GCF_026794685.1 - 18 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JALAUV010000001.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRP-metallophore,NRPS	150,610	202,387	High	bacillibactin	NRPS:Type I

NZ_JALAUV010000002.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	terpene-precursor	367,317	388,207

NZ_JALAUV010000003.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	sactipeptide	247,001	268,613	High	subtilosin A	ribosomal:RiPP:Thiopeptide

NZ_JALAUV010000004.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	NRPS	1	21,794	Low	plipastatin	NRPS:Type I

NZ_JALAUV010000005.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	NRPS,transAT-PKS,betalactone	327,434	409,740	High	fengycin	NRPS:Type I

NZ_JALAUV010000006.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	T3PKS,PKS-like	1	23,769	Low	aurantinin B/aurantinin C/aurantinin D	PKS

NZ_JALAUV010000008.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	other	333,995	370,043	High	bacilysin	other:other

NZ_JALAUV010000009.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	NRPS	70,706	136,097	High	surfactin	NRPS:Type I

NZ_JALAUV010000010.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	NRPS,T1PKS	53,219	134,562	Low	zwittermicin A	NRPS:Type I+PKS

NZ_JALAUV010000012.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	transAT-PKS-like	1	8,414

NZ_JALAUV010000014.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	T3PKS	93,774	134,871	Low	1-carbapen-2-em-3-carboxylic acid	other:other

NZ_JALAUV010000015.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	transAT-PKS-like	1	2,638

NZ_JALAUV010000016.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	transAT-PKS-like	1	30,349	Low	aurantinin B/aurantinin C/aurantinin D	PKS

NZ_JALAUV010000017.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	terpene	12,900	34,798

NZ_JALAUV010000019.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	NRPS	1	13,126	Low	plipastatin	NRPS:Type I

NZ_JALAUV010000022.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 22.1	NRPS	1	9,458

NZ_JALAUV010000023.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	glycocin	1	17,085	High	sublancin 168	ribosomal:RiPP:Lanthipeptide

NZ_JALAUV010000024.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	transAT-PKS	1	20,618	Low	aurantinin B/aurantinin C/aurantinin D	PKS

No secondary metabolite regions were found in these records:: NZ_JALAUV010000007.1 (Bacillus inaquosorum); NZ_JALAUV010000011.1 (Bacillus inaquosorum); NZ_JALAUV010000013.1 (Bacillus inaquosorum); NZ_JALAUV010000018.1 (Bacillus inaquosorum); NZ_JALAUV010000020.1 (Bacillus inaquosorum); NZ_JALAUV010000021.1 (Bacillus inaquosorum); NZ_JALAUV010000025.1 (Bacillus inaquosorum); NZ_JALAUV010000026.1 (Bacillus inaquosorum); NZ_JALAUV010000027.1 (Bacillus inaquosorum); NZ_JALAUV010000029.1 (Bacillus inaquosorum); NZ_JALAUV010000030.1 (Bacillus inaquosorum); NZ_JALAUV010000031.1 (Bacillus inaquosorum); NZ_JALAUV010000032.1 (Bacillus inaquosorum)

Compact view

NZ_JALAUV010000001.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 150,610 - 202,387 nt. (total: 51,778 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

MOE71_RS00960: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOE71_RS01035: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOE71_RS01085: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

MOE71_RS01090: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

MOE71_RS01135: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Hydrolases: hydrolase

MOE71_RS00920: isochorismatase

smcogs: SMCOG1027: isochorismatase

MOE71_RS01020: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

MOE71_RS01030: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

MOE71_RS01015: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOE71_RS01025: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000309.5	1.41	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0001185.5	1.10	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000401.5	1.05	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002695.2	0.74	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000309.5	0.89	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0001185.5	0.81	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000401.5	0.80	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002695.2	0.70	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.21 out of 26.06

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.61 out of 29.38

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.92 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.42 out of 27.78

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.49 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.93 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.36 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.52 out of 27.78

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.48 out of 25.88

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.97 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.08 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.73 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.18 out of 28.19

Confidence: medium

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 26.46 out of 33.14

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.96 out of 28.19

Confidence: medium

Additional weak hits (17):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.72 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.61 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.12 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.32 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.66 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.69 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.84 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.85 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.81 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.19 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.15 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.57 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.01 out of 35.63

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.22 out of 30.11

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 150609 - 202387:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOE71_RS01015: Gly - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (463..861): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDISALELQALVGGETNLYGPTETTIWSAA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1519..1935): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQIFGGEINMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOE71_RS01025: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SLSLYPLSSPGGALQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVVNK (97% 8Å match); diOH-Bz or Sal PLPAQGVVNK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
MogR	Repressor of flagellar motility genes
PsrA	Oleic acid responsive regulator
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor
ZuR variant 2	Zinc-responsive repressor

NZ_JALAUV010000002.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 367,317 - 388,207 nt. (total: 20,891 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

MOE71_RS04790: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: carboxylase

MOE71_RS04725: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

MOE71_RS04755: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

MOE71_RS04760: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000895.5	0.41	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001605.3	0.38	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000639.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000895.5	0.41	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001605.3	0.38	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000639.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

MOE71_RS04755: PT_FPPS_like

Domain 1 (33 - 296): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: IPP, DMAPP → FPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 20.50 out of 30.12

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.59 out of 29.25

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_JALAUV010000003.1 - Region 1 - sactipeptide

Download region GenBank file

Download region SVG

Location: 247,001 - 268,613 nt. (total: 21,613 nt) Show pHMM detection rules used

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Sactipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer

MOE71_RS06510: flavodoxin

smcogs: SMCOG1134: flavodoxin

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000602.5	0.88	ribosomal	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000514.5	0.38	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0001137.5	0.34	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002666.2	0.31	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0000310.5	0.30	NRPS	bacitracin	Bacillus licheniformis
BGC0000838.3	0.29	PKS	flexirubin	Flavobacterium johnsoniae UW101
BGC0001048.5	0.24	NRPS, PKS, saccharide	tallysomycin A, tallysomycin B	Streptoalloteichus hindustanus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000602.5	0.88	ribosomal	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000514.5	0.38	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0001137.5	0.34	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002666.2	0.31	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0000310.5	0.30	NRPS	bacitracin	Bacillus licheniformis
BGC0000838.3	0.29	PKS	flexirubin	Flavobacterium johnsoniae UW101
BGC0001048.5	0.24	NRPS, PKS, saccharide	tallysomycin A, tallysomycin B	Streptoalloteichus hindustanus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Sactipeptide predictions

Sactipeptide(s) for MOE71_RS06545

MOE71_RS06545

Leader:

MKKAVIVENK

Core:

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

antiSMASH-DB 4.0 matches for MOE71_RS06545

100.0%

NC_000964.3and 235 others:

