALAVA010000002.1 Sactipeptides: MOE81_RS02625_sactipeptideNZ_JALAVE010000001.1 Sactipeptides: MOE67_RS03645_sactipeptideNZ_JALAVI010000011.1 Sactipeptides: MOE80_RS14660_sactipeptideNZ_JALAVK010000006.1 Sactipeptides: MOE96_RS10120_sactipeptideNZ_JALAVL010000002.1 Sactipeptides: MOE60_RS03290_sactipeptideNZ_JALAVM010000009.1 Sactipeptides: MOE49_RS16195_sactipeptideNZ_JALAVO010000008.1 Sactipeptides: MOE63_RS14665_sactipeptideNZ_JALAVQ010000003.1 Sactipeptides: MOE59_RS02420_sactipeptideNZ_JALAVS010000002.1 Sactipeptides: MOE46_RS02250_sactipeptideNZ_JALAVT010000005.1 Sactipeptides: MOF25_RS08325_sactipeptideNZ_JALAVU010000004.1 Sactipeptides: MOE78_RS09660_sactipeptideNZ_JALAVV010000004.1 Sactipeptides: MOE66_RS02855_sactipeptideNZ_JALAVW010000001.1 Sactipeptides: MOE86_RS01005_sactipeptideNZ_JALAVX010000009.1 Sactipeptides: MOE40_RS07525_sactipeptideNZ_JALAVZ010000002.1 Sactipeptides: MOF00_RS02525_sactipeptideNZ_JALAWB010000008.1 Sactipeptides: MOE87_RS15020_sactipeptideNZ_JALAWK010000002.1 Sactipeptides: MOF06_RS12140_sactipeptideNZ_JALAWW010000010.1 Sactipeptides: MOF23_RS17300_sactipeptideNZ_JALAXQ010000012.1 Sactipeptides: MOF24_RS14120_sactipeptideNZ_JALAXV010000001.1 Sactipeptides: MOF15_RS00375_sactipeptideNZ_JALAYA010000016.1 Sactipeptides: MOF34_RS08915_sactipeptideNZ_JALAYD010000019.1 Sactipeptides: MOF39_RS20725_sactipeptideNZ_JALNTO010000006.1 Sactipeptides: MTN95_RS11045_sactipeptideNZ_JAMDFN010000008.1 Sactipeptides: M3M31_RS18245_sactipeptideNZ_JAMYDW010000003.1 Sactipeptides: NHM07_RS10830_sactipeptideNZ_JANBMP010000002.1 Sactipeptides: NL430_RS07940_sactipeptideNZ_JANDGG010000001.1 Sactipeptides: NKU38_RS03365_sactipeptideNZ_JANFAP010000001.1 Sactipeptides: NEC81_RS02065_sactipeptideNZ_JAQFFE010000015.1 Sactipeptides: PG051_RS13540_sactipeptideNZ_JAQOXM010000001.1 Sactipeptides: PO770_RS01950_sactipeptideNZ_JH600279.1 Sactipeptides: GYU_RS0104160_sactipeptideNZ_JXHL01000020.1 Sactipeptides: B4069_RS07025_sactipeptideNZ_JXHP01000031.1 Sactipeptides: B4073_RS09425_sactipeptideNZ_JXHR01000010.1 Sactipeptides: B4146_RS06925_sactipeptideNZ_KZ848487.1 Sactipeptides: DSL71_RS14015_sactipeptideNZ_LPVE01000021.1 Sactipeptides: AU385_RS06600_sactipeptideNZ_LSBB01000001.1 Sactipeptides: AXI57_RS01770_sactipeptideNZ_LUUT01000004.1 Sactipeptides: A6751_RS18460_sactipeptideNZ_MOEO01000004.1 Sactipeptides: BLL41_RS09830_sactipeptideNZ_MUXL01000002.1 Sactipeptides: B0W20_RS08845_sactipeptideNZ_MZZI01000001.1 Sactipeptides: B2G85_RS18515_sactipeptideNZ_NBBO01000003.1 Sactipeptides: B6K89_RS01830_sactipeptideNZ_NERK01000024.1 Sactipeptides: B9T64_RS18540_sactipeptideNZ_NJRD01000003.1 Sactipeptides: CE053_RS09115_sactipeptideNZ_NJRE01000002.1 Sactipeptides: CE047_RS07205_sactipeptideNZ_NKAK01000003.1 Sactipeptides: CE489_RS10400_sactipeptideNZ_NMOM01000004.1 Sactipeptides: CFI07_RS07245_sactipeptideNZ_PHIE01000002.1 Sactipeptides: CVV77_RS10760_sactipeptideNZ_PJCT01000002.1 Sactipeptides: CW370_RS11825_sactipeptideNZ_PVQM01000002.1 Sactipeptides: C6W22_RS11490_sactipeptideNZ_PVQN01000002.1 Sactipeptides: C6W23_RS05885_sactipeptideNZ_PVRK01000001.1 Sactipeptides: C6350_RS02025_sactipeptideNZ_PVWC01000004.1 Sactipeptides: C6372_RS11675_sactipeptideNZ_QRFZ01000012.1 Sactipeptides: DXT72_RS19010_sactipeptideNZ_SDKE01000003.1 Sactipeptides: EUA35_RS12130_sactipeptideNZ_SHOB01000002.1 Sactipeptides: ES060_RS14270_sactipeptideNZ_SIRN01000006.1 Sactipeptides: EYH65_RS15720_sactipeptideNZ_SNWK01000001.1 Sactipeptides: DFO69_RS02055_sactipeptideNZ_SOBO01000012.1 Sactipeptides: DFO78_RS18210_sactipeptideNZ_SORJ01000001.1 Sactipeptides: BJ795_RS03350_sactipeptideNZ_VBRP01000025.1 Sactipeptides: FE220_RS07065_sactipeptideNZ_VFNF01000001.1 Sactipeptides: FB592_RS03405_sactipeptideNZ_VIOH01000001.1 Sactipeptides: FLN47_RS01935_sactipeptideNZ_VLJK01000012.1 Sactipeptides: L605_RS10195_sactipeptideNZ_VLJL01000006.1 Sactipeptides: L604_RS05585_sactipeptideNZ_VLJX01000001.1 Sactipeptides: L609_RS01950_sactipeptideNZ_VTEK01000003.1 Sactipeptides: FZC71_RS10310_sactipeptideNZ_WTKJ01000004.1 Sactipeptides: NWT17_RS06185_sactipeptide

