GCF_026791895.1 - 16 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JALAQD010000001.1 (Bacillus atrophaeus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	terpene	207,391	228,233

NZ_JALAQD010000002.1 (Bacillus atrophaeus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	sactipeptide	375,616	397,225	High	subtilosin A	ribosomal:RiPP:Thiopeptide
Region 2.2	transAT-PKS,NRPS	715,026	754,092

NZ_JALAQD010000004.1 (Bacillus atrophaeus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	transAT-PKS,PKS-like,T3PKS,NRPS	94,562	210,097	High	bacillaene	NRPS:Type I+PKS:Type I

NZ_JALAQD010000009.1 (Bacillus atrophaeus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	NRPS	1	26,201	Low	surfactin	NRPS:Type I

NZ_JALAQD010000010.1 (Bacillus atrophaeus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	terpene-precursor	34,256	55,146

NZ_JALAQD010000013.1 (Bacillus atrophaeus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	T3PKS	150,541	191,638	Low	1-carbapen-2-em-3-carboxylic acid	other:other

NZ_JALAQD010000014.1 (Bacillus atrophaeus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	NRP-metallophore,NRPS	49,885	101,750	High	bacillibactin	NRPS:Type I
Region 14.2	azole-containing-RiPP	116,374	146,477

NZ_JALAQD010000016.1 (Bacillus atrophaeus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	NRPS,lanthipeptide-class-iii	5,437	52,447	High	andalusicin A/andalusicin B	ribosomal:RiPP:Lanthipeptide
Region 16.2	NRPS	181,674	209,577	Low	surfactin	NRPS:Type I

NZ_JALAQD010000020.1 (Bacillus atrophaeus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	NRPS,betalactone	1	64,103	Medium	fengycin	NRPS:Type I

NZ_JALAQD010000021.1 (Bacillus atrophaeus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	terpene	401	15,160

NZ_JALAQD010000022.1 (Bacillus atrophaeus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 22.1	NRPS	1	10,809

NZ_JALAQD010000026.1 (Bacillus atrophaeus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	transAT-PKS,NRPS	1	33,512	Low	mycosubtilin	NRPS:Type I+PKS

NZ_JALAQD010000032.1 (Bacillus atrophaeus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 32.1	NRPS	1	7,782

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	terpene	207,391	228,233
Region 2.1	sactipeptide	375,616	397,225	High	subtilosin A	ribosomal:RiPP:Thiopeptide
Region 2.2	transAT-PKS,NRPS	715,026	754,092
Region 4.1	transAT-PKS,PKS-like,T3PKS,NRPS	94,562	210,097	High	bacillaene	NRPS:Type I+PKS:Type I
Region 9.1	NRPS	1	26,201	Low	surfactin	NRPS:Type I
Region 10.1	terpene-precursor	34,256	55,146
Region 13.1	T3PKS	150,541	191,638	Low	1-carbapen-2-em-3-carboxylic acid	other:other
Region 14.1	NRP-metallophore,NRPS	49,885	101,750	High	bacillibactin	NRPS:Type I
Region 14.2	azole-containing-RiPP	116,374	146,477
Region 16.1	NRPS,lanthipeptide-class-iii	5,437	52,447	High	andalusicin A/andalusicin B	ribosomal:RiPP:Lanthipeptide
Region 16.2	NRPS	181,674	209,577	Low	surfactin	NRPS:Type I
Region 20.1	NRPS,betalactone	1	64,103	Medium	fengycin	NRPS:Type I
Region 21.1	terpene	401	15,160
Region 22.1	NRPS	1	10,809
Region 26.1	transAT-PKS,NRPS	1	33,512	Low	mycosubtilin	NRPS:Type I+PKS
Region 32.1	NRPS	1	7,782

No secondary metabolite regions were found in these records:: NZ_JALAQD010000003.1 (Bacillus atrophaeus); NZ_JALAQD010000005.1 (Bacillus atrophaeus); NZ_JALAQD010000006.1 (Bacillus atrophaeus); NZ_JALAQD010000007.1 (Bacillus atrophaeus); NZ_JALAQD010000008.1 (Bacillus atrophaeus); NZ_JALAQD010000011.1 (Bacillus atrophaeus); NZ_JALAQD010000012.1 (Bacillus atrophaeus); NZ_JALAQD010000015.1 (Bacillus atrophaeus); NZ_JALAQD010000017.1 (Bacillus atrophaeus); NZ_JALAQD010000018.1 (Bacillus atrophaeus); NZ_JALAQD010000019.1 (Bacillus atrophaeus); NZ_JALAQD010000023.1 (Bacillus atrophaeus); NZ_JALAQD010000024.1 (Bacillus atrophaeus); NZ_JALAQD010000025.1 (Bacillus atrophaeus); NZ_JALAQD010000027.1 (Bacillus atrophaeus); NZ_JALAQD010000028.1 (Bacillus atrophaeus); NZ_JALAQD010000029.1 (Bacillus atrophaeus); NZ_JALAQD010000030.1 (Bacillus atrophaeus); NZ_JALAQD010000031.1 (Bacillus atrophaeus); NZ_JALAQD010000033.1 (Bacillus atrophaeus); NZ_JALAQD010000034.1 (Bacillus atrophaeus); NZ_JALAQD010000035.1 (Bacillus atrophaeus); NZ_JALAQD010000038.1 (Bacillus atrophaeus); NZ_JALAQD010000039.1 (Bacillus atrophaeus); NZ_JALAQD010000040.1 (Bacillus atrophaeus); NZ_JALAQD010000041.1 (Bacillus atrophaeus); NZ_JALAQD010000042.1 (Bacillus atrophaeus)

Compact view

NZ_JALAQD010000001.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 207,391 - 228,233 nt. (total: 20,843 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

MOD08_RS01150: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Hydrolases: hydrolase protease

MOD08_RS01110: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

MOD08_RS01120: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

MOD08_RS01180: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000885.3	0.47	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000846.5	0.44	other (other)	tabtoxin	Pseudomonas syringae
BGC0001880.3	0.43	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000645.3	0.43	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0001374.5	0.40	other (other)	thienodolin	Streptomyces albogriseolus
BGC0002690.2	0.40	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0001810.3	0.38	PKS	trehangelin	Polymorphospora rubra
BGC0000916.5	0.37	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000502.5	0.37	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0000533.3	0.37	ribosomal	mutacin III	Streptococcus mutans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000885.3	0.47	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000846.5	0.44	other (other)	tabtoxin	Pseudomonas syringae
BGC0001880.3	0.43	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000645.3	0.43	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0001374.5	0.40	other (other)	thienodolin	Streptomyces albogriseolus
BGC0002690.2	0.40	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0001810.3	0.38	PKS	trehangelin	Polymorphospora rubra
BGC0000916.5	0.37	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000502.5	0.37	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0000533.3	0.37	ribosomal	mutacin III	Streptococcus mutans

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

MOD08_RS01125: PT_phytoene_like

Domain 1 (5 - 266): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.35 out of 27.55

Confidence: medium

Additional weak hits (5):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.18 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.54 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.84 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 24.35 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.25 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes

NZ_JALAQD010000002.1 - Region 1 - sactipeptide

Download region GenBank file

Download region SVG

Location: 375,616 - 397,225 nt. (total: 21,610 nt) Show pHMM detection rules used

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Sactipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer

MOD08_RS05805: flavodoxin

smcogs: SMCOG1134: flavodoxin

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000602.5	0.86	ribosomal	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000514.5	0.38	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0001170.5	0.34	ribosomal	clostridiolysin S	Clostridium sporogenes ATCC 15579
BGC0000564.5	0.34	ribosomal	clostridiolysin S	Clostridium botulinum A str. ATCC 3502
BGC0001137.5	0.34	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002666.2	0.31	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0000838.3	0.28	PKS	flexirubin	Flavobacterium johnsoniae UW101
BGC0002137.3	0.28	PKS	mutaxanthene A, mutaxanthene B, mutaxanthene D	Streptomyces sp. NRRL F-3213
BGC0002122.2	0.27	NRPS	gramicidin S	Aneurinibacillus migulanus
BGC0000792.3	0.26	saccharide	polysaccharide	Enterococcus faecalis OG1RF