NC_014479.1 Sactipeptides: BSUW23_RS18740_sactipeptideNC_014639.1 Sactipeptides: BATR1942_RS15950_sactipeptideNC_014976.1 Sactipeptides: BSN5_RS09700_sactipeptideNC_016047.1 Sactipeptides: GYO_RS41165_sactipeptideNC_017195.1 Sactipeptides: I33_RS18040_sactipeptideNC_017743.1 Sactipeptides: MY9_RS18920_sactipeptideNC_019896.1 Sactipeptides: A7A1_RS01935_sactipeptideNC_020244.1 Sactipeptides: C663_RS18295_sactipeptideNZ_BDDH01000003.1 Sactipeptides: A7P71_RS10610_sactipeptideNZ_CABIVP010000002.1 Sactipeptides: FY199_RS09010_sactipeptideNZ_CP007409.1 Sactipeptides: Q433_RS18950_sactipeptideNZ_CP009796.1 Sactipeptides: OB04_RS19085_sactipeptideNZ_CP011101.1 Sactipeptides: bslm_RS18365_sactipeptideNZ_CP011534.1 Sactipeptides: ABA10_RS18725_sactipeptideNZ_CP011802.1 Sactipeptides: D068_RS17505_sactipeptideNZ_CP016767.1 Sactipeptides: BCV50_RS14935_sactipeptideNZ_CP017072.1 Sactipeptides: BGM23_RS02945_sactipeptideNZ_CP017112.1 Sactipeptides: BS16045_RS19810_sactipeptideNZ_CP017313.1 Sactipeptides: BH660_RS14630_sactipeptideNZ_CP017314.1 Sactipeptides: BSBS38_RS19215_sactipeptideNZ_CP017676.1 Sactipeptides: BKN48_RS08085_sactipeptideNZ_CP018173.1 Sactipeptides: BAX60_RS03615_sactipeptideNZ_CP020367.1 Sactipeptides: BSK2_RS19060_sactipeptideNZ_CP020722.1 Sactipeptides: B7470_RS09560_sactipeptideNZ_CP020915.1 Sactipeptides: B9L64_RS11255_sactipeptideNZ_CP021169.1 Sactipeptides: B9N48_RS18685_sactipeptideNZ_CP021498.1 Sactipeptides: S101444_RS19170_sactipeptideNZ_CP021892.1 Sactipeptides: S100333_RS19720_sactipeptideNZ_CP021903.1 Sactipeptides: CD007_RS18975_sactipeptideNZ_CP021911.1 Sactipeptides: CDO84_RS18225_sactipeptideNZ_CP021921.1 Sactipeptides: S101392_RS19440_sactipeptideNZ_CP022391.1 Sactipeptides: CFK25_RS18875_sactipeptideNZ_CP022890.1 Sactipeptides: CJZ70_RS01210_sactipeptideNZ_CP023257.1 Sactipeptides: CLD04_RS19470_sactipeptideNZ_CP023409.1 Sactipeptides: Bateq7PJ16_RS20450_sactipeptideNZ_CP025941.1 Sactipeptides: C0W65_RS07300_sactipeptideNZ_CP026010.1 Sactipeptides: BS11774_RS03710_sactipeptideNZ_CP026030.1 Sactipeptides: C2H91_RS12110_sactipeptideNZ_CP026035.1 Sactipeptides: C2H96_RS13375_sactipeptideNZ_CP026036.1 Sactipeptides: C2H93_RS16885_sactipeptideNZ_CP026521.1 Sactipeptides: C1T29_RS22385_sactipeptideNZ_CP028201.1 Sactipeptides: C7M16_RS17535_sactipeptideNZ_CP028202.1 Sactipeptides: C7M17_RS17600_sactipeptideNZ_CP028217.1 Sactipeptides: C7M29_RS06900_sactipeptideNZ_CP028218.1 Sactipeptides: C7M30_RS12605_sactipeptideNZ_CP028812.1 Sactipeptides: DAE22_RS20770_sactipeptideNZ_CP029364.1 Sactipeptides: DIC78_RS12275_sactipeptideNZ_CP029461.1 Sactipeptides: DJ572_RS18795_sactipeptideNZ_CP029465.1 Sactipeptides: DKG76_RS19825_sactipeptideNZ_CP029609.1 Sactipeptides: DL538_RS20030_sactipeptideNZ_CP031675.1 Sactipeptides: DYS67_RS19275_sactipeptideNZ_CP031783.1 Sactipeptides: D0808_RS00710_sactipeptideNZ_CP031784.1 Sactipeptides: D0819_RS14700_sactipeptideNZ_CP032853.1 Sactipeptides: D9C10_RS17955_sactipeptideNZ_CP032855.1 Sactipeptides: D9C11_RS09165_sactipeptideNZ_CP035161.1 Sactipeptides: EQH88_RS19675_sactipeptideNZ_CP035167.1 Sactipeptides: EQJ08_RS19095_sactipeptideNZ_CP035226.1 Sactipeptides: EQW70_RS20085_sactipeptideNZ_CP035231.1 Sactipeptides: EQZ01_RS19685_sactipeptideNZ_CP035391.1 Sactipeptides: ES965_RS19370_sactipeptideNZ_CP035395.1 Sactipeptides: ES968_RS19740_sactipeptideNZ_CP035401.1 Sactipeptides: ETA19_RS19595_sactipeptideNZ_CP035402.1 Sactipeptides: ES969_RS19660_sactipeptideNZ_CP035403.1 Sactipeptides: ETA15_RS19805_sactipeptideNZ_CP035406.1 Sactipeptides: ETK61_RS20735_sactipeptideNZ_CP035413.1 Sactipeptides: ETL58_RS19505_sactipeptideNZ_CP039935.1 Sactipeptides: FCJ76_RS19255_sactipeptideNZ_CP045006.1 Sactipeptides: F9B13_RS01950_sactipeptideNZ_CP045425.1 Sactipeptides: GCU76_RS20710_sactipeptideNZ_CP045816.1 Sactipeptides: GII86_RS19920_sactipeptideNZ_CP045824.1 Sactipeptides: GII78_RS20125_sactipeptideNZ_CP046591.1 Sactipeptides: GO004_RS15965_sactipeptideNZ_CP046860.1 Sactipeptides: GPJ55_RS11605_sactipeptideNZ_CP047645.1 Sactipeptides: GSN02_RS19265_sactipeptideNZ_CP049924.1 Sactipeptides: G4G26_RS18960_sactipeptideNZ_CP050705.1 Sactipeptides: HCU65_RS18920_sactipeptideNZ_CP051462.1 Sactipeptides: HC662_RS19240_sactipeptideNZ_CP051464.1 Sactipeptides: HC660_RS18970_sactipeptideNZ_CP054050.1 Sactipeptides: HNV25_RS02005_sactipeptideNZ_CP054177.1 Sactipeptides: HR084_RS18935_sactipeptideNZ_CP054584.1 Sactipeptides: HT135_RS19775_sactipeptideNZ_CP060193.1 Sactipeptides: H7F27_RS02180_sactipeptideNZ_CP060417.1 Sactipeptides: H8S71_RS18495_sactipeptideNZ_CP061284.1 Sactipeptides: ICJ61_RS19715_sactipeptideNZ_CP061870.1 Sactipeptides: IE382_RS22305_sactipeptideNZ_CP062497.1 Sactipeptides: IHV08_RS19770_sactipeptideNZ_CP063276.1 Sactipeptides: IM743_RS18070_sactipeptideNZ_CP065858.1 Sactipeptides: I7X10_RS03370_sactipeptideNZ_CP069789.1 Sactipeptides: JR441_RS19085_sactipeptideNZ_CP070483.1 Sactipeptides: JQX68_RS19175_sactipeptideNZ_CP070976.1 Sactipeptides: JYG31_RS19675_sactipeptideNZ_CP071043.1 Sactipeptides: JS609_RS19245_sactipeptideNZ_CP073265.1 Sactipeptides: KCX77_RS18900_sactipeptideNZ_CP075344.1 Sactipeptides: KIL00_RS20100_sactipeptideNZ_CP076083.1 Sactipeptides: KFF76_RS18635_sactipeptideNZ_CP079759.1 Sactipeptides: KXZ66_RS19695_sactipeptideNZ_CP080508.1 Sactipeptides: K0V03_RS08595_sactipeptideNZ_CP089148.1 Sactipeptides: LRO88_RS20980_sactipeptideNZ_CP090125.1 Sactipeptides: LXE94_RS19505_sactipeptideNZ_CP093289.1 Sactipeptides: MNG38_RS19730_sactipeptideNZ_CP093546.1 Sactipeptides: MOW04_RS19180_sactipeptideNZ_CP095736.1 Sactipeptides: MX663_RS20090_sactipeptideNZ_CP096590.1 Sactipeptides: M0696_RS18995_sactipeptideNZ_CP096889.1 Sactipeptides: EFK13_RS19225_sactipeptideNZ_CP098738.1 Sactipeptides: NDR85_RS18965_sactipeptideNZ_CP100651.1 Sactipeptides: NLW79_RS19990_sactipeptideNZ_CP100752.1 Sactipeptides: NLV76_RS19060_sactipeptideNZ_CP101718.1 Sactipeptides: NPA28_RS19075_sactipeptideNZ_CP101936.1 Sactipeptides: NP434_RS18980_sactipeptideNZ_CP103352.1 Sactipeptides: NX823_RS19780_sactipeptideNZ_CP104878.1 Sactipeptides: N8A75_RS20105_sactipeptideNZ_CP107539.1 Sactipeptides: OEG95_RS19105_sactipeptideNZ_CP110264.1 Sactipeptides: OMK57_RS18975_sactipeptideNZ_CP114899.1 Sactipeptides: O6U12_RS19480_sactipeptideNZ_CP116773.1 Sactipeptides: PNF29_RS01990_sactipeptideNZ_FTMW01000001.1 Sactipeptides: BW968_RS02045_sactipeptideNZ_JAAUXF010000005.1 Sactipeptides: HC742_RS19325_sactipeptideNZ_JABRUZ010000003.1 Sactipeptides: HRF55_RS03085_sactipeptideNZ_JABRVH010000018.1 Sactipeptides: HRF53_RS09100_sactipeptideNZ_JABUKD010000002.1 Sactipeptides: HRW04_RS09345_sactipeptideNZ_JAEACL010000001.1 Sactipeptides: I5F14_RS00800_sactipeptideNZ_JAHVOC010000002.1 Sactipeptides: KXD37_RS07830_sactipeptideNZ_JAJFDG010000003.1 Sactipeptides: LJF29_RS11575_sactipeptideNZ_JAJHUI010000011.1 