Sactipeptides: BSU_37350_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

97.0%

NZ_CP092751.1:

Sactipeptides: MKF32_RS18515_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFEIAGATGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEIAGATGLFGLWG

33

93.9%

NZ_CP048852.1:

Sactipeptides: G4P54_RS19300_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFE+AGATGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEVAGATGLFGLWG

33

with 15 more sequence matches

Only the first 10 are displayed here.

90.9%

NZ_JALAKO010000018.1and 1 other:

NZ_JALAOG010000035.1 Sactipeptides: MOC96_RS18415_sactipeptide

Sactipeptides: MOB26_RS11095_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFEI G TGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEIGGVTGLFGLWG

33

87.9%

NZ_CP026362.1and 3 others:

NZ_CP033052.1 Sactipeptides: D9779_RS19215_sactipeptideNZ_JALAPG010000031.1 Sactipeptides: MOC70_RS13155_sactipeptideNZ_JALAQI010000016.1 Sactipeptides: MOD13_RS11485_sactipeptide

Sactipeptides: BV11031_RS20865_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDG IPDFEI G TGLFGLWG

1

GCATCSIGAVCLVDGFIPDFEIGGVTGLFGLWG

33

78.8%

NZ_NXEM01000021.1:

Sactipeptides: CPT06_RS05595_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GC TCSIGA CLV+GPIPDF+ G TGLFGLWG

1

GCTTCSIGAVCLVNGPIPDFKTGGVTGLFGLWG

33

72.7%

NC_014925.1and 17 others:

NZ_ANOI01000001.1 Sactipeptides: F779_RS13290_sactipeptideNZ_CP031604.1 Sactipeptides: DNJ55_RS07055_sactipeptideNZ_CP031605.1 Sactipeptides: DRC71_RS00165_sactipeptideNZ_CP035741.1 Sactipeptides: EW136_RS01865_sactipeptideNZ_CP039747.1 Sactipeptides: EFT29_RS00935_sactipeptideNZ_CP054206.2 Sactipeptides: HP560_RS11995_sactipeptideNZ_CP060700.1 Sactipeptides: H9Q12_RS10940_sactipeptideNZ_CP065920.1 Sactipeptides: JC281_RS11580_sactipeptideNZ_CP076465.1 Sactipeptides: KDE16_RS00560_sactipeptideNZ_JANPRJ010000013.1 Sactipeptides: NVR03_RS10250_sactipeptideNZ_JANPRN010000039.1 Sactipeptides: NVR04_RS07875_sactipeptideNZ_JTKO01000012.1 Sactipeptides: NO87_RS10650_sactipeptideNZ_LR134267.1 Sactipeptides: EL085_RS11430_sactipeptideNZ_MQMO01000006.1 Sactipeptides: BSR38_RS07375_sactipeptideNZ_MQNF01000024.1 Sactipeptides: BSR36_RS12515_sactipeptideNZ_QQPJ01000025.1 Sactipeptides: DV949_RS11300_sactipeptideNZ_SEZW01000001.1 Sactipeptides: EWV33_RS08610_sactipeptide