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000602.5	0.86	ribosomal	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000514.5	0.38	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0001170.5	0.34	ribosomal	clostridiolysin S	Clostridium sporogenes ATCC 15579
BGC0000564.5	0.34	ribosomal	clostridiolysin S	Clostridium botulinum A str. ATCC 3502
BGC0001137.5	0.34	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002666.2	0.31	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0000838.3	0.28	PKS	flexirubin	Flavobacterium johnsoniae UW101
BGC0002137.3	0.28	PKS	mutaxanthene A, mutaxanthene B, mutaxanthene D	Streptomyces sp. NRRL F-3213
BGC0002122.2	0.27	NRPS	gramicidin S	Aneurinibacillus migulanus
BGC0000792.3	0.26	saccharide	polysaccharide	Enterococcus faecalis OG1RF

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Sactipeptide predictions

Sactipeptide(s) for MOD08_RS05770

MOD08_RS05770

Leader:

MKKAVIVENK

Core:

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

antiSMASH-DB 4.0 matches for MOD08_RS05770

100.0%

NC_000964.3and 235 others:

NC_014479.1 Sactipeptides: BSUW23_RS18740_sactipeptideNC_014639.1 Sactipeptides: BATR1942_RS15950_sactipeptideNC_014976.1 Sactipeptides: BSN5_RS09700_sactipeptideNC_016047.1 Sactipeptides: GYO_RS41165_sactipeptideNC_017195.1 Sactipeptides: I33_RS18040_sactipeptideNC_017743.1 Sactipeptides: MY9_RS18920_sactipeptideNC_019896.1 Sactipeptides: A7A1_RS01935_sactipeptideNC_020244.1 Sactipeptides: C663_RS18295_sactipeptideNZ_BDDH01000003.1 Sactipeptides: A7P71_RS10610_sactipeptideNZ_CABIVP010000002.1 Sactipeptides: FY199_RS09010_sactipeptideNZ_CP007409.1 Sactipeptides: Q433_RS18950_sactipeptideNZ_CP009796.1 Sactipeptides: OB04_RS19085_sactipeptideNZ_CP011101.1 Sactipeptides: bslm_RS18365_sactipeptideNZ_CP011534.1 Sactipeptides: ABA10_RS18725_sactipeptideNZ_CP011802.1 Sactipeptides: D068_RS17505_sactipeptideNZ_CP016767.1 Sactipeptides: BCV50_RS14935_sactipeptideNZ_CP017072.1 Sactipeptides: BGM23_RS02945_sactipeptideNZ_CP017112.1 Sactipeptides: BS16045_RS19810_sactipeptideNZ_CP017313.1 Sactipeptides: BH660_RS14630_sactipeptideNZ_CP017314.1 Sactipeptides: BSBS38_RS19215_sactipeptideNZ_CP017676.1 Sactipeptides: BKN48_RS08085_sactipeptideNZ_CP018173.1 Sactipeptides: BAX60_RS03615_sactipeptideNZ_CP020367.1 Sactipeptides: BSK2_RS19060_sactipeptideNZ_CP020722.1 Sactipeptides: B7470_RS09560_sactipeptideNZ_CP020915.1 Sactipeptides: B9L64_RS11255_sactipeptideNZ_CP021169.1 Sactipeptides: B9N48_RS18685_sactipeptideNZ_CP021498.1 Sactipeptides: S101444_RS19170_sactipeptideNZ_CP021892.1 Sactipeptides: S100333_RS19720_sactipeptideNZ_CP021903.1 Sactipeptides: CD007_RS18975_sactipeptideNZ_CP021911.1 Sactipeptides: CDO84_RS18225_sactipeptideNZ_CP021921.1 Sactipeptides: S101392_RS19440_sactipeptideNZ_CP022391.1 Sactipeptides: CFK25_RS18875_sactipeptideNZ_CP022890.1 Sactipeptides: CJZ70_RS01210_sactipeptideNZ_CP023257.1 Sactipeptides: CLD04_RS19470_sactipeptideNZ_CP023409.1 Sactipeptides: Bateq7PJ16_RS20450_sactipeptideNZ_CP025941.1 Sactipeptides: C0W65_RS07300_sactipeptideNZ_CP026010.1 Sactipeptides: BS11774_RS03710_sactipeptideNZ_CP026030.1 Sactipeptides: C2H91_RS12110_sactipeptideNZ_CP026035.1 Sactipeptides: C2H96_RS13375_sactipeptideNZ_CP026036.1 Sactipeptides: C2H93_RS16885_sactipeptideNZ_CP026521.1 Sactipeptides: C1T29_RS22385_sactipeptideNZ_CP028201.1 Sactipeptides: C7M16_RS17535_sactipeptideNZ_CP028202.1 Sactipeptides: C7M17_RS17600_sactipeptideNZ_CP028217.1 Sactipeptides: C7M29_RS06900_sactipeptideNZ_CP028218.1 Sactipeptides: C7M30_RS12605_sactipeptideNZ_CP028812.1 Sactipeptides: DAE22_RS20770_sactipeptideNZ_CP029364.1 Sactipeptides: DIC78_RS12275_sactipeptideNZ_CP029461.1 Sactipeptides: DJ572_RS18795_sactipeptideNZ_CP029465.1 Sactipeptides: DKG76_RS19825_sactipeptideNZ_CP029609.1 Sactipeptides: DL538_RS20030_sactipeptideNZ_CP031675.1 Sactipeptides: DYS67_RS19275_sactipeptideNZ_CP031783.1 Sactipeptides: D0808_RS00710_sactipeptideNZ_CP031784.1 Sactipeptides: D0819_RS14700_sactipeptideNZ_CP032853.1 Sactipeptides: D9C10_RS17955_sactipeptideNZ_CP032855.1 Sactipeptides: D9C11_RS09165_sactipeptideNZ_CP035161.1 Sactipeptides: EQH88_RS19675_sactipeptideNZ_CP035167.1 Sactipeptides: EQJ08_RS19095_sactipeptideNZ_CP035226.1 Sactipeptides: EQW70_RS20085_sactipeptideNZ_CP035231.1 Sactipeptides: EQZ01_RS19685_sactipeptideNZ_CP035391.1 Sactipeptides: ES965_RS19370_sactipeptideNZ_CP035395.1 Sactipeptides: ES968_RS19740_sactipeptideNZ_CP035401.1 Sactipeptides: ETA19_RS19595_sactipeptideNZ_CP035402.1 Sactipeptides: ES969_RS19660_sactipeptideNZ_CP035403.1 Sactipeptides: ETA15_RS19805_sactipeptideNZ_CP035406.1 Sactipeptides: ETK61_RS20735_sactipeptideNZ_CP035413.1 Sactipeptides: ETL58_RS19505_sactipeptideNZ_CP039935.1 Sactipeptides: FCJ76_RS19255_sactipeptideNZ_CP045006.1 Sactipeptides: F9B13_RS01950_sactipeptideNZ_CP045425.1 Sactipeptides: GCU76_RS20710_sactipeptideNZ_CP045816.1 Sactipeptides: GII86_RS19920_sactipeptideNZ_CP045824.1 Sactipeptides: GII78_RS20125_sactipeptideNZ_CP046591.1 Sactipeptides: GO004_RS15965_sactipeptideNZ_CP046860.1 Sactipeptides: GPJ55_RS11605_sactipeptideNZ_CP047645.1 Sactipeptides: GSN02_RS19265_sactipeptideNZ_CP049924.1 Sactipeptides: G4G26_RS18960_sactipeptideNZ_CP050705.1 Sactipeptides: HCU65_RS18920_sactipeptideNZ_CP051462.1 Sactipeptides: HC662_RS19240_sactipeptideNZ_CP051464.1 Sactipeptides: HC660_RS18970_sactipeptideNZ_CP054050.1 Sactipeptides: HNV25_RS02005_sactipeptideNZ_CP054177.1 Sactipeptides: HR084_RS18935_sactipeptideNZ_CP054584.1 Sactipeptides: HT135_RS19775_sactipeptideNZ_CP060193.1 Sactipeptides: H7F27_RS02180_sactipeptideNZ_CP060417.1 Sactipeptides: H8S71_RS18495_sactipeptideNZ_CP061284.1 Sactipeptides: ICJ61_RS19715_sactipeptideNZ_CP061870.1 Sactipeptides: IE382_RS22305_sactipeptideNZ_CP062497.1 Sactipeptides: IHV08_RS19770_sactipeptideNZ_CP063276.1 Sactipeptides: IM743_RS18070_sactipeptideNZ_CP065858.1 Sactipeptides: I7X10_RS03370_sactipeptideNZ_CP069789.1 Sactipeptides: JR441_RS19085_sactipeptideNZ_CP070483.1 Sactipeptides: JQX68_RS19175_sactipeptideNZ_CP070976.1 Sactipeptides: JYG31_RS19675_sactipeptideNZ_CP071043.1 Sactipeptides: JS609_RS19245_sactipeptideNZ_CP073265.1 Sactipeptides: KCX77_RS18900_sactipeptideNZ_CP075344.1 Sactipeptides: KIL00_RS20100_sactipeptideNZ_CP076083.1 Sactipeptides: KFF76_RS18635_sactipeptideNZ_CP079759.1 Sactipeptides: KXZ66_RS19695_sactipeptideNZ_CP080508.1 Sactipeptides: K0V03_RS08595_sactipeptideNZ_CP089148.1 Sactipeptides: LRO88_RS20980_sactipeptideNZ_CP090125.1 Sactipeptides: LXE94_RS19505_sactipeptideNZ_CP093289.1 Sactipeptides: MNG38_RS19730_sactipeptideNZ_CP093546.1 Sactipeptides: MOW04_RS19180_sactipeptideNZ_CP095736.1 Sactipeptides: MX663_RS20090_sactipeptideNZ_CP096590.1 Sactipeptides: M0696_RS18995_sactipeptideNZ_CP096889.1 Sactipeptides: EFK13_RS19225_sactipeptideNZ_CP098738.1 Sactipeptides: NDR85_RS18965_sactipeptideNZ_CP100651.1 Sactipeptides: NLW79_RS19990_sactipeptideNZ_CP100752.1 Sactipeptides: NLV76_RS19060_sactipeptideNZ_CP101718.1 Sactipeptides: NPA28_RS19075_sactipeptideNZ_CP101936.1 Sactipeptides: NP434_RS18980_sactipeptideNZ_CP103352.1 Sactipeptides: NX823_RS19780_sactipeptideNZ_CP104878.1 Sactipeptides: N8A75_RS20105_sactipeptideNZ_CP107539.1 Sactipeptides: OEG95_RS19105_sactipeptideNZ_CP110264.1 Sactipeptides: OMK57_RS18975_sactipeptideNZ_CP114899.1 Sactipeptides: O6U12_RS19480_sactipeptideNZ_CP116773.1 