Sactipeptides: LK399_RS16325_sactipeptideNZ_JALAJC010000012.1 Sactipeptides: MOB18_RS16080_sactipeptideNZ_JALAKW010000005.1 Sactipeptides: MOB93_RS12665_sactipeptideNZ_JALAKZ010000001.1 Sactipeptides: MOB76_RS02240_sactipeptideNZ_JALALA010000011.1 Sactipeptides: MOB82_RS15020_sactipeptideNZ_JALALE010000020.1 Sactipeptides: MOB33_RS20855_sactipeptideNZ_JALALO010000006.1 Sactipeptides: MOB75_RS09230_sactipeptideNZ_JALAMD010000002.1 Sactipeptides: MOB22_RS02315_sactipeptideNZ_JALAME010000005.1 Sactipeptides: MOC02_RS13805_sactipeptideNZ_JALAMJ010000012.1 Sactipeptides: MOB80_RS16635_sactipeptideNZ_JALAMO010000007.1 Sactipeptides: MOB98_RS08535_sactipeptideNZ_JALAMR010000019.1 Sactipeptides: MOC09_RS17975_sactipeptideNZ_JALAMZ010000002.1 Sactipeptides: MOC43_RS01370_sactipeptideNZ_JALANN010000012.1 Sactipeptides: MOC49_RS18290_sactipeptideNZ_JALANX010000001.1 Sactipeptides: MOC25_RS03365_sactipeptideNZ_JALAPT010000001.1 Sactipeptides: MOC95_RS01580_sactipeptideNZ_JALAPV010000005.1 Sactipeptides: MOC91_RS13515_sactipeptideNZ_JALAPW010000003.1 Sactipeptides: MOD18_RS06235_sactipeptideNZ_JALAPX010000003.1 Sactipeptides: MOC97_RS06805_sactipeptideNZ_JALAPZ010000002.1 Sactipeptides: MOC81_RS03830_sactipeptideNZ_JALAQA010000008.1 Sactipeptides: MOD07_RS14955_sactipeptideNZ_JALAQC010000001.1 Sactipeptides: MOD00_RS01290_sactipeptideNZ_JALAQD010000002.1 Sactipeptides: MOD08_RS05770_sactipeptideNZ_JALAQE010000002.1 Sactipeptides: MOD19_RS04725_sactipeptideNZ_JALASB010000002.1 Sactipeptides: MOD42_RS03685_sactipeptideNZ_JALASC010000024.1 Sactipeptides: MOD69_RS20580_sactipeptideNZ_JALASM010000006.1 Sactipeptides: MOD51_RS10970_sactipeptideNZ_JALASR010000006.1 Sactipeptides: MOD87_RS10780_sactipeptideNZ_JALAST010000011.1 Sactipeptides: MOE17_RS14670_sactipeptideNZ_JALASW010000005.1 Sactipeptides: MOE15_RS06925_sactipeptideNZ_JALATC010000001.1 Sactipeptides: MOD56_RS03380_sactipeptideNZ_JALATD010000001.1 Sactipeptides: MOE02_RS03350_sactipeptideNZ_JALATE010000006.1 Sactipeptides: MOD98_RS11440_sactipeptideNZ_JALATF010000003.1 Sactipeptides: MOD44_RS09960_sactipeptideNZ_JALATG010000002.1 Sactipeptides: MOE16_RS03490_sactipeptideNZ_JALATJ010000007.1 Sactipeptides: MOD90_RS15770_sactipeptideNZ_JALATU010000001.1 Sactipeptides: MOE27_RS01985_sactipeptideNZ_JALATV010000005.1 Sactipeptides: MOD97_RS07020_sactipeptideNZ_JALAUA010000008.1 Sactipeptides: MOD32_RS16030_sactipeptideNZ_JALAUD010000001.1 Sactipeptides: MOE28_RS03345_sactipeptideNZ_JALAUJ010000006.1 Sactipeptides: MOE37_RS12685_sactipeptideNZ_JALAUK010000012.1 Sactipeptides: MOE38_RS11825_sactipeptideNZ_JALAUV010000003.1 Sactipeptides: MOE71_RS06545_sactipeptideNZ_JALAUW010000015.1 Sactipeptides: MOE83_RS13210_sactipeptideNZ_JALAVA010000002.1 Sactipeptides: MOE81_RS02625_sactipeptideNZ_JALAVE010000001.1 Sactipeptides: MOE67_RS03645_sactipeptideNZ_JALAVI010000011.1 Sactipeptides: MOE80_RS14660_sactipeptideNZ_JALAVK010000006.1 Sactipeptides: MOE96_RS10120_sactipeptideNZ_JALAVL010000002.1 Sactipeptides: MOE60_RS03290_sactipeptideNZ_JALAVM010000009.1 Sactipeptides: MOE49_RS16195_sactipeptideNZ_JALAVO010000008.1 Sactipeptides: MOE63_RS14665_sactipeptideNZ_JALAVQ010000003.1 Sactipeptides: MOE59_RS02420_sactipeptideNZ_JALAVS010000002.1 Sactipeptides: MOE46_RS02250_sactipeptideNZ_JALAVT010000005.1 Sactipeptides: MOF25_RS08325_sactipeptideNZ_JALAVU010000004.1 Sactipeptides: MOE78_RS09660_sactipeptideNZ_JALAVV010000004.1 Sactipeptides: MOE66_RS02855_sactipeptideNZ_JALAVW010000001.1 Sactipeptides: MOE86_RS01005_sactipeptideNZ_JALAVX010000009.1 Sactipeptides: MOE40_RS07525_sactipeptideNZ_JALAVZ010000002.1 Sactipeptides: MOF00_RS02525_sactipeptideNZ_JALAWB010000008.1 Sactipeptides: MOE87_RS15020_sactipeptideNZ_JALAWK010000002.1 Sactipeptides: MOF06_RS12140_sactipeptideNZ_JALAWW010000010.1 Sactipeptides: MOF23_RS17300_sactipeptideNZ_JALAXQ010000012.1 Sactipeptides: MOF24_RS14120_sactipeptideNZ_JALAXV010000001.1 Sactipeptides: MOF15_RS00375_sactipeptideNZ_JALAYA010000016.1 Sactipeptides: MOF34_RS08915_sactipeptideNZ_JALAYD010000019.1 Sactipeptides: MOF39_RS20725_sactipeptideNZ_JALNTO010000006.1 Sactipeptides: MTN95_RS11045_sactipeptideNZ_JAMDFN010000008.1 Sactipeptides: M3M31_RS18245_sactipeptideNZ_JAMYDW010000003.1 Sactipeptides: NHM07_RS10830_sactipeptideNZ_JANBMP010000002.1 Sactipeptides: NL430_RS07940_sactipeptideNZ_JANDGG010000001.1 Sactipeptides: NKU38_RS03365_sactipeptideNZ_JANFAP010000001.1 Sactipeptides: NEC81_RS02065_sactipeptideNZ_JAQFFE010000015.1 Sactipeptides: PG051_RS13540_sactipeptideNZ_JAQOXM010000001.1 Sactipeptides: PO770_RS01950_sactipeptideNZ_JH600279.1 Sactipeptides: GYU_RS0104160_sactipeptideNZ_JXHL01000020.1 Sactipeptides: B4069_RS07025_sactipeptideNZ_JXHP01000031.1 Sactipeptides: B4073_RS09425_sactipeptideNZ_JXHR01000010.1 Sactipeptides: B4146_RS06925_sactipeptideNZ_KZ848487.1 Sactipeptides: DSL71_RS14015_sactipeptideNZ_LPVE01000021.1 Sactipeptides: AU385_RS06600_sactipeptideNZ_LSBB01000001.1 Sactipeptides: AXI57_RS01770_sactipeptideNZ_LUUT01000004.1 Sactipeptides: A6751_RS18460_sactipeptideNZ_MOEO01000004.1 Sactipeptides: BLL41_RS09830_sactipeptideNZ_MUXL01000002.1 Sactipeptides: B0W20_RS08845_sactipeptideNZ_MZZI01000001.1 Sactipeptides: B2G85_RS18515_sactipeptideNZ_NBBO01000003.1 Sactipeptides: B6K89_RS01830_sactipeptideNZ_NERK01000024.1 Sactipeptides: B9T64_RS18540_sactipeptideNZ_NJRD01000003.1 Sactipeptides: CE053_RS09115_sactipeptideNZ_NJRE01000002.1 Sactipeptides: CE047_RS07205_sactipeptideNZ_NKAK01000003.1 Sactipeptides: CE489_RS10400_sactipeptideNZ_NMOM01000004.1 Sactipeptides: CFI07_RS07245_sactipeptideNZ_PHIE01000002.1 Sactipeptides: CVV77_RS10760_sactipeptideNZ_PJCT01000002.1 Sactipeptides: CW370_RS11825_sactipeptideNZ_PVQM01000002.1 Sactipeptides: C6W22_RS11490_sactipeptideNZ_PVQN01000002.1 Sactipeptides: C6W23_RS05885_sactipeptideNZ_PVRK01000001.1 Sactipeptides: C6350_RS02025_sactipeptideNZ_PVWC01000004.1 Sactipeptides: C6372_RS11675_sactipeptideNZ_QRFZ01000012.1 Sactipeptides: DXT72_RS19010_sactipeptideNZ_SDKE01000003.1 Sactipeptides: EUA35_RS12130_sactipeptideNZ_SHOB01000002.1 Sactipeptides: ES060_RS14270_sactipeptideNZ_SIRN01000006.1 Sactipeptides: EYH65_RS15720_sactipeptideNZ_SNWK01000001.1 Sactipeptides: DFO69_RS02055_sactipeptideNZ_SOBO01000012.1 Sactipeptides: DFO78_RS18210_sactipeptideNZ_SORJ01000001.1 Sactipeptides: BJ795_RS03350_sactipeptideNZ_VBRP01000025.1 Sactipeptides: FE220_RS07065_sactipeptideNZ_VFNF01000001.1 Sactipeptides: FB592_RS03405_sactipeptideNZ_VIOH01000001.1 Sactipeptides: FLN47_RS01935_sactipeptideNZ_VLJK01000012.1 Sactipeptides: L605_RS10195_sactipeptideNZ_VLJL01000006.1 Sactipeptides: L604_RS05585_sactipeptideNZ_VLJX01000001.1 Sactipeptides: L609_RS01950_sactipeptideNZ_VTEK01000003.1 Sactipeptides: FZC71_RS10310_sactipeptideNZ_WTKJ01000004.1 Sactipeptides: NWT17_RS06185_sactipeptide