Sactipeptides: SPSINT_RS00615_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+TCSIGAACL+DGP+PDFE+ G TG+FGL

1

GCSTCSIGAACLIDGPLPDFEVMGITGIFGL

31

69.7%

NZ_CP027770.1:

Sactipeptides: C7J90_RS04260_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ CSIGAACL+DGP PDFE+ G TG FGL

1

GCSACSIGAACLIDGPFPDFEVMGITGTFGL

31

69.7%

NZ_CP066885.1:

Sactipeptides: JGZ27_RS11325_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+TCSIG ACL+DGP+PDFE+ G TG+FGL

1

GCSTCSIGVACLIDGPLPDFEVMGITGIFGL

31

69.7%

NZ_CP094808.1and 3 others:

NZ_CP094809.1 Sactipeptides: MUA95_RS01320_sactipeptideNZ_CP094813.1 Sactipeptides: MUA84_RS01300_sactipeptideNZ_VKCY01000004.1 Sactipeptides: FNK43_RS05155_sactipeptide

Sactipeptides: MUA11_RS01375_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C+IGAACL DGPIPDFE+AG TG FG+

1

GCSACAIGAACLADGPIPDFEVAGITGTFGI

31

66.7%

NZ_ATDF02000020.1and 1 other:

NZ_KV827785.1 Sactipeptides: HMPREF2580_RS10900_sactipeptide

Sactipeptides: M462_RS08950_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C++GAACL DGPIPDFE+AG TG FG+

1

GCSACAVGAACLADGPIPDFEVAGITGTFGM

31

63.6%

NC_022584.1and 2 others:

NZ_CP047883.1 Sactipeptides: M594_RS05585_sactipeptideNZ_KV802690.1 Sactipeptides: HMPREF2764_RS03300_sactipeptide

Sactipeptides: N596_RS03165_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GC+ C+IGA CL DGPIPDFEIAG + +F +G

1

GCSVCAIGAVCLADGPIPDFEIAGVSAVFTAFG

33

63.6%

NZ_CP063367.1and 1 other:

NZ_LR134263.1 Sactipeptides: EL101_RS12790_sactipeptide

Sactipeptides: IPU22_RS12430_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C++GA CL DGPIPDFE+AG TG FG+

1

GCSACAVGAVCLADGPIPDFEVAGITGTFGI

31

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.21 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.64 out of 27.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (3):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.07 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.53 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.81 out of 33.14

Confidence: weak

RREFinder

Sactipeptides

TFBS Finder

RRE predictions

: RRE type: Subtilosin_rSAM_RRE; Location: 5 - 98; Score: 99.1

Core peptide predictions

MOF23_RS17300: Putative sactipeptide; RODEO score: 33.0; Core sequence, approximate: GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism

NZ_JALAWW010000010.1 - Region 2 - other

Download region SVG

Location: 214,486 - 255,904 nt. (total: 41,419 nt) Show pHMM detection rules used

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOF23_RS17475: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOF23_RS17495: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOF23_RS17525: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase transferase

MOF23_RS17480: aminotransferase

smcogs: SMCOG1019: aminotransferase

MOF23_RS17555: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase lyase

MOF23_RS17490: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

MOF23_RS17545: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

MOF23_RS17550: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Translocases: permease

MOF23_RS17515: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001184.4	0.84	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000888.5	0.83	other (other)	bacilysin	Bacillus sp. CS93
BGC0000773.3	0.55	saccharide	lipopolysaccharide	Escherichia coli
BGC0000898.5	0.54	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000794.5	0.54	saccharide	S-layer glycan	Geobacillus stearothermophilus
BGC0000790.3	0.54	saccharide	O-antigen	Escherichia coli
BGC0000791.3	0.54	saccharide	O-antigen	Cronobacter sakazakii
BGC0000795.3	0.52	saccharide	S-layer glycan	Aneurinibacillus thermoaerophilus
BGC0000827.3	0.52	other (other)	staurosporine	Salinispora arenicola CNS-205
BGC0000792.3	0.52	saccharide	polysaccharide	Enterococcus faecalis OG1RF