Sactipeptides: PNF29_RS01990_sactipeptideNZ_FTMW01000001.1 Sactipeptides: BW968_RS02045_sactipeptideNZ_JAAUXF010000005.1 Sactipeptides: HC742_RS19325_sactipeptideNZ_JABRUZ010000003.1 Sactipeptides: HRF55_RS03085_sactipeptideNZ_JABRVH010000018.1 Sactipeptides: HRF53_RS09100_sactipeptideNZ_JABUKD010000002.1 Sactipeptides: HRW04_RS09345_sactipeptideNZ_JAEACL010000001.1 Sactipeptides: I5F14_RS00800_sactipeptideNZ_JAHVOC010000002.1 Sactipeptides: KXD37_RS07830_sactipeptideNZ_JAJFDG010000003.1 Sactipeptides: LJF29_RS11575_sactipeptideNZ_JAJHUI010000011.1 Sactipeptides: LK399_RS16325_sactipeptideNZ_JALAJC010000012.1 Sactipeptides: MOB18_RS16080_sactipeptideNZ_JALAKW010000005.1 Sactipeptides: MOB93_RS12665_sactipeptideNZ_JALAKZ010000001.1 Sactipeptides: MOB76_RS02240_sactipeptideNZ_JALALA010000011.1 Sactipeptides: MOB82_RS15020_sactipeptideNZ_JALALE010000020.1 Sactipeptides: MOB33_RS20855_sactipeptideNZ_JALALO010000006.1 Sactipeptides: MOB75_RS09230_sactipeptideNZ_JALAMD010000002.1 Sactipeptides: MOB22_RS02315_sactipeptideNZ_JALAME010000005.1 Sactipeptides: MOC02_RS13805_sactipeptideNZ_JALAMJ010000012.1 Sactipeptides: MOB80_RS16635_sactipeptideNZ_JALAMO010000007.1 Sactipeptides: MOB98_RS08535_sactipeptideNZ_JALAMR010000019.1 Sactipeptides: MOC09_RS17975_sactipeptideNZ_JALAMZ010000002.1 Sactipeptides: MOC43_RS01370_sactipeptideNZ_JALANN010000012.1 Sactipeptides: MOC49_RS18290_sactipeptideNZ_JALANX010000001.1 Sactipeptides: MOC25_RS03365_sactipeptideNZ_JALAPT010000001.1 Sactipeptides: MOC95_RS01580_sactipeptideNZ_JALAPV010000005.1 Sactipeptides: MOC91_RS13515_sactipeptideNZ_JALAPW010000003.1 Sactipeptides: MOD18_RS06235_sactipeptideNZ_JALAPX010000003.1 Sactipeptides: MOC97_RS06805_sactipeptideNZ_JALAPZ010000002.1 Sactipeptides: MOC81_RS03830_sactipeptideNZ_JALAQA010000008.1 Sactipeptides: MOD07_RS14955_sactipeptideNZ_JALAQC010000001.1 Sactipeptides: MOD00_RS01290_sactipeptideNZ_JALAQD010000002.1 Sactipeptides: MOD08_RS05770_sactipeptideNZ_JALAQE010000002.1 Sactipeptides: MOD19_RS04725_sactipeptideNZ_JALASB010000002.1 Sactipeptides: MOD42_RS03685_sactipeptideNZ_JALASC010000024.1 Sactipeptides: MOD69_RS20580_sactipeptideNZ_JALASM010000006.1 Sactipeptides: MOD51_RS10970_sactipeptideNZ_JALASR010000006.1 Sactipeptides: MOD87_RS10780_sactipeptideNZ_JALAST010000011.1 Sactipeptides: MOE17_RS14670_sactipeptideNZ_JALASW010000005.1 Sactipeptides: MOE15_RS06925_sactipeptideNZ_JALATC010000001.1 Sactipeptides: MOD56_RS03380_sactipeptideNZ_JALATD010000001.1 Sactipeptides: MOE02_RS03350_sactipeptideNZ_JALATE010000006.1 Sactipeptides: MOD98_RS11440_sactipeptideNZ_JALATF010000003.1 Sactipeptides: MOD44_RS09960_sactipeptideNZ_JALATG010000002.1 Sactipeptides: MOE16_RS03490_sactipeptideNZ_JALATJ010000007.1 Sactipeptides: MOD90_RS15770_sactipeptideNZ_JALATU010000001.1 Sactipeptides: MOE27_RS01985_sactipeptideNZ_JALATV010000005.1 Sactipeptides: MOD97_RS07020_sactipeptideNZ_JALAUA010000008.1 Sactipeptides: MOD32_RS16030_sactipeptideNZ_JALAUD010000001.1 Sactipeptides: MOE28_RS03345_sactipeptideNZ_JALAUJ010000006.1 Sactipeptides: MOE37_RS12685_sactipeptideNZ_JALAUK010000012.1 Sactipeptides: MOE38_RS11825_sactipeptideNZ_JALAUV010000003.1 Sactipeptides: MOE71_RS06545_sactipeptideNZ_JALAUW010000015.1 Sactipeptides: MOE83_RS13210_sactipeptideNZ_JALAVA010000002.1 Sactipeptides: MOE81_RS02625_sactipeptideNZ_JALAVE010000001.1 Sactipeptides: MOE67_RS03645_sactipeptideNZ_JALAVI010000011.1 Sactipeptides: MOE80_RS14660_sactipeptideNZ_JALAVK010000006.1 Sactipeptides: MOE96_RS10120_sactipeptideNZ_JALAVL010000002.1 Sactipeptides: MOE60_RS03290_sactipeptideNZ_JALAVM010000009.1 Sactipeptides: MOE49_RS16195_sactipeptideNZ_JALAVO010000008.1 Sactipeptides: MOE63_RS14665_sactipeptideNZ_JALAVQ010000003.1 Sactipeptides: MOE59_RS02420_sactipeptideNZ_JALAVS010000002.1 Sactipeptides: MOE46_RS02250_sactipeptideNZ_JALAVT010000005.1 Sactipeptides: MOF25_RS08325_sactipeptideNZ_JALAVU010000004.1 Sactipeptides: MOE78_RS09660_sactipeptideNZ_JALAVV010000004.1 Sactipeptides: MOE66_RS02855_sactipeptideNZ_JALAVW010000001.1 Sactipeptides: MOE86_RS01005_sactipeptideNZ_JALAVX010000009.1 Sactipeptides: MOE40_RS07525_sactipeptideNZ_JALAVZ010000002.1 Sactipeptides: MOF00_RS02525_sactipeptideNZ_JALAWB010000008.1 Sactipeptides: MOE87_RS15020_sactipeptideNZ_JALAWK010000002.1 Sactipeptides: MOF06_RS12140_sactipeptideNZ_JALAWW010000010.1 Sactipeptides: MOF23_RS17300_sactipeptideNZ_JALAXQ010000012.1 Sactipeptides: MOF24_RS14120_sactipeptideNZ_JALAXV010000001.1 Sactipeptides: MOF15_RS00375_sactipeptideNZ_JALAYA010000016.1 Sactipeptides: MOF34_RS08915_sactipeptideNZ_JALAYD010000019.1 Sactipeptides: MOF39_RS20725_sactipeptideNZ_JALNTO010000006.1 Sactipeptides: MTN95_RS11045_sactipeptideNZ_JAMDFN010000008.1 Sactipeptides: M3M31_RS18245_sactipeptideNZ_JAMYDW010000003.1 Sactipeptides: NHM07_RS10830_sactipeptideNZ_JANBMP010000002.1 Sactipeptides: NL430_RS07940_sactipeptideNZ_JANDGG010000001.1 Sactipeptides: NKU38_RS03365_sactipeptideNZ_JANFAP010000001.1 Sactipeptides: NEC81_RS02065_sactipeptideNZ_JAQFFE010000015.1 Sactipeptides: PG051_RS13540_sactipeptideNZ_JAQOXM010000001.1 Sactipeptides: PO770_RS01950_sactipeptideNZ_JH600279.1 Sactipeptides: GYU_RS0104160_sactipeptideNZ_JXHL01000020.1 Sactipeptides: B4069_RS07025_sactipeptideNZ_JXHP01000031.1 Sactipeptides: B4073_RS09425_sactipeptideNZ_JXHR01000010.1 Sactipeptides: B4146_RS06925_sactipeptideNZ_KZ848487.1 Sactipeptides: DSL71_RS14015_sactipeptideNZ_LPVE01000021.1 Sactipeptides: AU385_RS06600_sactipeptideNZ_LSBB01000001.1 Sactipeptides: AXI57_RS01770_sactipeptideNZ_LUUT01000004.1 Sactipeptides: A6751_RS18460_sactipeptideNZ_MOEO01000004.1 Sactipeptides: BLL41_RS09830_sactipeptideNZ_MUXL01000002.1 Sactipeptides: B0W20_RS08845_sactipeptideNZ_MZZI01000001.1 Sactipeptides: B2G85_RS18515_sactipeptideNZ_NBBO01000003.1 Sactipeptides: B6K89_RS01830_sactipeptideNZ_NERK01000024.1 Sactipeptides: B9T64_RS18540_sactipeptideNZ_NJRD01000003.1 Sactipeptides: CE053_RS09115_sactipeptideNZ_NJRE01000002.1 Sactipeptides: CE047_RS07205_sactipeptideNZ_NKAK01000003.1 Sactipeptides: CE489_RS10400_sactipeptideNZ_NMOM01000004.1 Sactipeptides: CFI07_RS07245_sactipeptideNZ_PHIE01000002.1 Sactipeptides: CVV77_RS10760_sactipeptideNZ_PJCT01000002.1 Sactipeptides: CW370_RS11825_sactipeptideNZ_PVQM01000002.1 Sactipeptides: C6W22_RS11490_sactipeptideNZ_PVQN01000002.1 Sactipeptides: C6W23_RS05885_sactipeptideNZ_PVRK01000001.1 Sactipeptides: C6350_RS02025_sactipeptideNZ_PVWC01000004.1 Sactipeptides: C6372_RS11675_sactipeptideNZ_QRFZ01000012.1 Sactipeptides: DXT72_RS19010_sactipeptideNZ_SDKE01000003.1 Sactipeptides: EUA35_RS12130_sactipeptideNZ_SHOB01000002.1 Sactipeptides: ES060_RS14270_sactipeptideNZ_SIRN01000006.1 Sactipeptides: EYH65_RS15720_sactipeptideNZ_SNWK01000001.1 Sactipeptides: DFO69_RS02055_sactipeptideNZ_SOBO01000012.1 Sactipeptides: DFO78_RS18210_sactipeptideNZ_SORJ01000001.1 Sactipeptides: BJ795_RS03350_sactipeptideNZ_VBRP01000025.1 Sactipeptides: FE220_RS07065_sactipeptideNZ_VFNF01000001.1 Sactipeptides: FB592_RS03405_sactipeptideNZ_VIOH01000001.1 Sactipeptides: FLN47_RS01935_sactipeptideNZ_VLJK01000012.1 Sactipeptides: L605_RS10195_sactipeptideNZ_VLJL01000006.1 Sactipeptides: L604_RS05585_sactipeptideNZ_VLJX01000001.1 Sactipeptides: L609_RS01950_sactipeptideNZ_VTEK01000003.1 Sactipeptides: FZC71_RS10310_sactipeptideNZ_WTKJ01000004.1 Sactipeptides: NWT17_RS06185_sactipeptide