Sactipeptides: BSU_37350_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

97.0%

NZ_CP092751.1:

Sactipeptides: MKF32_RS18515_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFEIAGATGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEIAGATGLFGLWG

33

93.9%

NZ_CP048852.1:

Sactipeptides: G4P54_RS19300_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFE+AGATGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEVAGATGLFGLWG

33

with 15 more sequence matches

Only the first 10 are displayed here.

90.9%

NZ_JALAKO010000018.1and 1 other:

NZ_JALAOG010000035.1 Sactipeptides: MOC96_RS18415_sactipeptide

Sactipeptides: MOB26_RS11095_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFEI G TGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEIGGVTGLFGLWG

33

87.9%

NZ_CP026362.1and 3 others:

NZ_CP033052.1 Sactipeptides: D9779_RS19215_sactipeptideNZ_JALAPG010000031.1 Sactipeptides: MOC70_RS13155_sactipeptideNZ_JALAQI010000016.1 Sactipeptides: MOD13_RS11485_sactipeptide

Sactipeptides: BV11031_RS20865_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDG IPDFEI G TGLFGLWG

1

GCATCSIGAVCLVDGFIPDFEIGGVTGLFGLWG

33

78.8%

NZ_NXEM01000021.1:

Sactipeptides: CPT06_RS05595_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GC TCSIGA CLV+GPIPDF+ G TGLFGLWG

1

GCTTCSIGAVCLVNGPIPDFKTGGVTGLFGLWG

33

72.7%

NC_014925.1and 17 others:

NZ_ANOI01000001.1 Sactipeptides: F779_RS13290_sactipeptideNZ_CP031604.1 Sactipeptides: DNJ55_RS07055_sactipeptideNZ_CP031605.1 Sactipeptides: DRC71_RS00165_sactipeptideNZ_CP035741.1 Sactipeptides: EW136_RS01865_sactipeptideNZ_CP039747.1 Sactipeptides: EFT29_RS00935_sactipeptideNZ_CP054206.2 Sactipeptides: HP560_RS11995_sactipeptideNZ_CP060700.1 Sactipeptides: H9Q12_RS10940_sactipeptideNZ_CP065920.1 Sactipeptides: JC281_RS11580_sactipeptideNZ_CP076465.1 Sactipeptides: KDE16_RS00560_sactipeptideNZ_JANPRJ010000013.1 Sactipeptides: NVR03_RS10250_sactipeptideNZ_JANPRN010000039.1 Sactipeptides: NVR04_RS07875_sactipeptideNZ_JTKO01000012.1 Sactipeptides: NO87_RS10650_sactipeptideNZ_LR134267.1 Sactipeptides: EL085_RS11430_sactipeptideNZ_MQMO01000006.1 Sactipeptides: BSR38_RS07375_sactipeptideNZ_MQNF01000024.1 Sactipeptides: BSR36_RS12515_sactipeptideNZ_QQPJ01000025.1 Sactipeptides: DV949_RS11300_sactipeptideNZ_SEZW01000001.1 Sactipeptides: EWV33_RS08610_sactipeptide

Sactipeptides: SPSINT_RS00615_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+TCSIGAACL+DGP+PDFE+ G TG+FGL

1

GCSTCSIGAACLIDGPLPDFEVMGITGIFGL

31

69.7%

NZ_CP027770.1:

Sactipeptides: C7J90_RS04260_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ CSIGAACL+DGP PDFE+ G TG FGL

1

GCSACSIGAACLIDGPFPDFEVMGITGTFGL

31

69.7%

NZ_CP066885.1:

Sactipeptides: JGZ27_RS11325_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+TCSIG ACL+DGP+PDFE+ G TG+FGL

1

GCSTCSIGVACLIDGPLPDFEVMGITGIFGL

31

69.7%

NZ_CP094808.1and 3 others:

NZ_CP094809.1 Sactipeptides: MUA95_RS01320_sactipeptideNZ_CP094813.1 Sactipeptides: MUA84_RS01300_sactipeptideNZ_VKCY01000004.1 Sactipeptides: FNK43_RS05155_sactipeptide

Sactipeptides: MUA11_RS01375_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C+IGAACL DGPIPDFE+AG TG FG+

1

GCSACAIGAACLADGPIPDFEVAGITGTFGI

31

66.7%

NZ_ATDF02000020.1and 1 other:

NZ_KV827785.1 Sactipeptides: HMPREF2580_RS10900_sactipeptide

Sactipeptides: M462_RS08950_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C++GAACL DGPIPDFE+AG TG FG+

1

GCSACAVGAACLADGPIPDFEVAGITGTFGM

31

63.6%

NC_022584.1and 2 others:

NZ_CP047883.1 Sactipeptides: M594_RS05585_sactipeptideNZ_KV802690.1 Sactipeptides: HMPREF2764_RS03300_sactipeptide

Sactipeptides: N596_RS03165_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GC+ C+IGA CL DGPIPDFEIAG + +F +G

1

GCSVCAIGAVCLADGPIPDFEIAGVSAVFTAFG

33

63.6%

NZ_CP063367.1and 1 other:

NZ_LR134263.1 Sactipeptides: EL101_RS12790_sactipeptide

Sactipeptides: IPU22_RS12430_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C++GA CL DGPIPDFE+AG TG FG+

1

GCSACAVGAVCLADGPIPDFEVAGITGTFGI

31

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.21 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.64 out of 27.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.07 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.53 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.88 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.81 out of 33.14

Confidence: weak

RREFinder

Sactipeptides

TFBS Finder

RRE predictions

: RRE type: Subtilosin_rSAM_RRE; Location: 5 - 98; Score: 99.1

Core peptide predictions

MOE71_RS06545: Putative sactipeptide; RODEO score: 33.0; Core sequence, approximate: GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism

NZ_JALAUV010000004.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 21,794 nt. (total: 21,794 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOE71_RS06730: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: peptidase

MOE71_RS06720: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Ligases: ligase

MOE71_RS06680: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.58	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.58	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.58	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.58	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000584.5	0.46	ribosomal	colicin V	Escherichia coli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.58	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.58	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.58	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.58	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000584.5	0.46	ribosomal	colicin V	Escherichia coli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.77 out of 26.06

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.93 out of 29.25

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.34 out of 28.19

Confidence: medium

Additional weak hits (2):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.85 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.25 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
MogR	Repressor of flagellar motility genes
SypG	Regulator of biofilm formation and host colonization
ZuR variant 1	Zinc-responsive repressor

NZ_JALAUV010000005.1 - Region 1 - NRPS,betalactone,transAT-PKS

Download region GenBank file

Download region SVG

Location: 327,434 - 409,740 nt. (total: 82,307 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOE71_RS09200: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acetyltransferase acylase carboxylase transferase

MOE71_RS09140: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MOE71_RS09155: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

MOE71_RS09170: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

MOE71_RS09190: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

MOE71_RS09215: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Lyases: hydratase

MOE71_RS09175: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

MOE71_RS09125: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOE71_RS09130: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOE71_RS09135: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MOE71_RS09180: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

MOE71_RS09195: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOE71_RS09230: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOE71_RS09235: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001103.5	1.26	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0002135.2	1.24	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.19	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000402.4	1.17	NRPS	paenilarvin A, paenilarvin B, paenilarvin C	Paenibacillus larvae subsp. larvae DSM 25430
BGC0001128.4	1.16	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	1.16	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	1.15	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	1.13	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	1.12	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	1.12	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000402.4	0.81	NRPS	paenilarvin A, paenilarvin B, paenilarvin C	Paenibacillus larvae subsp. larvae DSM 25430
BGC0001103.5	0.80	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0002135.2	0.76	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.74	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.21 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.56 out of 26.06

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.72 out of 27.78

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.28 out of 23.79

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.03 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.41 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.54 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.44 out of 26.06

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.45 out of 29.72

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.23 out of 26.06

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.60 out of 21.55

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.52 out of 28.19

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.92 out of 24.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.00 out of 26.06

Confidence: medium

Additional weak hits (10):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.51 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.75 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.38 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.15 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.05 out of 28.14

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.44 out of 20.47

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.47 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.00 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.26 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 327433 - 409740:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Tyr) + (Ile) + (fatty_acid - mal - Asn - D-Tyr) + (D-Asn - Gln - Pro - D-Asn) + (Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOE71_RS09125: Asn - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (268..663): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGDFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1778..2177): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNNHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOE71_RS09130: Tyr - Asn - Gln - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (268..662): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: SWKYFDAFILNGSTVVGGENNEYGPTENSVVSTF
Nearest Stachelhaus code(s):: Tyr DALSVGEVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1779..2174): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGECNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3288..3693): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDASVQQADGLIGGETNVYGPTETCVDASL
Nearest Stachelhaus code(s):: Gln DAQDLGVVDK (100% 8Å match); Ile DAQDLGVVDK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4337..4733): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LYEAFDVCYQESFLIVAGEHNHYGPSETHVVTMY
Nearest Stachelhaus code(s):: Pro DVQFIAHVVK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