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001184.4	0.84	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000888.5	0.83	other (other)	bacilysin	Bacillus sp. CS93
BGC0000773.3	0.55	saccharide	lipopolysaccharide	Escherichia coli
BGC0000898.5	0.54	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000794.5	0.54	saccharide	S-layer glycan	Geobacillus stearothermophilus
BGC0000790.3	0.54	saccharide	O-antigen	Escherichia coli
BGC0000791.3	0.54	saccharide	O-antigen	Cronobacter sakazakii
BGC0000795.3	0.52	saccharide	S-layer glycan	Aneurinibacillus thermoaerophilus
BGC0000827.3	0.52	other (other)	staurosporine	Salinispora arenicola CNS-205
BGC0000792.3	0.52	saccharide	polysaccharide	Enterococcus faecalis OG1RF

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.85 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.36 out of 27.78

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.33 out of 20.97

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.05 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.35 out of 26.06

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.92 out of 30.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.70 out of 26.06

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (6):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.24 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.27 out of 36.54

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.37 out of 20.01

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 26.09 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.22 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.64 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis

NZ_JALAWW010000011.1 - Region 1 - NRPS,T1PKS

Download region SVG

Location: 53,592 - 134,944 nt. (total: 81,353 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOF23_RS18115: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

MOF23_RS18130: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: formyltransferase

MOF23_RS18020: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: amidase esterase hydrolase phosphatase

MOF23_RS18100: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

MOF23_RS18110: thioesterase

smcogs: SMCOG1004: thioesterase

MOF23_RS18120: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

MOF23_RS18185: amidase

smcogs: SMCOG1105: amidase

Ligases: ligase synthase

MOF23_RS18095: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOF23_RS18135: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOF23_RS18140: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOF23_RS18145: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MOF23_RS18150: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MOF23_RS18155: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: permease

MOF23_RS18040: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000426.5	0.70	NRPS	sevadicin	Paenibacillus larvae
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001133.4	0.68	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000426.5	0.68	NRPS	sevadicin	Paenibacillus larvae
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001133.4	0.67	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 26.94 out of 27.78

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.63 out of 26.85

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.78 out of 20.97

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.45 out of 26.85

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.10 out of 26.06

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 25.31

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.78 out of 24.78

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 25.34 out of 29.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.13 out of 26.06

Confidence: medium

Additional weak hits (5):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.12 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.83 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.28 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.18 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.59 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 53591 - 134944:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (Asn - ohmal - Glu) + (ohmal) + (mal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MOF23_RS18095: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (464..859): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YSASFDLTVTSTKLIVGGEFNEYGPTEATVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

MOF23_RS18135: Asn - mal

Search NORINE for peptide: strict or relaxed

AMP-binding (480..874): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATFDLTVTSTKLILGGEFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

PKS_AT (1595..1889): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 88.1
inactive: 61.8
Methoxymalonyl-CoA: 40.7
Methylmalonyl-CoA: 29.2
Propionyl-CoA: 27.5
Isobutyryl-CoA: 10.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOF23_RS18140: Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (273..674): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: LGIAFDASVQTPDAMAGGETNNYGPTECTVQSAA
Nearest Stachelhaus code(s):: Ile DAQDLGVVDK (68% 8Å match); Gln or Glu DAQDLGVVDK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

MOF23_RS18145: mal

PKS_AT (521..804): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 144.3
inactive: 98.9
Methoxymalonyl-CoA: 54.9
Methylmalonyl-CoA: 40.3
Propionyl-CoA: 32.6
Isobutyryl-CoA: 15.5
fatty_acid: 13.2
Benzoyl-CoA: 11.8
Acetyl-CoA: 10.1
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOF23_RS18150: mal - mal

PKS_AT (531..797): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 23.6
Methoxymalonyl-CoA: 15.8
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (1508..1796): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 172.7
inactive: 102.8
Methoxymalonyl-CoA: 69.5
Methylmalonyl-CoA: 50.4
Propionyl-CoA: 36.5
fatty_acid: 19.6
Ethylmalonyl-CoA: 19.5
Benzoyl-CoA: 15.6
Acetyl-CoA: 13.0
Isobutyryl-CoA: 11.9
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOF23_RS18155: mal

PKS_AT (534..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 147.4
inactive: 114.4
Methoxymalonyl-CoA: 76.1
Methylmalonyl-CoA: 63.0
Propionyl-CoA: 44.4
Isobutyryl-CoA: 35.2
Ethylmalonyl-CoA: 21.0
CHC-CoA: 17.1
fatty_acid: 16.9
2-Methylbutyryl-CoA: 16.1
3-Methylbutyryl-CoA: 10.0
trans-1,2-CPDA: 9.6
Benzoyl-CoA: 9.1
Acetyl-CoA: 0.0

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
RutR	Regulator of the pyrimidine and purine metabolism
SypG	Regulator of biofilm formation and host colonization
ToxT	Regulator of MSHA biosynthesis

NZ_JALAWW010000013.1 - Region 1 - NRP-metallophore,NRPS,terpene-precursor

Download region SVG

Location: 68,307 - 134,552 nt. (total: 66,246 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

MOF23_RS21260: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

MOF23_RS21305: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

MOF23_RS21310: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

MOF23_RS21360: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOF23_RS21435: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: esterase hydrolase

MOF23_RS21375: isochorismatase

smcogs: SMCOG1027: isochorismatase

MOF23_RS21475: isochorismatase

smcogs: SMCOG1027: isochorismatase

MOF23_RS21525: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Isomerases: isomerase

MOF23_RS21365: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthetase

MOF23_RS21370: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOF23_RS21380: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOF23_RS21505: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000309.5	1.41	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0001185.5	1.10	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000401.5	1.05	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002695.2	0.74	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000309.5	0.89	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0001185.5	0.82	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000401.5	0.80	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002695.2	0.70	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

MOF23_RS21505: PT_FPPS_like

Domain 1 (23 - 281): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.96 out of 28.19

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.08 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.97 out of 26.06

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.87 out of 18.16

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.61 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.21 out of 26.06

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.52 out of 27.78

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.36 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.93 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.49 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.42 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.92 out of 27.78

Confidence: medium

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 26.64 out of 32.74

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.03 out of 26.06

Confidence: medium

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 26.46 out of 33.14

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.73 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.18 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.85 out of 25.31

Confidence: strong

Additional weak hits (17):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.62 out of 21.55

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.22 out of 30.11

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.15 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.19 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.81 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.85 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.84 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.69 out of 29.38

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 21.80 out of 30.11

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.12 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.61 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.72 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.33 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.45 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.98 out of 29.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 68306 - 134552:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 68306 - 120084:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Thr)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MOF23_RS21370: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SLSLYPLSSPGGALQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVVNK (97% 8Å match); diOH-Bz or Sal PLPAQGVVNK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

MOF23_RS21380: Gly - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (463..861): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDISALELQALVGGETNLYGPTETTIWSAA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1519..1935): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQIFGGEINMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
FuR variant 2	Ferric Uptake Regulator
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor
ZuR variant 2	Zinc-responsive repressor

NZ_JALAWW010000017.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 9,401 nt. (total: 9,401 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

MOF23_RS22865: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOF23_RS22870: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0000426.5	0.68	NRPS	sevadicin	Paenibacillus larvae
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001050.5	0.65	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0000426.5	0.68	NRPS	sevadicin	Paenibacillus larvae
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001050.5	0.65	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 9401:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X) + (Pro)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MOF23_RS22865: Pro - Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (468..865): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LFEAFDVCYQESFLITAGEHNHYGPSETHVVSTY
Nearest Stachelhaus code(s):: Pro DVQFIAHVVK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1499..1884): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: FSLTFDASIWEWHFFSGGETNSYGPTEATVEAAF
Nearest Stachelhaus code(s):: Glu DAWHFGSVEK (100% 8Å match); Gln DAWHFGSVEK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

MOF23_RS22870: X

AMP-binding (195..588): X

nrpys: Ala, Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNSSFDVVTFEGWLIIGGEWNGYGPTENTTFSTC
Nearest Stachelhaus code(s):: Ala or Val DVFWIGGTFK (100% 8Å match); Val DVFWIGGTFK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

NZ_JALAWW010000021.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 14,994 nt. (total: 14,994 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

MOF23_RS23010: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOF23_RS23015: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOF23_RS23020: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000426.5	0.71	NRPS	sevadicin	Paenibacillus larvae
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001050.5	0.68	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001133.4	0.68	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000426.5	0.71	NRPS	sevadicin	Paenibacillus larvae
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001050.5	0.68	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001133.4	0.68	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 14994:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Orn) + (Tyr - D-Thr) + (Glu)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MOF23_RS23010: Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (469..870): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDASVWQWHFFAGGEIHGYGPTEATVDAAF
Nearest Stachelhaus code(s):: Glu DAWHFGGVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOF23_RS23015: Tyr - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (474..865): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: TWRFFDGCVTSTIITFAGEANEYGPTENSVATTI
Nearest Stachelhaus code(s):: Tyr DGTITAEVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1903): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LHQHFDFSVWEGNQIFGGEINMYGITETTVHVTF
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOF23_RS23020: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (194..599): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: AAWAFDVFSGDRESILGSDINSYGVTEATIDSSC
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)