Sactipeptides: BSU_37350_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

97.0%

NZ_CP092751.1:

Sactipeptides: MKF32_RS18515_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFEIAGATGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEIAGATGLFGLWG

33

93.9%

NZ_CP048852.1:

Sactipeptides: G4P54_RS19300_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFE+AGATGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEVAGATGLFGLWG

33

with 15 more sequence matches

Only the first 10 are displayed here.

90.9%

NZ_JALAKO010000018.1and 1 other:

NZ_JALAOG010000035.1 Sactipeptides: MOC96_RS18415_sactipeptide

Sactipeptides: MOB26_RS11095_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFEI G TGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEIGGVTGLFGLWG

33

87.9%

NZ_CP026362.1and 3 others:

NZ_CP033052.1 Sactipeptides: D9779_RS19215_sactipeptideNZ_JALAPG010000031.1 Sactipeptides: MOC70_RS13155_sactipeptideNZ_JALAQI010000016.1 Sactipeptides: MOD13_RS11485_sactipeptide

Sactipeptides: BV11031_RS20865_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDG IPDFEI G TGLFGLWG

1

GCATCSIGAVCLVDGFIPDFEIGGVTGLFGLWG

33

78.8%

NZ_NXEM01000021.1:

Sactipeptides: CPT06_RS05595_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GC TCSIGA CLV+GPIPDF+ G TGLFGLWG

1

GCTTCSIGAVCLVNGPIPDFKTGGVTGLFGLWG

33

72.7%

NC_014925.1and 17 others:

NZ_ANOI01000001.1 Sactipeptides: F779_RS13290_sactipeptideNZ_CP031604.1 Sactipeptides: DNJ55_RS07055_sactipeptideNZ_CP031605.1 Sactipeptides: DRC71_RS00165_sactipeptideNZ_CP035741.1 Sactipeptides: EW136_RS01865_sactipeptideNZ_CP039747.1 Sactipeptides: EFT29_RS00935_sactipeptideNZ_CP054206.2 Sactipeptides: HP560_RS11995_sactipeptideNZ_CP060700.1 Sactipeptides: H9Q12_RS10940_sactipeptideNZ_CP065920.1 Sactipeptides: JC281_RS11580_sactipeptideNZ_CP076465.1 Sactipeptides: KDE16_RS00560_sactipeptideNZ_JANPRJ010000013.1 Sactipeptides: NVR03_RS10250_sactipeptideNZ_JANPRN010000039.1 Sactipeptides: NVR04_RS07875_sactipeptideNZ_JTKO01000012.1 Sactipeptides: NO87_RS10650_sactipeptideNZ_LR134267.1 Sactipeptides: EL085_RS11430_sactipeptideNZ_MQMO01000006.1 Sactipeptides: BSR38_RS07375_sactipeptideNZ_MQNF01000024.1 Sactipeptides: BSR36_RS12515_sactipeptideNZ_QQPJ01000025.1 Sactipeptides: DV949_RS11300_sactipeptideNZ_SEZW01000001.1 Sactipeptides: EWV33_RS08610_sactipeptide

Sactipeptides: SPSINT_RS00615_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+TCSIGAACL+DGP+PDFE+ G TG+FGL

1

GCSTCSIGAACLIDGPLPDFEVMGITGIFGL

31

69.7%

NZ_CP027770.1:

Sactipeptides: C7J90_RS04260_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ CSIGAACL+DGP PDFE+ G TG FGL

1

GCSACSIGAACLIDGPFPDFEVMGITGTFGL

31

69.7%

NZ_CP066885.1:

Sactipeptides: JGZ27_RS11325_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+TCSIG ACL+DGP+PDFE+ G TG+FGL

1

GCSTCSIGVACLIDGPLPDFEVMGITGIFGL

31

69.7%

NZ_CP094808.1and 3 others:

NZ_CP094809.1 Sactipeptides: MUA95_RS01320_sactipeptideNZ_CP094813.1 Sactipeptides: MUA84_RS01300_sactipeptideNZ_VKCY01000004.1 Sactipeptides: FNK43_RS05155_sactipeptide

Sactipeptides: MUA11_RS01375_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C+IGAACL DGPIPDFE+AG TG FG+

1

GCSACAIGAACLADGPIPDFEVAGITGTFGI

31

66.7%

NZ_ATDF02000020.1and 1 other:

NZ_KV827785.1 Sactipeptides: HMPREF2580_RS10900_sactipeptide

Sactipeptides: M462_RS08950_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C++GAACL DGPIPDFE+AG TG FG+

1

GCSACAVGAACLADGPIPDFEVAGITGTFGM

31

63.6%

NC_022584.1and 2 others:

NZ_CP047883.1 Sactipeptides: M594_RS05585_sactipeptideNZ_KV802690.1 Sactipeptides: HMPREF2764_RS03300_sactipeptide

Sactipeptides: N596_RS03165_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GC+ C+IGA CL DGPIPDFEIAG + +F +G

1

GCSVCAIGAVCLADGPIPDFEIAGVSAVFTAFG

33

63.6%

NZ_CP063367.1and 1 other:

NZ_LR134263.1 Sactipeptides: EL101_RS12790_sactipeptide

Sactipeptides: IPU22_RS12430_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C++GA CL DGPIPDFE+AG TG FG+

1

GCSACAVGAVCLADGPIPDFEVAGITGTFGI

31

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.06 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.87 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.25 out of 26.06

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.21 out of 23.79

Confidence: medium

Additional weak hits (8):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.37 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.52 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.53 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.38 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.89 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.28 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.81 out of 33.14

Confidence: weak

RREFinder

Sactipeptides

TFBS Finder

RRE predictions

: RRE type: Subtilosin_rSAM_RRE; Location: 5 - 98; Score: 93.1

Core peptide predictions

MOD08_RS05770: Putative sactipeptide; RODEO score: 33.0; Core sequence, approximate: GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_JALAQD010000002.1 - Region 2 - NRPS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 715,026 - 754,092 nt. (total: 39,067 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

MOD08_RS07525: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: ligase synthase

MOD08_RS07530: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MOD08_RS07535: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOD08_RS07540: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: permease

MOD08_RS07465: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0000426.5	0.68	NRPS	sevadicin	Paenibacillus larvae
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001133.4	0.64	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000402.4	0.61	NRPS	paenilarvin A, paenilarvin B, paenilarvin C	Paenibacillus larvae subsp. larvae DSM 25430
BGC0001132.4	0.61	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0000426.5	0.67	NRPS	sevadicin	Paenibacillus larvae
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001133.4	0.65	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000402.4	0.64	NRPS	paenilarvin A, paenilarvin B, paenilarvin C	Paenibacillus larvae subsp. larvae DSM 25430
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.22 out of 27.78

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.40 out of 27.55

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.98 out of 18.16

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.42 out of 27.78

Confidence: medium

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 25.52 out of 28.14

Confidence: medium

Additional weak hits (4):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.52 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.16 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.82 out of 27.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.01 out of 28.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 715025 - 754092:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - mal) + (X - D-Asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOD08_RS07525: mal

PKS_AT (5..285): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 55.2
inactive: 22.6
Methoxymalonyl-CoA: 20.6
Methylmalonyl-CoA: 13.6
fatty_acid: 12.1
Ethylmalonyl-CoA: 9.3
trans-1,2-CPDA: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOD08_RS07530: fatty_acid

CAL_domain (34..476): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 252.7
NH2: 28.6
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

MOD08_RS07535: X - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (431..824): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWCYFDAFVTSTDVVLGGEINAYGPTEGTVLCTC
Nearest Stachelhaus code(s):: Tyr DAIDVGAVGK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1472..1865): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGEYNEYGPTETVVGCMF
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

MOD08_RS07540: Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (473..794): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LAMAFDASVYETTLVSAGEINAYGPTESTVCATY
Nearest Stachelhaus code(s):: Tyr DASTVAAVCK (82% 8Å match); Phe DAFTVAAVCK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
PerR	Peroxide regulator

NZ_JALAQD010000004.1 - Region 1 - NRPS,PKS-like,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 94,562 - 210,097 nt. (total: 115,536 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
PKS-like: (t2pks2 or ksIII)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

MOD08_RS08060: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

MOD08_RS08165: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOD08_RS08185: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase

MOD08_RS08120: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MOD08_RS08125: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MOD08_RS08130: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase protease

MOD08_RS08115: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

MOD08_RS08195: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: hydratase

MOD08_RS08150: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

MOD08_RS08155: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

MOD08_RS08065: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

MOD08_RS08140: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MOD08_RS08145: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

MOD08_RS08160: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOD08_RS08170: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MOD08_RS08175: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOD08_RS08180: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001089.5	1.31	NRPS, PKS	bacillaene	Bacillus velezensis FZB42
BGC0001160.5	1.30	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001135.5	1.30	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001164.3	1.28	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001825.4	1.27	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000205.3	1.26	PKS	bryostatin	Candidatus Endobugula sertula
BGC0001132.4	1.26	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.25	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.23	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.22	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001089.5	0.79	NRPS, PKS	bacillaene	Bacillus velezensis FZB42
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000205.3	0.65	PKS	bryostatin	Candidatus Endobugula sertula
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.54 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.49 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.64 out of 26.06

Confidence: medium

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 22.86 out of 26.12

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 23.04 out of 24.78

Confidence: strong

Additional weak hits (10):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.76 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.89 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.51 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.96 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.44 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.54 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.72 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.68 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.87 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 94561 - 210097:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - Gly - ccmal - ohmal - mal) + (ccmal - mal - ohmal - mal) + (Me-ccmal - ohmal - mal) + (Ala - ccmal - ccmal - Me-ccmal) + (mal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOD08_RS08120: mal

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 91.6
Methoxymalonyl-CoA: 43.2
inactive: 38.9
Methylmalonyl-CoA: 27.0
Propionyl-CoA: 18.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOD08_RS08125: mal

PKS_AT (7..293): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 40.2
inactive: 21.9
Isobutyryl-CoA: 10.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOD08_RS08130: mal

PKS_AT (4..283): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 84.8
inactive: 33.0
Methoxymalonyl-CoA: 28.8
Methylmalonyl-CoA: 9.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOD08_RS08160: fatty_acid - Gly

Search NORINE for peptide: strict or relaxed

CAL_domain (60..476): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 12.0
NH2: 10.1
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1153..1548): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDIAALELQALCGGEWNMFGPTETTVWSAI
Nearest Stachelhaus code(s):: Gly DILQLGMVWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

MOD08_RS08175: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (473..881): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TFLTFDVSISEGNFMVAGEENIYGPTEASIYAAY
Nearest Stachelhaus code(s):: Ala DVSNMAIIYK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 2	Repressor of DNA damage response
LuxO	Repressor of luminescence
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_JALAQD010000009.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 26,201 nt. (total: 26,201 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase aminotransferase

MOD08_RS10355: aminotransferase

smcogs: SMCOG1019: aminotransferase

MOD08_RS10360: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: dehalogenase esterase

MOD08_RS10340: thioesterase

smcogs: SMCOG1004: thioesterase

MOD08_RS10410: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase

MOD08_RS10330: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOD08_RS10335: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000426.5	0.69	NRPS	sevadicin	Paenibacillus larvae
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002071.2	0.67	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001133.4	0.66	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000426.5	0.69	NRPS	sevadicin	Paenibacillus larvae
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002071.2	0.67	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001133.4	0.66	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.28 out of 27.78

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.75 out of 18.57

Confidence: strong

Additional weak hits (2):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.22 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.72 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 26201:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOD08_RS10335: Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (469..866): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VQTSFDGFTFDAFVLFGGEIHVYGPTEVTVFATA
Nearest Stachelhaus code(s):: Ile DGFFLGVVFK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ToxT	Regulator of MSHA biosynthesis