MOE71_RS09135: fatty_acid - Asn

Search NORINE for peptide: strict or relaxed

CAL_domain (36..478): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 608.7
NH2: 19.5
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (2953..3348): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGEFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOE71_RS09140: mal

PKS_AT (6..291): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 80.9
inactive: 33.8
Methoxymalonyl-CoA: 21.3
Methylmalonyl-CoA: 13.0
Propionyl-CoA: 12.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOE71_RS09195: X

AMP-binding (13..445): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NNIVF-GCVLGAHGIMAGSTIAYGQTEASPVITQ
Nearest Stachelhaus code(s):: Z-ahmohOrn FGLHIASTCK (56% 8Å match); Ile DGLFIGIPVK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

MOE71_RS09230: Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (481..874): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LNSGFDAVTFEGFLYVGGEHNIYGPTENTTFSTF
Nearest Stachelhaus code(s):: Ile DAFFYGITFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOE71_RS09235: Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (248..642): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: TWRFFDGFLTSTIITLAGEANEYGPTENSVATTV
Nearest Stachelhaus code(s):: Tyr DGTITAEVAK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
NtrC	Nitrogen regulatory protein C
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JALAUV010000006.1 - Region 1 - PKS-like,T3PKS

Download region GenBank file

Download region SVG

Location: 1 - 23,769 nt. (total: 23,769 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase methyltransferase

MOE71_RS09285: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

MOE71_RS09305: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: hydratase

MOE71_RS09265: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

MOE71_RS09270: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

MOE71_RS22860: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: synthase

MOE71_RS09255: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MOE71_RS09260: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002175.3	0.54	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.54	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0000205.3	0.53	PKS	bryostatin	Candidatus Endobugula sertula
BGC0000255.5	0.34	PKS	pederin	Uncultured bacterium
BGC0001520.3	0.34	PKS	aurantinin B, aurantinin C, aurantinin D	Bacillus subtilis
BGC0001844.4	0.29	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0001064.5	0.27	PKS	cylindrocyclophane D, cylindrocyclophane E, cylindrocyclophane F	Cylindrospermum licheniforme UTEX B 2014
BGC0001566.3	0.27	PKS	Cylindrocyclophane D, Cylindrocyclophane E, Cylindrocyclophane F	Cylindrospermum licheniforme UTEX B 2014
BGC0001266.3	0.27	PKS	grayanic acid	Cladonia grayi
BGC0001105.5	0.27	NRPS, PKS	onnamide A	Uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002175.3	0.61	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0000205.3	0.60	PKS	bryostatin	Candidatus Endobugula sertula
BGC0000255.5	0.48	PKS	pederin	Uncultured bacterium
BGC0001520.3	0.48	PKS	aurantinin B, aurantinin C, aurantinin D	Bacillus subtilis
BGC0001844.4	0.45	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0001064.5	0.43	PKS	cylindrocyclophane D, cylindrocyclophane E, cylindrocyclophane F	Cylindrospermum licheniforme UTEX B 2014
BGC0001566.3	0.43	PKS	Cylindrocyclophane D, Cylindrocyclophane E, Cylindrocyclophane F	Cylindrospermum licheniforme UTEX B 2014
BGC0001266.3	0.43	PKS	grayanic acid	Cladonia grayi
BGC0001105.5	0.43	NRPS, PKS	onnamide A	Uncultured bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 28.14 out of 28.14

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.98 out of 27.55

Confidence: medium

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 25.44 out of 28.14

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.15 out of 28.19

Confidence: medium

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
PerR	Peroxide regulator
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_JALAUV010000008.1 - Region 1 - other

Download region GenBank file

Download region SVG

Location: 333,995 - 370,043 nt. (total: 36,049 nt) Show pHMM detection rules used

Region on contig edge.

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOE71_RS14790: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

MOE71_RS14820: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOE71_RS14840: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase transferase

MOE71_RS14760: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

MOE71_RS14835: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: dehydratase lyase

MOE71_RS14765: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

MOE71_RS14770: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

MOE71_RS14825: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Translocases: permease

MOE71_RS14800: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001184.4	0.84	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000888.5	0.83	other (other)	bacilysin	Bacillus sp. CS93
BGC0000773.3	0.55	saccharide	lipopolysaccharide	Escherichia coli
BGC0000898.5	0.54	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000794.5	0.54	saccharide	S-layer glycan	Geobacillus stearothermophilus
BGC0000790.3	0.54	saccharide	O-antigen	Escherichia coli
BGC0000791.3	0.54	saccharide	O-antigen	Cronobacter sakazakii
BGC0000795.3	0.52	saccharide	S-layer glycan	Aneurinibacillus thermoaerophilus
BGC0000792.3	0.52	saccharide	polysaccharide	Enterococcus faecalis OG1RF
BGC0000827.3	0.51	other (other)	staurosporine	Salinispora arenicola CNS-205

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001184.4	0.84	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000888.5	0.83	other (other)	bacilysin	Bacillus sp. CS93
BGC0000773.3	0.55	saccharide	lipopolysaccharide	Escherichia coli
BGC0000898.5	0.54	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000794.5	0.54	saccharide	S-layer glycan	Geobacillus stearothermophilus
BGC0000790.3	0.54	saccharide	O-antigen	Escherichia coli
BGC0000791.3	0.54	saccharide	O-antigen	Cronobacter sakazakii
BGC0000795.3	0.52	saccharide	S-layer glycan	Aneurinibacillus thermoaerophilus
BGC0000792.3	0.52	saccharide	polysaccharide	Enterococcus faecalis OG1RF
BGC0000827.3	0.51	other (other)	staurosporine	Salinispora arenicola CNS-205

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.70 out of 26.06

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.92 out of 30.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.35 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.02 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.05 out of 27.78

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.33 out of 20.97

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.85 out of 27.78

Confidence: medium

Additional weak hits (6):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.64 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.22 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 26.09 out of 36.54

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.60 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.74 out of 26.06

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.37 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JALAUV010000009.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 70,706 - 136,097 nt. (total: 65,392 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

MOE71_RS15240: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: PPTase aminotransferase

MOE71_RS15395: aminotransferase

smcogs: SMCOG1019: aminotransferase

MOE71_RS15400: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase hydrolase

MOE71_RS15375: thioesterase

smcogs: SMCOG1004: thioesterase

MOE71_RS15460: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

MOE71_RS15265: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

MOE71_RS15345: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOE71_RS15350: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOE71_RS15360: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOE71_RS15365: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOE71_RS15370: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.27 out of 26.06

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.88 out of 27.78

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.01 out of 23.79

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.74 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.42 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.88 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.30 out of 28.19

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.26 out of 24.78

Confidence: medium

Additional weak hits (9):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.63 out of 26.12

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.58 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.41 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.04 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.54 out of 26.06

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 30.11

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.22 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.74 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 70705 - 136097:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Glu - Leu - D-Leu) + (Val) + (Asp - D-Leu) + (Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOE71_RS15345: Glu - Leu - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (466..867): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: LSLAFDASVKQADGLIGGETNVYGPTETCVDASV
Nearest Stachelhaus code(s):: Glu DAKDLGVVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1510..1908): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: TETSFDAFMFDGMIMFGGELHMYGPSESTVFATY
Nearest Stachelhaus code(s):: Leu DAFMMGMVFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2938): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDASIWEPFLLTGGDVNNYGPTENTVVATS
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOE71_RS15350: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNGGFDAGTFEGWLIIGGDWNGYGPTENTTFSTS
Nearest Stachelhaus code(s):: Val DAFWIGGTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

MOE71_RS15360: Asp - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (427..830): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YWFSFDLGYTSPKLVLGGEINHYGPTEATIGAIA
Nearest Stachelhaus code(s):: Asp DLTKVGHIGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1472..1860): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDASIWEPFLLTGGDVNNYGPTENTVVATS
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOE71_RS15370: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LHVSFDAFTFDAFALFGGEINCYGPTEGTVFATA
Nearest Stachelhaus code(s):: Leu DAFFLGCVFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JALAUV010000010.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 53,219 - 134,562 nt. (total: 81,344 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOE71_RS17030: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

MOE71_RS17045: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: formyltransferase

MOE71_RS16935: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: amidase esterase hydrolase phosphatase

MOE71_RS17015: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

MOE71_RS17025: thioesterase

smcogs: SMCOG1004: thioesterase

MOE71_RS17035: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

MOE71_RS17100: amidase

smcogs: SMCOG1105: amidase

Ligases: ligase synthase

MOE71_RS17010: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOE71_RS17050: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOE71_RS17055: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOE71_RS17060: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MOE71_RS17065: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MOE71_RS17070: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: permease

MOE71_RS16955: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001250.4	0.71	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.71	NRPS	epichloenin A	Epichloe festucae
BGC0000426.5	0.70	NRPS	sevadicin	Paenibacillus larvae
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.67	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001250.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0000426.5	0.68	NRPS	sevadicin	Paenibacillus larvae
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.67	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 26.94 out of 27.78

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.63 out of 26.85

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.78 out of 20.97

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.45 out of 26.85

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.10 out of 26.06

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 25.34 out of 29.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.31 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.13 out of 26.06

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 25.31

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.78 out of 24.78

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.82 out of 29.25

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.26 out of 28.19

Confidence: medium

Additional weak hits (8):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.12 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.83 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.28 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.56 out of 26.85

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.20 out of 39.62

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 25.93 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.88 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 24.28 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 53218 - 134562:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (Asn - ohmal - Glu) + (ohmal) + (mal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOE71_RS17010: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (464..859): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YSASFDLTVTSTKLIVGGEFNEYGPTEATVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

MOE71_RS17050: Asn - mal

Search NORINE for peptide: strict or relaxed

AMP-binding (480..874): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATFDLTVTSTKLILGGEFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

PKS_AT (1595..1889): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 84.1
inactive: 61.8
Methoxymalonyl-CoA: 36.7
Propionyl-CoA: 25.7
Methylmalonyl-CoA: 24.9
Isobutyryl-CoA: 8.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOE71_RS17055: Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (273..674): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: LGIAFDASVQTPDAMAGGETNNYGPTECTVQSAA
Nearest Stachelhaus code(s):: Ile DAQDLGVVDK (68% 8Å match); Gln or Glu DAQDLGVVDK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

MOE71_RS17060: mal

PKS_AT (521..804): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 142.0
inactive: 95.4
Methoxymalonyl-CoA: 54.1
Methylmalonyl-CoA: 40.5
Propionyl-CoA: 29.5
Isobutyryl-CoA: 15.8
Benzoyl-CoA: 11.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOE71_RS17065: mal - mal

PKS_AT (531..797): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 17.7
Methoxymalonyl-CoA: 15.8
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (1505..1793): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 174.4
inactive: 106.8
Methoxymalonyl-CoA: 70.7
Methylmalonyl-CoA: 51.2
Propionyl-CoA: 36.5
Ethylmalonyl-CoA: 19.8
fatty_acid: 19.6
Benzoyl-CoA: 15.7
Isobutyryl-CoA: 13.4
Acetyl-CoA: 13.0
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOE71_RS17070: mal

PKS_AT (534..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 147.4
inactive: 114.4
Methoxymalonyl-CoA: 76.1
Methylmalonyl-CoA: 63.0
Propionyl-CoA: 44.4
Isobutyryl-CoA: 35.2
Ethylmalonyl-CoA: 21.0
CHC-CoA: 17.1
fatty_acid: 16.9
2-Methylbutyryl-CoA: 16.1
3-Methylbutyryl-CoA: 10.0
trans-1,2-CPDA: 9.6
Benzoyl-CoA: 9.1
Acetyl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
RutR	Regulator of the pyrimidine and purine metabolism
SypG	Regulator of biofilm formation and host colonization
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JALAUV010000012.1 - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 8,414 nt. (total: 8,414 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

MOE71_RS18165: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

MOE71_RS18160: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.58	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.57	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000107.3	0.57	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001258.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.58	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.57	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000107.3	0.57	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001258.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

Predicted core structure(s)

For candidate cluster 1, location 0 - 8414:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NZ_JALAUV010000014.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 93,774 - 134,871 nt. (total: 41,098 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOE71_RS19135: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase methyltransferase

MOE71_RS19150: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

MOE71_RS19185: isoprenylcysteine carboxyl methyltransferase

smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Ligases: synthase

MOE71_RS19180: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001831.3	0.51	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000282.3	0.49	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001962.3	0.45	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001847.2	0.44	other (other)	1-carbapen-2-em-3-carboxylic acid	Pectobacterium carotovorum
BGC0001475.4	0.43	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002332.2	0.42	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000509.4	0.37	ribosomal	epilancin 15x	Staphylococcus epidermidis
BGC0001882.3	0.36	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001831.3	0.51	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000282.3	0.49	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001962.3	0.45	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001847.2	0.44	other (other)	1-carbapen-2-em-3-carboxylic acid	Pectobacterium carotovorum
BGC0001475.4	0.43	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002332.2	0.42	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000509.4	0.37	ribosomal	epilancin 15x	Staphylococcus epidermidis
BGC0001882.3	0.36	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.91 out of 27.55

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.89 out of 23.79

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.84 out of 29.38

Confidence: medium

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 28.05 out of 32.74

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.65 out of 29.38

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.87 out of 29.72

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.73 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.14 out of 28.19

Confidence: medium

Additional weak hits (7):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.18 out of 25.75

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.46 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.03 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.01 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.59 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.31 out of 29.25

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
FuR variant 1	Ferric Uptake Regulator
FuR variant 2	Ferric Uptake Regulator
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
ZuR variant 1	Zinc-responsive repressor

NZ_JALAUV010000015.1 - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 2,638 nt. (total: 2,638 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

MOE71_RS19470: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.54	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.54	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001276.3	0.53	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001254.3	0.53	PKS	ACT-Toxin II	Alternaria alternata
BGC0001244.3	0.53	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.53	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001275.3	0.53	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.53	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001268.4	0.53	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001273.3	0.53	PKS	asperlactone	Aspergillus ochraceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.54	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.54	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001276.3	0.53	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001254.3	0.53	PKS	ACT-Toxin II	Alternaria alternata
BGC0001244.3	0.53	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.53	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001275.3	0.53	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.53	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001268.4	0.53	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001273.3	0.53	PKS	asperlactone	Aspergillus ochraceus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NZ_JALAUV010000016.1 - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 30,349 nt. (total: 30,349 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOE71_RS19485: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

MOE71_RS19475: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MOE71_RS19495: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.61	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.61	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001254.3	0.59	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000037.4	0.58	PKS	cichorine	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.61	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.61	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001254.3	0.59	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000037.4	0.58	PKS	cichorine	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

Predicted core structure(s)