NZ_JALAQD010000010.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 34,256 - 55,146 nt. (total: 20,891 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase

MOD08_RS11290: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

MOD08_RS11250: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

MOD08_RS11260: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000639.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000638.3	0.37	terpene	carotenoid	Pantoea ananatis
BGC0000640.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000639.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000638.3	0.37	terpene	carotenoid	Pantoea ananatis
BGC0000640.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

MOD08_RS11260: PT_FPPS_like

Domain 1 (33 - 296): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.07 out of 18.46

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.31 out of 26.06

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 25.31

Confidence: medium

Additional weak hits (2):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.61 out of 30.25

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 20.11 out of 30.12

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis

NZ_JALAQD010000013.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 150,541 - 191,638 nt. (total: 41,098 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOD08_RS16540: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase methyltransferase

MOD08_RS16555: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

MOD08_RS16590: isoprenylcysteine carboxyl methyltransferase

smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Ligases: synthase

MOD08_RS16585: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.54	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.54	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001962.3	0.49	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000867.3	0.45	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002332.2	0.44	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001847.2	0.44	other (other)	1-carbapen-2-em-3-carboxylic acid	Pectobacterium carotovorum
BGC0001475.4	0.43	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001810.3	0.39	PKS	trehangelin	Polymorphospora rubra
BGC0001663.3	0.38	PKS	merocyclophane C, merocyclophane D	Nostoc sp. UIC 10110

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.54	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.54	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001962.3	0.49	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000867.3	0.45	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002332.2	0.44	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001847.2	0.44	other (other)	1-carbapen-2-em-3-carboxylic acid	Pectobacterium carotovorum
BGC0001475.4	0.43	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001810.3	0.39	PKS	trehangelin	Polymorphospora rubra
BGC0001663.3	0.38	PKS	merocyclophane C, merocyclophane D	Nostoc sp. UIC 10110

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.53 out of 26.06

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.55 out of 27.78

Confidence: medium

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 26.96 out of 32.74

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.98 out of 20.97

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.87 out of 30.25

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.05 out of 27.55

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.83 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.08 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.93 out of 28.19

Confidence: medium

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 26.59 out of 33.14

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.93 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.14 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.27 out of 28.19

Confidence: medium

Additional weak hits (12):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.16 out of 25.88

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 27.73 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.48 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.18 out of 25.75

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.80 out of 26.12

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.83 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.07 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 25.13 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.03 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.80 out of 26.12

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.01 out of 24.78

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
FuR variant 2	Ferric Uptake Regulator
GnfM	Regulator of nitrogen-fixation genes
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor
ZuR variant 2	Zinc-responsive repressor

NZ_JALAQD010000014.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 49,885 - 101,750 nt. (total: 51,866 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

MOD08_RS17385: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOD08_RS17460: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOD08_RS17520: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

MOD08_RS17525: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

MOD08_RS17565: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Hydrolases: hydrolase

MOD08_RS17350: isochorismatase

smcogs: SMCOG1027: isochorismatase

MOD08_RS17445: isochorismatase

smcogs: SMCOG1027: isochorismatase

MOD08_RS17540: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Isomerases: isomerase

MOD08_RS17455: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

MOD08_RS17440: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOD08_RS17450: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000309.5	1.15	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0001185.5	1.10	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000401.5	1.07	NRPS	paenibactin	Paenibacillus elgii B69
BGC0000343.5	0.86	NRPS	enterobactin	Pseudomonas sp. J465
BGC0002075.3	0.85	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002695.2	0.75	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000309.5	0.83	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0001185.5	0.81	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000401.5	0.81	NRPS	paenibactin	Paenibacillus elgii B69
BGC0000343.5	0.74	NRPS	enterobactin	Pseudomonas sp. J465
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002695.2	0.70	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.37 out of 27.78

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.26 out of 26.06

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.61 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 25.47 out of 26.06

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 27.15 out of 29.38

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.61 out of 27.78

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.49 out of 29.38

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.54 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.52 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.97 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.60 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.73 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 26.46 out of 33.14

Confidence: medium

Additional weak hits (17):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.53 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.62 out of 23.43

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.90 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.61 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.12 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.55 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.31 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.89 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.88 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.10 out of 23.43

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.74 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.27 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.42 out of 32.74

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 21.63 out of 30.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 49884 - 101750:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOD08_RS17440: Gly - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (466..869): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDISALELQALVGGETNLYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1529..1945): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQIFGGEINMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

MOD08_RS17450: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SISLYPLSSPGGALQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVVNK (100% 8Å match); diOH-Bz or Sal PLPAQGVVNK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor
ZuR variant 2	Zinc-responsive repressor

NZ_JALAQD010000014.1 - Region 2 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 116,374 - 146,477 nt. (total: 30,104 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

MOD08_RS17805: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Lyases: dehydratase

MOD08_RS17720: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002311.3	0.53	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0001472.5	0.47	ribosomal	berninamycin A	Streptomyces bernensis
BGC0000605.5	0.47	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0002120.3	0.47	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001173.5	0.45	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000566.5	0.44	ribosomal	streptolysin S	Streptococcus pyogenes M1 GAS
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001170.5	0.44	ribosomal	clostridiolysin S	Clostridium sporogenes ATCC 15579
BGC0000564.5	0.44	ribosomal	clostridiolysin S	Clostridium botulinum A str. ATCC 3502

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002311.3	0.53	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0001472.5	0.47	ribosomal	berninamycin A	Streptomyces bernensis
BGC0000605.5	0.47	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0002120.3	0.47	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001173.5	0.45	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000566.5	0.44	ribosomal	streptolysin S	Streptococcus pyogenes M1 GAS
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001170.5	0.44	ribosomal	clostridiolysin S	Clostridium sporogenes ATCC 15579
BGC0000564.5	0.44	ribosomal	clostridiolysin S	Clostridium botulinum A str. ATCC 3502

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.52 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.70 out of 26.06

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.96 out of 30.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.64 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.19 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.64 out of 26.06

Confidence: medium

Additional weak hits (6):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.08 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.76 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.15 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.48 out of 29.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.48 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.35 out of 33.14

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

TFBS Finder

Azole RiPPs

TFBS definitions

Regulator	Description
ColR	Phenol-responsive regulator
MogR	Repressor of flagellar motility genes

Core peptide predictions

No core peptides found.

NZ_JALAQD010000016.1 - Region 1 - NRPS,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 5,437 - 52,447 nt. (total: 47,011 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

MOD08_RS18780: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

MOD08_RS18820: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: methyltransferase

MOD08_RS18750: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: hydrolase

MOD08_RS18755: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: decarboxylase

MOD08_RS18775: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: ligase

MOD08_RS18770: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

MOD08_RS18800: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	1.19	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002111.3	0.55	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0002701.2	0.40	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0000551.5	0.36	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.35	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.35	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.35	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.34	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0001261.3	0.33	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.33	NRPS	peramine	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	0.84	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for MOD08_RS18740

MOD08_RS18745

Leader:

MNTVLELQKLAHDTDGKGPAVE

Core:

ATITTTWTVTTTSGFVSSVSNHC

Core with dehydrations:

ADhbIDhbDhbDhbWDhbVDhbDhbDhbDhaGFVDhaDhaVDhaNHCys

antiSMASH-DB 4.0 matches for MOD08_RS18745

95.8%

NC_022081.1and 21 others:

NZ_CP016913.1 Lanthipeptides: BARD7_RS19060_lanthipeptideNZ_CP022654.2 Lanthipeptides: CHN56_RS21570_lanthipeptideNZ_CP032144.1 Lanthipeptides: D3C60_RS19850_lanthipeptideNZ_CP034203.1 Lanthipeptides: EBA29_RS19705_lanthipeptideNZ_CP040378.1 Lanthipeptides: D1120_RS19620_lanthipeptideNZ_CP068563.1 Lanthipeptides: JKJ03_RS01160_lanthipeptideNZ_CP069391.1 Lanthipeptides: JR311_RS02265_lanthipeptideNZ_CP073635.1 Lanthipeptides: KEF49_RS01155_lanthipeptideNZ_CP083764.1 Lanthipeptides: LAZ98_RS01175_lanthipeptideNZ_CP085388.1 Lanthipeptides: LIS75_RS01165_lanthipeptideNZ_CP088300.1 Lanthipeptides: LQ763_RS01075_lanthipeptideNZ_CP097586.1 Lanthipeptides: M8971_RS04245_lanthipeptideNZ_CP107556.1 Lanthipeptides: OF857_RS01165_lanthipeptideNZ_CP116014.1 Lanthipeptides: PF996_RS01170_lanthipeptideNZ_JAGFPJ010000003.1 Lanthipeptides: J5M77_RS15590_lanthipeptideNZ_JALAQD010000016.1 Lanthipeptides: MOD08_RS18745_lanthipeptideNZ_JALAUL010000008.1 Lanthipeptides: MOE42_RS14800_lanthipeptideNZ_JAQEMJ010000010.1 Lanthipeptides: PGW53_RS13095_lanthipeptideNZ_LMAG01000010.1 Lanthipeptides: ASQ47_RS20350_lanthipeptideNZ_PVRP01000003.1 Lanthipeptides: C6355_RS19570_lanthipeptideNZ_SUKE01000008.1 Lanthipeptides: FAZ22_RS20105_lanthipeptide

Lanthipeptides: BASU_RS20300_lanthipeptide

1

ATITTTWTVTTTSGFVSSVSNHC

23

ATITTTWTVTTTSGFVSSVSNHC

2

ATITTTWTVTTTSGFVSSVSNHC

24

52.2%

NZ_FOHE01000012.1and 1 other:

NZ_FOHE01000012.1 Lanthipeptides: BMX40_RS20540_lanthipeptide

Lanthipeptides: BMX40_RS20545_lanthipeptide

6

TWTVTTTSGFVSSVSNHC

23

TWTVT F+S+VSNHC

4

TWTVTI---FLSTVSNHC

18

39.1%

NC_014551.1and 13 others:

NC_017188.1 Lanthipeptides: BAMTA208_RS20935_lanthipeptideNZ_CP026010.1 Lanthipeptides: BS11774_RS22080_lanthipeptideNZ_CP032146.1 Lanthipeptides: D2M30_RS20760_lanthipeptideNZ_CP054584.1 Lanthipeptides: HT135_RS21830_lanthipeptideNZ_CP061284.1 Lanthipeptides: ICJ61_RS04855_lanthipeptideNZ_CP062984.1 Lanthipeptides: IL989_RS03875_lanthipeptideNZ_CP065858.1 Lanthipeptides: I7X10_RS19015_lanthipeptideNZ_DF836084.1 Lanthipeptides: CMW1_RS20390_lanthipeptideNZ_JAHVOC010000011.1 Lanthipeptides: KXD37_RS21915_lanthipeptideNZ_JALAPV010000012.1 Lanthipeptides: MOC91_RS19785_lanthipeptideNZ_JALAQA010000009.1 Lanthipeptides: MOD07_RS18870_lanthipeptideNZ_JANDGG010000010.1 Lanthipeptides: NKU38_RS19495_lanthipeptideNZ_KQ236689.1 Lanthipeptides: AD710_RS19845_lanthipeptide

Lanthipeptides: BAMF_RS41660_lanthipeptide

4

TTTWTVTTTSGFVSSVSNHC

23

T WT+ TT S++SN C

1

TAGWTLLTTLIGTSTISNSC

20

with 9 more sequence matches

37.9%

NZ_CP089924.1:

Lanthipeptides: LVB77_RS02735_lanthipeptide

8

TVTTTSGFVSSVSNHC

23

+V TSG SSVSNHC

5

SVNCTSG--SSVSNHC

18

34.8%

NZ_WEHU01000003.1and 3 others:

NZ_WEHU01000003.1 Lanthipeptides: F9279_RS25000_lanthipeptideNZ_WEHU01000003.1 Lanthipeptides: F9279_RS24995_lanthipeptideNZ_WEHU01000003.1 Lanthipeptides: F9279_RS24990_lanthipeptide

Lanthipeptides: F9279_RS25005_lanthipeptide

15

FVSSVSNHC

23

FVSS+SNHC

15

FVSSISNHC

23

34.5%

NZ_CP025227.1:

Lanthipeptides: allorf_0999194_0999376_lanthipeptide

7

WTVTTTS--GFVSSVSNHC

23

WTV TTS G V ++S C

2

WTVPTTSTIGLVCTLSWEC

20

26.1%

NZ_BBYG01000022.1:

Lanthipeptides: AOQ37_RS40945_lanthipeptide

17

SSVSNHC

23

SS+SNHC

4

SSISNHC

10

26.1%

NZ_CP014806.1and 3 others:

NZ_CP014806.1 Lanthipeptides: ATY39_RS17975_lanthipeptideNZ_CP014806.1 Lanthipeptides: ATY39_RS17970_lanthipeptideNZ_CP014806.1 Lanthipeptides: ATY39_RS17965_lanthipeptide

Lanthipeptides: ATY39_RS17980_lanthipeptide

15

FVSSVSNHC

23

F S++SNHC

15

FASTISNHC

23

26.1%

NZ_CP018933.1and 24 others:

NZ_CP018933.1 Lanthipeptides: BEI49_RS29525_lanthipeptideNZ_CP018933.1 Lanthipeptides: BEI49_RS29520_lanthipeptideNZ_CP018933.1 Lanthipeptides: BEI49_RS29515_lanthipeptideNZ_CP018933.1 Lanthipeptides: BEI49_RS29510_lanthipeptideNZ_CP018933.1 Lanthipeptides: BEI49_RS29505_lanthipeptideNZ_CP018933.1 Lanthipeptides: BEI49_RS29500_lanthipeptideNZ_CP018933.1 Lanthipeptides: BEI49_RS29495_lanthipeptideNZ_CP018933.1 Lanthipeptides: BEI49_RS29490_lanthipeptideNZ_CP018933.1 Lanthipeptides: BEI49_RS29485_lanthipeptideNZ_CP018933.1 Lanthipeptides: BEI49_RS29480_lanthipeptideNZ_CP018933.1 Lanthipeptides: BEI49_RS29475_lanthipeptideNZ_CP085399.1 Lanthipeptides: LIS81_RS04325_lanthipeptideNZ_CP085399.1 Lanthipeptides: LIS81_RS04320_lanthipeptideNZ_CP085399.1 Lanthipeptides: LIS81_RS04315_lanthipeptideNZ_CP085399.1 Lanthipeptides: LIS81_RS04310_lanthipeptideNZ_CP085399.1 Lanthipeptides: LIS81_RS04305_lanthipeptideNZ_CP085399.1 Lanthipeptides: LIS81_RS04300_lanthipeptideNZ_CP085399.1 Lanthipeptides: LIS81_RS04295_lanthipeptideNZ_CP085399.1 Lanthipeptides: LIS81_RS04290_lanthipeptideNZ_CP085399.1 Lanthipeptides: LIS81_RS04285_lanthipeptideNZ_CP085399.1 Lanthipeptides: LIS81_RS04280_lanthipeptideNZ_NTVN01000027.1 Lanthipeptides: CN415_RS28750_lanthipeptideNZ_PJCU01000036.1 Lanthipeptides: CWE34_RS31080_lanthipeptideNZ_PJCU01000036.1 Lanthipeptides: CWE34_RS31075_lanthipeptide

Lanthipeptides: BEI49_RS29530_lanthipeptide

15

FVSSVSNHC

23

+ S+VSNHC

14

WASTVSNHC

22

26.1%

NZ_GL545262.1:

Lanthipeptides: HMPREF0798_RS11830_lanthipeptide

8

TVTTTSGFVSSVSNHC

23

+++T F+S++S HC

1

SISTLVAFLSTISQHC

16

21.2%

NZ_MIFN01000022.1and 1 other:

NZ_MIFN01000022.1 Lanthipeptides: BHL26_RS15355_lanthipeptide

Lanthipeptides: BHL26_RS15355_lanthipeptide

3

ITTTWTVTTTSGFVSS

18

+ TT +T SG++SS

6

LATTGALTAVSGYISS

21

17.4%

NZ_QVFA01000004.1:

Lanthipeptides: DW882_RS14120_lanthipeptide

4

TTTWTVTTTSGFVSSVSN

21

TTT ++ S VS++SN

14

TTTAIISAISSVVSAISN

31

MIBiG 4.0 matches for MOD08_RS18745

39.1%

BGC0002111.3 (EVG22_32245):

Lanthipeptide: andalusicin A or andalusicin B

8

TVTTTSGFVSSVSNHC

23

TVTTT + S++SN+C

8

TVTTTGAWASTISNNC

23

39.1%

BGC0002111.3 (multiple genes):

Lanthipeptide: andalusicin A or andalusicin B

8

TVTTTSGFVSSVSNHC

23

TVTTT + S++SN+C

8

TVTTTGVWASTISNNC

23

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.42 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.70 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.28 out of 26.06

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.16 out of 20.97

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 21.55

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.94 out of 21.55

Confidence: medium

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

MOD08_RS18745 - Class III

Cleavage pHMM score: -1.90

RODEO score: 0

Monoisotopic mass: 2184.1 Da

Molecular weight: 2185.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2203.4 Da N = 1; 2221.4 Da N = 2; 2239.4 Da N = 3; 2257.4 Da N = 4; 2275.5 Da N = 5; 2293.5 Da N = 6; 2311.5 Da N = 7; 2329.5 Da N = 8; 2347.5 Da N = 9; 2365.6 Da N = 10; 2383.6 Da N = 11

Predicted core structure(s)

For candidate cluster 1, location 5436 - 52447:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOD08_RS18770: X - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (266..656): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FVMAFDISLLEIESLLAGELNIYGPTETTLCAAL
Nearest Stachelhaus code(s):: Pro DLLYLALVCK (59% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1303..1683): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNTLHSGDISLGGATEASIWSIY
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_JALAQD010000016.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 181,674 - 209,577 nt. (total: 27,904 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

MOD08_RS19470: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

MOD08_RS19505: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Ligases: ligase synthase

MOD08_RS19490: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

MOD08_RS19570: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.88 out of 27.78

Confidence: medium

Additional weak hits (2):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.63 out of 26.12

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 181673 - 209577:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Glu - Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOD08_RS19570: Glu - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (466..869): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: LSLAFDASVKQADGLIGGETNVYGPTETCVDASV
Nearest Stachelhaus code(s):: Glu DAKDLGVVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1512..1910): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: TQTSFDAFMFDGMIMFGGELHMYGPSESTVFATY
Nearest Stachelhaus code(s):: Leu DAFMMGMVFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ToxT	Regulator of MSHA biosynthesis

NZ_JALAQD010000020.1 - Region 1 - NRPS,betalactone

Download region GenBank file

Download region SVG

Location: 1 - 64,103 nt. (total: 64,103 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOD08_RS20110: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

MOD08_RS20175: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: carboxylase transferase

MOD08_RS20185: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

MOD08_RS20205: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

MOD08_RS20220: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Hydrolases: peptidase

MOD08_RS20120: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Lyases: hydratase

MOD08_RS20200: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

MOD08_RS20070: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOD08_RS20075: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOD08_RS20180: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOD08_RS20195: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.41	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.40	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.40	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.39	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.38	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.38	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.38	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001103.5	0.37	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001261.3	0.37	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.36	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.70	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.93 out of 29.25

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.70 out of 27.55

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.81 out of 30.25

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.34 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.99 out of 26.06

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.53 out of 20.97

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.35 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.53 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.71 out of 18.16

Confidence: strong

Additional weak hits (8):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.25 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.55 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.47 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.70 out of 29.38

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.51 out of 29.51

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.02 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.77 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.53 out of 30.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 64103:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Tyr - D-Asn - Gln - Pro - D-Asn) + (Asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 43729:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Tyr - D-Asn - Gln - Pro - D-Asn) + (Asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOD08_RS20070: Tyr - Asn - Gln - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (175..569): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: SWKYFDAFILNGSTVVGGENNEYGPTENSVVSTF
Nearest Stachelhaus code(s):: Tyr DALSVGEVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1686..2081): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGECNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3195..3600): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDASVQQADGLIGGETNVYGPTETCVDASL
Nearest Stachelhaus code(s):: Gln DAQDLGVVDK (100% 8Å match); Ile DAQDLGVVDK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4244..4640): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LYEAFDVCYQESFLIAAGEHNHYGPSETHVVTMY
Nearest Stachelhaus code(s):: Pro DVQFIAHVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOD08_RS20075: Asn - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (268..663): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGDFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1778..2173): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGDFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOD08_RS20180: X

AMP-binding (12..445): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NNIVF-GCVLGAHGIMAGSTIAYGQTEASPVITQ
Nearest Stachelhaus code(s):: Z-ahmohOrn FGLHIASTCK (56% 8Å match); Ile DGLFIGIPVK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
GnfM	Regulator of nitrogen-fixation genes
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence
SypG	Regulator of biofilm formation and host colonization
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JALAQD010000021.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 401 - 15,160 nt. (total: 14,760 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOD08_RS20445: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000313.4	0.36	NRPS	beauvericin	Beauveria bassiana
BGC0001535.3	0.34	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002255.3	0.29	PKS	lijiquinone	Ascomycota sp. F53
BGC0001865.4	0.28	PKS	elsinochrome C	Parastagonospora nodorum SN15
BGC0000663.5	0.27	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001575.4	0.26	NRPS	PZN5, PZN6, PZN7, PZN9, PZN10, PZN11	Ruminococcus sp. 5_1_39BFAA
BGC0001338.4	0.26	PKS	citrinin	Monascus ruber
BGC0000154.4	0.26	PKS	stipitatic acid	Talaromyces stipitatus ATCC 10500
BGC0001739.3	0.25	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001057.4	0.24	NRPS, PKS	zearalenone	Fusarium graminearum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000313.4	0.36	NRPS	beauvericin	Beauveria bassiana
BGC0001535.3	0.34	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002255.3	0.29	PKS	lijiquinone	Ascomycota sp. F53
BGC0001865.4	0.28	PKS	elsinochrome C	Parastagonospora nodorum SN15
BGC0000663.5	0.27	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001575.4	0.26	NRPS	PZN5, PZN6, PZN7, PZN9, PZN10, PZN11	Ruminococcus sp. 5_1_39BFAA
BGC0001338.4	0.26	PKS	citrinin	Monascus ruber
BGC0000154.4	0.26	PKS	stipitatic acid	Talaromyces stipitatus ATCC 10500
BGC0001739.3	0.25	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001057.4	0.24	NRPS, PKS	zearalenone	Fusarium graminearum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

MOD08_RS20440: T2TS

Domain 1 (3 - 626): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.30 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.70 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.28 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.83 out of 28.19

Confidence: medium

Additional weak hits (2):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.22 out of 26.06

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor

NZ_JALAQD010000022.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,809 nt. (total: 10,809 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

MOD08_RS20465: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOD08_RS20470: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOD08_RS20480: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOD08_RS20485: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001050.5	0.69	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001050.5	0.69	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.16 out of 26.06

Confidence: medium

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 10809:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Leu) + (Val) + (Asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOD08_RS20465: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (47..449): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YWFSFDLGYTSPKLVLGGEINHYGPTETTIGTVA
Nearest Stachelhaus code(s):: Asp DLTKVGHIGK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

MOD08_RS20480: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNAGFDAGTFEGWLIIGGDWNGYGPTENTTFSTS
Nearest Stachelhaus code(s):: Val DAFWIGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOD08_RS20485: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (0..313): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDASIWEPFLLTGGDVNNYGPTENTVVATS
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes

NZ_JALAQD010000026.1 - Region 1 - NRPS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 33,512 nt. (total: 33,512 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer

MOD08_RS20655: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOD08_RS20680: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

MOD08_RS20685: flavodoxin

smcogs: SMCOG1134: flavodoxin

Transferases: acylase kinase

MOD08_RS20640: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MOD08_RS20675: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: hydrolase

MOD08_RS20695: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

MOD08_RS20725: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Ligases: synthase

MOD08_RS20635: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.25 out of 18.46

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 23.63 out of 27.55

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.95 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.19 out of 27.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.48 out of 24.78

Confidence: strong

Additional weak hits (5):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.51 out of 36.54

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.97 out of 25.88

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.25 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.62 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 33512:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - mal - Asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOD08_RS20635: fatty_acid - Asn

Search NORINE for peptide: strict or relaxed

CAL_domain (36..479): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 601.2
NH2: 18.0
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (2953..3348): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGEFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOD08_RS20640: mal

PKS_AT (6..293): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 71.7
inactive: 37.1
Methoxymalonyl-CoA: 20.1
Methylmalonyl-CoA: 9.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
LexA variant 2	Repressor of DNA damage response
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JALAQD010000032.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 7,782 nt. (total: 7,782 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

MOD08_RS21115: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.64 out of 28.19

Confidence: strong

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
ZuR variant 1	Zinc-responsive repressor