For candidate cluster 1, location 0 - 30349:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (Me-ohmal) + (ccmal - ohmal - mal) + (Me-mal)
Non-colinear ordering:: MOE71_RS19495 + MOE71_RS19490 + MOE71_RS19485 + MOE71_RS19480 + MOE71_RS19475

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NZ_JALAUV010000017.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 12,900 - 34,798 nt. (total: 21,899 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOE71_RS19625: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001535.3	0.34	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002316.2	0.31	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0002255.3	0.29	PKS	lijiquinone	Ascomycota sp. F53
BGC0001736.3	0.27	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000663.5	0.27	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001057.4	0.27	NRPS, PKS	zearalenone	Fusarium graminearum
BGC0001575.4	0.26	NRPS	PZN5, PZN6, PZN7, PZN9, PZN10, PZN11	Ruminococcus sp. 5_1_39BFAA
BGC0001338.4	0.26	PKS	citrinin	Monascus ruber
BGC0002755.2	0.26	NRPS	clovibactin	Eleftheria terrae P9846
BGC0002083.3	0.26	PKS	gladiofungin A, gladiofungin B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001535.3	0.34	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002316.2	0.31	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0002255.3	0.29	PKS	lijiquinone	Ascomycota sp. F53
BGC0001736.3	0.27	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000663.5	0.27	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001057.4	0.27	NRPS, PKS	zearalenone	Fusarium graminearum
BGC0001575.4	0.26	NRPS	PZN5, PZN6, PZN7, PZN9, PZN10, PZN11	Ruminococcus sp. 5_1_39BFAA
BGC0001338.4	0.26	PKS	citrinin	Monascus ruber
BGC0002755.2	0.26	NRPS	clovibactin	Eleftheria terrae P9846
BGC0002083.3	0.26	PKS	gladiofungin A, gladiofungin B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

MOE71_RS19630: T2TS

Domain 1 (4 - 629): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 26.30 out of 27.78

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.78 out of 20.97

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.34 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.70 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.50 out of 27.78

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.10 out of 21.84

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.86 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.62 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.82 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_JALAUV010000019.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 13,126 nt. (total: 13,126 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

MOE71_RS21935: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOE71_RS21940: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOE71_RS21945: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000426.5	0.71	NRPS	sevadicin	Paenibacillus larvae
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001434.3	0.66	NRPS	nematophin	Xenorhabdus budapestensis
BGC0001133.4	0.66	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000426.5	0.71	NRPS	sevadicin	Paenibacillus larvae
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001434.3	0.66	NRPS	nematophin	Xenorhabdus budapestensis
BGC0001133.4	0.66	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 13126:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Orn) + (Tyr - D-Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOE71_RS21935: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (138..543): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: AAWAFDVFSGDRESILGSDINSYGVTEATIDSSC
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

MOE71_RS21940: Tyr - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (474..865): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: TWRFFDGCVTSTIITFAGEANEYGPTENSVATTI
Nearest Stachelhaus code(s):: Tyr DGTITAEVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1902): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LHQHFDFSVWEGNQIFGGEINMYGITETTVHVTF
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_JALAUV010000022.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 9,458 nt. (total: 9,458 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

MOE71_RS22310: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOE71_RS22315: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000426.5	0.67	NRPS	sevadicin	Paenibacillus larvae
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001050.5	0.65	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000426.5	0.67	NRPS	sevadicin	Paenibacillus larvae
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001050.5	0.65	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 9458:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X) + (Pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOE71_RS22310: X

AMP-binding (139..532): X

nrpys: Ala, Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNSSFDVVTFEAWLIIGGEWNGYGPTENTTFSTC
Nearest Stachelhaus code(s):: Ala or Val DVFWIGGTFK (97% 8Å match); Val DVFWIGGTFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

MOE71_RS22315: Pro - Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (468..865): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LFEAFDVCYQESFFITAGEHNHYGPSETHVVSTY
Nearest Stachelhaus code(s):: Pro DVQFIAHVVK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1499..1900): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: FSLTFDASIWEWHFFSGGETNSYGPTEATVEAAF
Nearest Stachelhaus code(s):: Glu DAWHFGSVEK (100% 8Å match); Gln DAWHFGSVEK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_JALAUV010000023.1 - Region 1 - glycocin

Download region GenBank file

Download region SVG

Location: 1 - 17,085 nt. (total: 17,085 nt) Show pHMM detection rules used

Region on contig edge.

glycocin: (glycocin or sublancin)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000558.5	0.88	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0001861.4	0.64	ribosomal	bacillicin BAG2O	Bacillus cereus BAG2O-1
BGC0001863.4	0.64	ribosomal, terpene	bacillicn CER074	Bacillus mycoides
BGC0001862.4	0.58	ribosomal	pallidocin	Aeribacillus pallidus
BGC0002674.2	0.52	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0001864.3	0.50	ribosomal	listeriocytocin	Listeria monocytogenes SLCC2540
BGC0000484.5	0.47	ribosomal	glycocin F	Lactobacillus plantarum
BGC0002586.2	0.45	ribosomal	ASM1	Lactiplantibacillus plantarum
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000558.5	0.88	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0001861.4	0.64	ribosomal	bacillicin BAG2O	Bacillus cereus BAG2O-1
BGC0001863.4	0.64	ribosomal, terpene	bacillicn CER074	Bacillus mycoides
BGC0001862.4	0.58	ribosomal	pallidocin	Aeribacillus pallidus
BGC0002674.2	0.52	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0001864.3	0.50	ribosomal	listeriocytocin	Listeria monocytogenes SLCC2540
BGC0000484.5	0.47	ribosomal	glycocin F	Lactobacillus plantarum
BGC0002586.2	0.45	ribosomal	ASM1	Lactiplantibacillus plantarum
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.54 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.50 out of 27.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 23.46 out of 24.78

Confidence: strong

TFBS Finder

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes

NZ_JALAUV010000024.1 - Region 1 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 20,618 nt. (total: 20,618 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOE71_RS22615: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acylase methyltransferase

MOE71_RS22575: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MOE71_RS22585: methyltransferase

smcogs: SMCOG1089: methyltransferase

MOE71_RS22590: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

MOE71_RS22595: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

MOE71_RS22605: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

MOE71_RS22610: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase

MOE71_RS22620: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.59	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001520.3	0.55	PKS	aurantinin B, aurantinin C, aurantinin D	Bacillus subtilis
BGC0000174.5	0.48	PKS	bryostatin	Candidatus Endobugula sertula
BGC0002056.3	0.47	NRPS, PKS	peloruside A	sponge metagenome

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.59	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001520.3	0.55	PKS	aurantinin B, aurantinin C, aurantinin D	Bacillus subtilis
BGC0000174.5	0.48	PKS	bryostatin	Candidatus Endobugula sertula
BGC0002056.3	0.47	NRPS, PKS	peloruside A	sponge metagenome

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.86 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.00 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.31 out of 26.06

Confidence: medium

Additional weak hits (6):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.18 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.18 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.18 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.25 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.71 out of 30.97

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.02 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 20618:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOE71_RS22575: mal

PKS_AT (7..292): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 34.3
inactive: 20.2
Methoxymalonyl-CoA: 20.2
Methylmalonyl-CoA: 17.0
Isobutyryl-CoA: 15.5
2-Methylbutyryl-CoA: 0.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

MOE71_RS22595: mal

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 79.3
inactive: 27.7
Methoxymalonyl-CoA: 19.5
Propionyl-CoA: 14.1
Methylmalonyl-CoA: 11.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis