GCF_026788285.1 - 16 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JALAJC010000001.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	transAT-PKS,PKS-like,NRPS	812,628	925,108	High	bacillaene	NRPS:Type I+PKS:Type I
Region 1.2	NRPS,transAT-PKS,betalactone	979,163	1,060,455	Medium	fengycin	NRPS:Type I

NZ_JALAJC010000004.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	terpene-precursor	1	18,224

NZ_JALAJC010000005.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	other	1	35,632	High	bacilysin	other:other
Region 5.2	RiPP-like	270,144	281,012

NZ_JALAJC010000006.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	NRPS	1	28,253	Low	surfactin	NRPS:Type I

NZ_JALAJC010000012.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	sactipeptide	246,766	268,378	High	subtilosin A	ribosomal:RiPP:Thiopeptide

NZ_JALAJC010000013.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	NRPS	1	39,252	Medium	plipastatin	NRPS:Type I
Region 12.2	terpene	137,068	158,966
Region 12.3	T3PKS	208,141	249,238	Low	1-carbapen-2-em-3-carboxylic acid	other:other

NZ_JALAJC010000014.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	terpene-precursor,NRP-metallophore,NRPS	66,338	132,605	High	bacillibactin	NRPS:Type I

NZ_JALAJC010000016.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	NRPS,T1PKS	1	62,426	Low	zwittermicin A	NRPS:Type I+PKS

NZ_JALAJC010000019.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	NRPS	1	10,877

NZ_JALAJC010000024.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	NRPS	1	9,531

NZ_JALAJC010000025.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	NRPS	1	10,368	Low	lichenysin	NRPS:Type I

NZ_JALAJC010000030.1 (Bacillus inaquosorum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 28.1	NRPS	1	1,275

No secondary metabolite regions were found in these records:: NZ_JALAJC010000002.1 (Bacillus inaquosorum); NZ_JALAJC010000003.1 (Bacillus inaquosorum); NZ_JALAJC010000007.1 (Bacillus inaquosorum); NZ_JALAJC010000009.1 (Bacillus inaquosorum); NZ_JALAJC010000010.1 (Bacillus inaquosorum); NZ_JALAJC010000011.1 (Bacillus inaquosorum); NZ_JALAJC010000015.1 (Bacillus inaquosorum); NZ_JALAJC010000017.1 (Bacillus inaquosorum); NZ_JALAJC010000018.1 (Bacillus inaquosorum); NZ_JALAJC010000020.1 (Bacillus inaquosorum); NZ_JALAJC010000021.1 (Bacillus inaquosorum); NZ_JALAJC010000022.1 (Bacillus inaquosorum); NZ_JALAJC010000023.1 (Bacillus inaquosorum); NZ_JALAJC010000026.1 (Bacillus inaquosorum); NZ_JALAJC010000027.1 (Bacillus inaquosorum); NZ_JALAJC010000028.1 (Bacillus inaquosorum)

Compact view

NZ_JALAJC010000001.1 - Region 1 - NRPS,PKS-like,transAT-PKS

Download region GenBank file

Download region SVG

Location: 812,628 - 925,108 nt. (total: 112,481 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
PKS-like: (t2pks2 or ksIII)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

MOB18_RS04360: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

MOB18_RS04495: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOB18_RS04515: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase

MOB18_RS04450: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MOB18_RS04455: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MOB18_RS04460: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase protease

MOB18_RS04440: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

MOB18_RS04530: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: hydratase

MOB18_RS04480: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

MOB18_RS04485: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

MOB18_RS04365: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

MOB18_RS04470: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MOB18_RS04475: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

MOB18_RS04490: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOB18_RS04500: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MOB18_RS04505: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOB18_RS04510: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	1.01	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.99	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001089.5	0.92	NRPS, PKS	bacillaene	Bacillus velezensis FZB42
BGC0001128.4	0.85	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000205.3	0.84	PKS	bryostatin	Candidatus Endobugula sertula
BGC0002191.2	0.84	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002274.2	0.82	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001161.5	0.81	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0001163.3	0.81	PKS	1-heptadecene	Moorea producens 3L
BGC0001162.3	0.81	PKS	1-heptadecene	Moorea producens JHB

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001089.5	0.73	NRPS, PKS	bacillaene	Bacillus velezensis FZB42
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002274.2	0.63	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	0.62	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.62	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000205.3	0.62	PKS	bryostatin	Candidatus Endobugula sertula
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.85 out of 25.31

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.20 out of 27.78

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.32 out of 30.25

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 24.56 out of 24.78

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.88 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.25 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 28.19

Confidence: medium

Additional weak hits (14):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.21 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 25.41 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.90 out of 29.38

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.54 out of 20.01

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.15 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.82 out of 28.14

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.54 out of 36.54

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.69 out of 27.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.52 out of 33.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.86 out of 30.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.22 out of 20.01

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.82 out of 29.38

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 812627 - 925108:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid) + (ccmal - mal - ohmal - mal) + (Me-ccmal - ohmal - mal) + (Ala - ccmal - ccmal - Me-ccmal) + (mal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOB18_RS04450: mal

PKS_AT (4..283): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 94.1
Methoxymalonyl-CoA: 45.7
inactive: 38.0
Methylmalonyl-CoA: 33.4
Propionyl-CoA: 24.7
Ethylmalonyl-CoA: 12.6
CHC-CoA: 12.4
2-Methylbutyryl-CoA: 9.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

MOB18_RS04455: pk

PKS_AT (7..293): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 32.3
Malonyl-CoA: 23.1
Isobutyryl-CoA: 9.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOB18_RS04460: mal

PKS_AT (4..284): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 84.4
inactive: 37.6
Methoxymalonyl-CoA: 28.6
Methylmalonyl-CoA: 22.8
Propionyl-CoA: 14.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOB18_RS04490: fatty_acid

CAL_domain (60..476): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 17.4
NH2: 10.4
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

MOB18_RS04505: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (472..880): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TFLTFDVSISEGNFMVAGEDNIYGPTEASIYAAY
Nearest Stachelhaus code(s):: Ala DVSNMAIIYK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JALAJC010000001.1 - Region 2 - NRPS,betalactone,transAT-PKS

Download region GenBank file

Download region SVG

Location: 979,163 - 1,060,455 nt. (total: 81,293 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOB18_RS05165: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acetyltransferase acylase carboxylase transferase

MOB18_RS05105: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MOB18_RS05120: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

MOB18_RS05135: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

MOB18_RS05155: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

MOB18_RS05180: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Lyases: hydratase

MOB18_RS05140: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

MOB18_RS05090: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOB18_RS05095: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOB18_RS05100: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MOB18_RS05145: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

MOB18_RS05160: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOB18_RS05195: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOB18_RS05200: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001103.5	1.25	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0002135.2	1.21	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.19	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000402.4	1.18	NRPS	paenilarvin A, paenilarvin B, paenilarvin C	Paenibacillus larvae subsp. larvae DSM 25430
BGC0001128.4	1.16	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	1.14	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	1.13	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	1.12	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	1.09	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	1.08	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000402.4	0.81	NRPS	paenilarvin A, paenilarvin B, paenilarvin C	Paenibacillus larvae subsp. larvae DSM 25430
BGC0001103.5	0.80	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001090.5	0.71	NRPS, PKS	bacillomycin D	Bacillus velezensis FZB42
BGC0001050.5	0.71	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.21 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.86 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.56 out of 26.06

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.72 out of 27.78

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.28 out of 23.79

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.03 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.41 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.54 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.44 out of 26.06

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.45 out of 29.72

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.23 out of 26.06

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.53 out of 20.97

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.60 out of 21.55

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.52 out of 28.19

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 23.04 out of 24.78

Confidence: strong

Additional weak hits (11):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.51 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.25 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.75 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.15 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.05 out of 28.14

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.44 out of 20.47

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.18 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.00 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.26 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.38 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.47 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 979162 - 1060455:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Tyr) + (Ile) + (fatty_acid - mal - Asn - D-Tyr) + (D-Asn - Gln - Pro - D-Asn) + (Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOB18_RS05090: Asn - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (268..663): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGDFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1778..2177): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNNHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOB18_RS05095: Tyr - Asn - Gln - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (268..662): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: SWKYFDAFILNGSTVVGGENNEYGPTENSVVSTF
Nearest Stachelhaus code(s):: Tyr DALSVGEVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1779..2174): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGECNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3288..3693): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDASVQQADGLIGGETNVYGPTETCVDASL
Nearest Stachelhaus code(s):: Gln DAQDLGVVDK (100% 8Å match); Ile DAQDLGVVDK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4337..4733): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LYEAFDVCYQESFLIVAGEHNHYGPSETHVVTMY
Nearest Stachelhaus code(s):: Pro DVQFIAHVVK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

MOB18_RS05100: fatty_acid - Asn

Search NORINE for peptide: strict or relaxed

CAL_domain (36..478): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 608.7
NH2: 19.5
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (2956..3351): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGEFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOB18_RS05105: mal

PKS_AT (6..291): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 80.9
inactive: 33.8
Methoxymalonyl-CoA: 21.3
Methylmalonyl-CoA: 13.0
Propionyl-CoA: 12.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOB18_RS05160: X

AMP-binding (13..445): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NNIVF-GCVLGAHGIMAGSTIAYGQTEASPVITQ
Nearest Stachelhaus code(s):: Z-ahmohOrn FGLHIASTCK (56% 8Å match); Ile DGLFIGIPVK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

MOB18_RS05195: Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (481..874): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LNSGFDAVTFEGFLYVGGEHNIYGPTENTTFSTF
Nearest Stachelhaus code(s):: Ile DAFFYGITFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOB18_RS05200: Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (176..570): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: TWRFFDGFLTSTIITLAGEANEYGPTENSVATTV
Nearest Stachelhaus code(s):: Tyr DGTITAEVAK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
NtrC	Nitrogen regulatory protein C
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JALAJC010000004.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1 - 18,224 nt. (total: 18,224 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase

MOB18_RS06835: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

MOB18_RS06800: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

MOB18_RS06805: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000895.5	0.39	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000639.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000638.3	0.37	terpene	carotenoid	Pantoea ananatis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000895.5	0.39	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000639.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000638.3	0.37	terpene	carotenoid	Pantoea ananatis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

MOB18_RS06805: PT_FPPS_like

Domain 1 (33 - 296): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.05 out of 27.55

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.69 out of 21.55

Confidence: strong

Additional weak hits (1):

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 20.50 out of 30.12

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
GnfM	Regulator of nitrogen-fixation genes

NZ_JALAJC010000005.1 - Region 1 - other

Download region GenBank file

Download region SVG

Location: 1 - 35,632 nt. (total: 35,632 nt) Show pHMM detection rules used

Region on contig edge.

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOB18_RS07665: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOB18_RS07685: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOB18_RS07715: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase transferase

MOB18_RS07670: aminotransferase

smcogs: SMCOG1019: aminotransferase

MOB18_RS07745: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase lyase

MOB18_RS07680: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

MOB18_RS07735: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

MOB18_RS07740: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Translocases: permease

MOB18_RS07705: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001184.4	0.84	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000888.5	0.83	other (other)	bacilysin	Bacillus sp. CS93
BGC0000773.3	0.55	saccharide	lipopolysaccharide	Escherichia coli
BGC0000898.5	0.54	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000794.5	0.54	saccharide	S-layer glycan	Geobacillus stearothermophilus
BGC0000790.3	0.54	saccharide	O-antigen	Escherichia coli
BGC0000791.3	0.54	saccharide	O-antigen	Cronobacter sakazakii
BGC0000795.3	0.52	saccharide	S-layer glycan	Aneurinibacillus thermoaerophilus
BGC0000792.3	0.52	saccharide	polysaccharide	Enterococcus faecalis OG1RF
BGC0000827.3	0.51	other (other)	staurosporine	Salinispora arenicola CNS-205

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001184.4	0.84	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000888.5	0.83	other (other)	bacilysin	Bacillus sp. CS93
BGC0000773.3	0.55	saccharide	lipopolysaccharide	Escherichia coli
BGC0000898.5	0.54	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000794.5	0.54	saccharide	S-layer glycan	Geobacillus stearothermophilus
BGC0000790.3	0.54	saccharide	O-antigen	Escherichia coli
BGC0000791.3	0.54	saccharide	O-antigen	Cronobacter sakazakii
BGC0000795.3	0.52	saccharide	S-layer glycan	Aneurinibacillus thermoaerophilus
BGC0000792.3	0.52	saccharide	polysaccharide	Enterococcus faecalis OG1RF
BGC0000827.3	0.51	other (other)	staurosporine	Salinispora arenicola CNS-205

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.85 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.36 out of 27.78

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.33 out of 20.97

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.05 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.02 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.64 out of 26.06

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.92 out of 30.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.70 out of 26.06

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (2):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.37 out of 20.01

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.64 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis

NZ_JALAJC010000005.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 270,144 - 281,012 nt. (total: 10,869 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOB18_RS09025: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000616.4	0.52	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0001291.3	0.45	ribosomal	enterocin NKR-5-3B	Enterococcus faecium
BGC0001887.3	0.39	ribosomal	huazacin	Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
BGC0000555.3	0.34	ribosomal	staphylococcin C55 α, staphylococcin C55 β	Staphylococcus aureus
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000559.4	0.30	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0002329.2	0.26	NRPS	trinickiabactin	Trinickia caryophylli
BGC0000807.3	0.25	saccharide	phosphonoglycans	Stackebrandtia nassauensis DSM 44728
BGC0002336.2	0.22	NRPS	bolagladin A, bolagladin B	Burkholderia gladioli
BGC0002308.2	0.22	PKS, other (other)	camporidine A, camporidine B	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000616.4	0.52	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0001291.3	0.45	ribosomal	enterocin NKR-5-3B	Enterococcus faecium
BGC0001887.3	0.39	ribosomal	huazacin	Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
BGC0000555.3	0.34	ribosomal	staphylococcin C55 α, staphylococcin C55 β	Staphylococcus aureus
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000559.4	0.30	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0002329.2	0.26	NRPS	trinickiabactin	Trinickia caryophylli
BGC0000807.3	0.25	saccharide	phosphonoglycans	Stackebrandtia nassauensis DSM 44728
BGC0002336.2	0.22	NRPS	bolagladin A, bolagladin B	Burkholderia gladioli
BGC0002308.2	0.22	PKS, other (other)	camporidine A, camporidine B	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.02 out of 26.85

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.93 out of 26.33

Confidence: medium

Additional weak hits (2):

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 16.85 out of 20.47

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.16 out of 27.55

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
RutR	Regulator of the pyrimidine and purine metabolism

NZ_JALAJC010000006.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 28,253 nt. (total: 28,253 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer oxidoreductase

MOB18_RS09620: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

MOB18_RS09625: flavodoxin

smcogs: SMCOG1134: flavodoxin

Ligases: synthase

MOB18_RS09595: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.42 out of 27.78

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.01 out of 23.79

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.64 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.88 out of 27.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.26 out of 24.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.87 out of 28.19

Confidence: medium

Additional weak hits (4):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.04 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.59 out of 39.62

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.51 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 28253:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Glu - Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOB18_RS09535: Glu - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (466..867): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: LSLAFDASVKQADGLIGGETNVYGPTETCVDASV
Nearest Stachelhaus code(s):: Glu DAKDLGVVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1510..1908): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: TETSFDAFMFDGMIMFGGELHMYGPSESTVFATY
Nearest Stachelhaus code(s):: Leu DAFMMGMVFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JALAJC010000012.1 - Region 1 - sactipeptide

Download region GenBank file

Download region SVG

Location: 246,766 - 268,378 nt. (total: 21,613 nt) Show pHMM detection rules used

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Sactipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer

MOB18_RS16045: flavodoxin

smcogs: SMCOG1134: flavodoxin

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000602.5	0.88	ribosomal	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000514.5	0.38	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0001137.5	0.34	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002666.2	0.31	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0000310.5	0.30	NRPS	bacitracin	Bacillus licheniformis
BGC0000838.3	0.29	PKS	flexirubin	Flavobacterium johnsoniae UW101
BGC0001048.5	0.24	NRPS, PKS, saccharide	tallysomycin A, tallysomycin B	Streptoalloteichus hindustanus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000602.5	0.88	ribosomal	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000514.5	0.38	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0001137.5	0.34	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002666.2	0.31	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0000310.5	0.30	NRPS	bacitracin	Bacillus licheniformis
BGC0000838.3	0.29	PKS	flexirubin	Flavobacterium johnsoniae UW101
BGC0001048.5	0.24	NRPS, PKS, saccharide	tallysomycin A, tallysomycin B	Streptoalloteichus hindustanus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Sactipeptide predictions

Sactipeptide(s) for MOB18_RS16080

MOB18_RS16080

Leader:

MKKAVIVENK

Core:

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

antiSMASH-DB 4.0 matches for MOB18_RS16080

100.0%

NC_000964.3and 235 others:

NC_014479.1 Sactipeptides: BSUW23_RS18740_sactipeptideNC_014639.1 Sactipeptides: BATR1942_RS15950_sactipeptideNC_014976.1 Sactipeptides: BSN5_RS09700_sactipeptideNC_016047.1 Sactipeptides: GYO_RS41165_sactipeptideNC_017195.1 Sactipeptides: I33_RS18040_sactipeptideNC_017743.1 Sactipeptides: MY9_RS18920_sactipeptideNC_019896.1 Sactipeptides: A7A1_RS01935_sactipeptideNC_020244.1 Sactipeptides: C663_RS18295_sactipeptideNZ_BDDH01000003.1 Sactipeptides: A7P71_RS10610_sactipeptideNZ_CABIVP010000002.1 Sactipeptides: FY199_RS09010_sactipeptideNZ_CP007409.1 Sactipeptides: Q433_RS18950_sactipeptideNZ_CP009796.1 Sactipeptides: OB04_RS19085_sactipeptideNZ_CP011101.1 Sactipeptides: bslm_RS18365_sactipeptideNZ_CP011534.1 Sactipeptides: ABA10_RS18725_sactipeptideNZ_CP011802.1 Sactipeptides: D068_RS17505_sactipeptideNZ_CP016767.1 Sactipeptides: BCV50_RS14935_sactipeptideNZ_CP017072.1 Sactipeptides: BGM23_RS02945_sactipeptideNZ_CP017112.1 Sactipeptides: BS16045_RS19810_sactipeptideNZ_CP017313.1 Sactipeptides: BH660_RS14630_sactipeptideNZ_CP017314.1 Sactipeptides: BSBS38_RS19215_sactipeptideNZ_CP017676.1 Sactipeptides: BKN48_RS08085_sactipeptideNZ_CP018173.1 Sactipeptides: BAX60_RS03615_sactipeptideNZ_CP020367.1 Sactipeptides: BSK2_RS19060_sactipeptideNZ_CP020722.1 Sactipeptides: B7470_RS09560_sactipeptideNZ_CP020915.1 Sactipeptides: B9L64_RS11255_sactipeptideNZ_CP021169.1 Sactipeptides: B9N48_RS18685_sactipeptideNZ_CP021498.1 Sactipeptides: S101444_RS19170_sactipeptideNZ_CP021892.1 Sactipeptides: S100333_RS19720_sactipeptideNZ_CP021903.1 Sactipeptides: CD007_RS18975_sactipeptideNZ_CP021911.1 Sactipeptides: CDO84_RS18225_sactipeptideNZ_CP021921.1 Sactipeptides: S101392_RS19440_sactipeptideNZ_CP022391.1 Sactipeptides: CFK25_RS18875_sactipeptideNZ_CP022890.1 Sactipeptides: CJZ70_RS01210_sactipeptideNZ_CP023257.1 Sactipeptides: CLD04_RS19470_sactipeptideNZ_CP023409.1 Sactipeptides: Bateq7PJ16_RS20450_sactipeptideNZ_CP025941.1 Sactipeptides: C0W65_RS07300_sactipeptideNZ_CP026010.1 Sactipeptides: BS11774_RS03710_sactipeptideNZ_CP026030.1 Sactipeptides: C2H91_RS12110_sactipeptideNZ_CP026035.1 Sactipeptides: C2H96_RS13375_sactipeptideNZ_CP026036.1 Sactipeptides: C2H93_RS16885_sactipeptideNZ_CP026521.1 Sactipeptides: C1T29_RS22385_sactipeptideNZ_CP028201.1 Sactipeptides: C7M16_RS17535_sactipeptideNZ_CP028202.1 Sactipeptides: C7M17_RS17600_sactipeptideNZ_CP028217.1 Sactipeptides: C7M29_RS06900_sactipeptideNZ_CP028218.1 Sactipeptides: C7M30_RS12605_sactipeptideNZ_CP028812.1 Sactipeptides: DAE22_RS20770_sactipeptideNZ_CP029364.1 Sactipeptides: DIC78_RS12275_sactipeptideNZ_CP029461.1 Sactipeptides: DJ572_RS18795_sactipeptideNZ_CP029465.1 Sactipeptides: DKG76_RS19825_sactipeptideNZ_CP029609.1 Sactipeptides: DL538_RS20030_sactipeptideNZ_CP031675.1 Sactipeptides: DYS67_RS19275_sactipeptideNZ_CP031783.1 Sactipeptides: D0808_RS00710_sactipeptideNZ_CP031784.1 Sactipeptides: D0819_RS14700_sactipeptideNZ_CP032853.1 Sactipeptides: D9C10_RS17955_sactipeptideNZ_CP032855.1 Sactipeptides: D9C11_RS09165_sactipeptideNZ_CP035161.1 Sactipeptides: EQH88_RS19675_sactipeptideNZ_CP035167.1 Sactipeptides: EQJ08_RS19095_sactipeptideNZ_CP035226.1 Sactipeptides: EQW70_RS20085_sactipeptideNZ_CP035231.1 Sactipeptides: EQZ01_RS19685_sactipeptideNZ_CP035391.1 Sactipeptides: ES965_RS19370_sactipeptideNZ_CP035395.1 Sactipeptides: ES968_RS19740_sactipeptideNZ_CP035401.1 Sactipeptides: ETA19_RS19595_sactipeptideNZ_CP035402.1 Sactipeptides: ES969_RS19660_sactipeptideNZ_CP035403.1 Sactipeptides: ETA15_RS19805_sactipeptideNZ_CP035406.1 Sactipeptides: ETK61_RS20735_sactipeptideNZ_CP035413.1 Sactipeptides: ETL58_RS19505_sactipeptideNZ_CP039935.1 Sactipeptides: FCJ76_RS19255_sactipeptideNZ_CP045006.1 Sactipeptides: F9B13_RS01950_sactipeptideNZ_CP045425.1 Sactipeptides: GCU76_RS20710_sactipeptideNZ_CP045816.1 Sactipeptides: GII86_RS19920_sactipeptideNZ_CP045824.1 Sactipeptides: GII78_RS20125_sactipeptideNZ_CP046591.1 Sactipeptides: GO004_RS15965_sactipeptideNZ_CP046860.1 Sactipeptides: GPJ55_RS11605_sactipeptideNZ_CP047645.1 Sactipeptides: GSN02_RS19265_sactipeptideNZ_CP049924.1 Sactipeptides: G4G26_RS18960_sactipeptideNZ_CP050705.1 Sactipeptides: HCU65_RS18920_sactipeptideNZ_CP051462.1 Sactipeptides: HC662_RS19240_sactipeptideNZ_CP051464.1 Sactipeptides: HC660_RS18970_sactipeptideNZ_CP054050.1 Sactipeptides: HNV25_RS02005_sactipeptideNZ_CP054177.1 Sactipeptides: HR084_RS18935_sactipeptideNZ_CP054584.1 Sactipeptides: HT135_RS19775_sactipeptideNZ_CP060193.1 Sactipeptides: H7F27_RS02180_sactipeptideNZ_CP060417.1 Sactipeptides: H8S71_RS18495_sactipeptideNZ_CP061284.1 Sactipeptides: ICJ61_RS19715_sactipeptideNZ_CP061870.1 Sactipeptides: IE382_RS22305_sactipeptideNZ_CP062497.1 Sactipeptides: IHV08_RS19770_sactipeptideNZ_CP063276.1 Sactipeptides: IM743_RS18070_sactipeptideNZ_CP065858.1 Sactipeptides: I7X10_RS03370_sactipeptideNZ_CP069789.1 Sactipeptides: JR441_RS19085_sactipeptideNZ_CP070483.1 Sactipeptides: JQX68_RS19175_sactipeptideNZ_CP070976.1 Sactipeptides: JYG31_RS19675_sactipeptideNZ_CP071043.1 Sactipeptides: JS609_RS19245_sactipeptideNZ_CP073265.1 Sactipeptides: KCX77_RS18900_sactipeptideNZ_CP075344.1 Sactipeptides: KIL00_RS20100_sactipeptideNZ_CP076083.1 Sactipeptides: KFF76_RS18635_sactipeptideNZ_CP079759.1 Sactipeptides: KXZ66_RS19695_sactipeptideNZ_CP080508.1 Sactipeptides: K0V03_RS08595_sactipeptideNZ_CP089148.1 Sactipeptides: LRO88_RS20980_sactipeptideNZ_CP090125.1 Sactipeptides: LXE94_RS19505_sactipeptideNZ_CP093289.1 Sactipeptides: MNG38_RS19730_sactipeptideNZ_CP093546.1 Sactipeptides: MOW04_RS19180_sactipeptideNZ_CP095736.1 Sactipeptides: MX663_RS20090_sactipeptideNZ_CP096590.1 Sactipeptides: M0696_RS18995_sactipeptideNZ_CP096889.1 Sactipeptides: EFK13_RS19225_sactipeptideNZ_CP098738.1 Sactipeptides: NDR85_RS18965_sactipeptideNZ_CP100651.1 Sactipeptides: NLW79_RS19990_sactipeptideNZ_CP100752.1 Sactipeptides: NLV76_RS19060_sactipeptideNZ_CP101718.1 Sactipeptides: NPA28_RS19075_sactipeptideNZ_CP101936.1 Sactipeptides: NP434_RS18980_sactipeptideNZ_CP103352.1 Sactipeptides: NX823_RS19780_sactipeptideNZ_CP104878.1 Sactipeptides: N8A75_RS20105_sactipeptideNZ_CP107539.1 Sactipeptides: OEG95_RS19105_sactipeptideNZ_CP110264.1 Sactipeptides: OMK57_RS18975_sactipeptideNZ_CP114899.1 Sactipeptides: O6U12_RS19480_sactipeptideNZ_CP116773.1 Sactipeptides: PNF29_RS01990_sactipeptideNZ_FTMW01000001.1 Sactipeptides: BW968_RS02045_sactipeptideNZ_JAAUXF010000005.1 Sactipeptides: HC742_RS19325_sactipeptideNZ_JABRUZ010000003.1 Sactipeptides: HRF55_RS03085_sactipeptideNZ_JABRVH010000018.1 Sactipeptides: HRF53_RS09100_sactipeptideNZ_JABUKD010000002.1 Sactipeptides: HRW04_RS09345_sactipeptideNZ_JAEACL010000001.1 Sactipeptides: I5F14_RS00800_sactipeptideNZ_JAHVOC010000002.1 Sactipeptides: KXD37_RS07830_sactipeptideNZ_JAJFDG010000003.1 Sactipeptides: LJF29_RS11575_sactipeptideNZ_JAJHUI010000011.1 Sactipeptides: LK399_RS16325_sactipeptideNZ_JALAJC010000012.1 Sactipeptides: MOB18_RS16080_sactipeptideNZ_JALAKW010000005.1 Sactipeptides: MOB93_RS12665_sactipeptideNZ_JALAKZ010000001.1 Sactipeptides: MOB76_RS02240_sactipeptideNZ_JALALA010000011.1 Sactipeptides: MOB82_RS15020_sactipeptideNZ_JALALE010000020.1 Sactipeptides: MOB33_RS20855_sactipeptideNZ_JALALO010000006.1 Sactipeptides: MOB75_RS09230_sactipeptideNZ_JALAMD010000002.1 Sactipeptides: MOB22_RS02315_sactipeptideNZ_JALAME010000005.1 Sactipeptides: MOC02_RS13805_sactipeptideNZ_JALAMJ010000012.1 Sactipeptides: MOB80_RS16635_sactipeptideNZ_JALAMO010000007.1 Sactipeptides: MOB98_RS08535_sactipeptideNZ_JALAMR010000019.1 Sactipeptides: MOC09_RS17975_sactipeptideNZ_JALAMZ010000002.1 Sactipeptides: MOC43_RS01370_sactipeptideNZ_JALANN010000012.1 Sactipeptides: MOC49_RS18290_sactipeptideNZ_JALANX010000001.1 Sactipeptides: MOC25_RS03365_sactipeptideNZ_JALAPT010000001.1 Sactipeptides: MOC95_RS01580_sactipeptideNZ_JALAPV010000005.1 Sactipeptides: MOC91_RS13515_sactipeptideNZ_JALAPW010000003.1 Sactipeptides: MOD18_RS06235_sactipeptideNZ_JALAPX010000003.1 Sactipeptides: MOC97_RS06805_sactipeptideNZ_JALAPZ010000002.1 Sactipeptides: MOC81_RS03830_sactipeptideNZ_JALAQA010000008.1 Sactipeptides: MOD07_RS14955_sactipeptideNZ_JALAQC010000001.1 Sactipeptides: MOD00_RS01290_sactipeptideNZ_JALAQD010000002.1 Sactipeptides: MOD08_RS05770_sactipeptideNZ_JALAQE010000002.1 Sactipeptides: MOD19_RS04725_sactipeptideNZ_JALASB010000002.1 Sactipeptides: MOD42_RS03685_sactipeptideNZ_JALASC010000024.1 Sactipeptides: MOD69_RS20580_sactipeptideNZ_JALASM010000006.1 Sactipeptides: MOD51_RS10970_sactipeptideNZ_JALASR010000006.1 Sactipeptides: MOD87_RS10780_sactipeptideNZ_JALAST010000011.1 Sactipeptides: MOE17_RS14670_sactipeptideNZ_JALASW010000005.1 Sactipeptides: MOE15_RS06925_sactipeptideNZ_JALATC010000001.1 Sactipeptides: MOD56_RS03380_sactipeptideNZ_JALATD010000001.1 Sactipeptides: MOE02_RS03350_sactipeptideNZ_JALATE010000006.1 Sactipeptides: MOD98_RS11440_sactipeptideNZ_JALATF010000003.1 Sactipeptides: MOD44_RS09960_sactipeptideNZ_JALATG010000002.1 Sactipeptides: MOE16_RS03490_sactipeptideNZ_JALATJ010000007.1 Sactipeptides: MOD90_RS15770_sactipeptideNZ_JALATU010000001.1 Sactipeptides: MOE27_RS01985_sactipeptideNZ_JALATV010000005.1 Sactipeptides: MOD97_RS07020_sactipeptideNZ_JALAUA010000008.1 Sactipeptides: MOD32_RS16030_sactipeptideNZ_JALAUD010000001.1 Sactipeptides: MOE28_RS03345_sactipeptideNZ_JALAUJ010000006.1 Sactipeptides: MOE37_RS12685_sactipeptideNZ_JALAUK010000012.1 Sactipeptides: MOE38_RS11825_sactipeptideNZ_JALAUV010000003.1 Sactipeptides: MOE71_RS06545_sactipeptideNZ_JALAUW010000015.1 Sactipeptides: MOE83_RS13210_sactipeptideNZ_JALAVA010000002.1 Sactipeptides: MOE81_RS02625_sactipeptideNZ_JALAVE010000001.1 Sactipeptides: MOE67_RS03645_sactipeptideNZ_JALAVI010000011.1 Sactipeptides: MOE80_RS14660_sactipeptideNZ_JALAVK010000006.1 Sactipeptides: MOE96_RS10120_sactipeptideNZ_JALAVL010000002.1 Sactipeptides: MOE60_RS03290_sactipeptideNZ_JALAVM010000009.1 Sactipeptides: MOE49_RS16195_sactipeptideNZ_JALAVO010000008.1 Sactipeptides: MOE63_RS14665_sactipeptideNZ_JALAVQ010000003.1 Sactipeptides: MOE59_RS02420_sactipeptideNZ_JALAVS010000002.1 Sactipeptides: MOE46_RS02250_sactipeptideNZ_JALAVT010000005.1 Sactipeptides: MOF25_RS08325_sactipeptideNZ_JALAVU010000004.1 Sactipeptides: MOE78_RS09660_sactipeptideNZ_JALAVV010000004.1 Sactipeptides: MOE66_RS02855_sactipeptideNZ_JALAVW010000001.1 Sactipeptides: MOE86_RS01005_sactipeptideNZ_JALAVX010000009.1 Sactipeptides: MOE40_RS07525_sactipeptideNZ_JALAVZ010000002.1 Sactipeptides: MOF00_RS02525_sactipeptideNZ_JALAWB010000008.1 Sactipeptides: MOE87_RS15020_sactipeptideNZ_JALAWK010000002.1 Sactipeptides: MOF06_RS12140_sactipeptideNZ_JALAWW010000010.1 Sactipeptides: MOF23_RS17300_sactipeptideNZ_JALAXQ010000012.1 Sactipeptides: MOF24_RS14120_sactipeptideNZ_JALAXV010000001.1 Sactipeptides: MOF15_RS00375_sactipeptideNZ_JALAYA010000016.1 Sactipeptides: MOF34_RS08915_sactipeptideNZ_JALAYD010000019.1 Sactipeptides: MOF39_RS20725_sactipeptideNZ_JALNTO010000006.1 Sactipeptides: MTN95_RS11045_sactipeptideNZ_JAMDFN010000008.1 Sactipeptides: M3M31_RS18245_sactipeptideNZ_JAMYDW010000003.1 Sactipeptides: NHM07_RS10830_sactipeptideNZ_JANBMP010000002.1 Sactipeptides: NL430_RS07940_sactipeptideNZ_JANDGG010000001.1 Sactipeptides: NKU38_RS03365_sactipeptideNZ_JANFAP010000001.1 Sactipeptides: NEC81_RS02065_sactipeptideNZ_JAQFFE010000015.1 Sactipeptides: PG051_RS13540_sactipeptideNZ_JAQOXM010000001.1 Sactipeptides: PO770_RS01950_sactipeptideNZ_JH600279.1 Sactipeptides: GYU_RS0104160_sactipeptideNZ_JXHL01000020.1 Sactipeptides: B4069_RS07025_sactipeptideNZ_JXHP01000031.1 Sactipeptides: B4073_RS09425_sactipeptideNZ_JXHR01000010.1 Sactipeptides: B4146_RS06925_sactipeptideNZ_KZ848487.1 Sactipeptides: DSL71_RS14015_sactipeptideNZ_LPVE01000021.1 Sactipeptides: AU385_RS06600_sactipeptideNZ_LSBB01000001.1 Sactipeptides: AXI57_RS01770_sactipeptideNZ_LUUT01000004.1 Sactipeptides: A6751_RS18460_sactipeptideNZ_MOEO01000004.1 Sactipeptides: BLL41_RS09830_sactipeptideNZ_MUXL01000002.1 Sactipeptides: B0W20_RS08845_sactipeptideNZ_MZZI01000001.1 Sactipeptides: B2G85_RS18515_sactipeptideNZ_NBBO01000003.1 Sactipeptides: B6K89_RS01830_sactipeptideNZ_NERK01000024.1 Sactipeptides: B9T64_RS18540_sactipeptideNZ_NJRD01000003.1 Sactipeptides: CE053_RS09115_sactipeptideNZ_NJRE01000002.1 Sactipeptides: CE047_RS07205_sactipeptideNZ_NKAK01000003.1 Sactipeptides: CE489_RS10400_sactipeptideNZ_NMOM01000004.1 Sactipeptides: CFI07_RS07245_sactipeptideNZ_PHIE01000002.1 Sactipeptides: CVV77_RS10760_sactipeptideNZ_PJCT01000002.1 Sactipeptides: CW370_RS11825_sactipeptideNZ_PVQM01000002.1 Sactipeptides: C6W22_RS11490_sactipeptideNZ_PVQN01000002.1 Sactipeptides: C6W23_RS05885_sactipeptideNZ_PVRK01000001.1 Sactipeptides: C6350_RS02025_sactipeptideNZ_PVWC01000004.1 Sactipeptides: C6372_RS11675_sactipeptideNZ_QRFZ01000012.1 Sactipeptides: DXT72_RS19010_sactipeptideNZ_SDKE01000003.1 Sactipeptides: EUA35_RS12130_sactipeptideNZ_SHOB01000002.1 Sactipeptides: ES060_RS14270_sactipeptideNZ_SIRN01000006.1 Sactipeptides: EYH65_RS15720_sactipeptideNZ_SNWK01000001.1 Sactipeptides: DFO69_RS02055_sactipeptideNZ_SOBO01000012.1 Sactipeptides: DFO78_RS18210_sactipeptideNZ_SORJ01000001.1 Sactipeptides: BJ795_RS03350_sactipeptideNZ_VBRP01000025.1 Sactipeptides: FE220_RS07065_sactipeptideNZ_VFNF01000001.1 Sactipeptides: FB592_RS03405_sactipeptideNZ_VIOH01000001.1 Sactipeptides: FLN47_RS01935_sactipeptideNZ_VLJK01000012.1 Sactipeptides: L605_RS10195_sactipeptideNZ_VLJL01000006.1 Sactipeptides: L604_RS05585_sactipeptideNZ_VLJX01000001.1 Sactipeptides: L609_RS01950_sactipeptideNZ_VTEK01000003.1 Sactipeptides: FZC71_RS10310_sactipeptideNZ_WTKJ01000004.1 Sactipeptides: NWT17_RS06185_sactipeptide

Sactipeptides: BSU_37350_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

97.0%

NZ_CP092751.1:

Sactipeptides: MKF32_RS18515_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFEIAGATGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEIAGATGLFGLWG

33

93.9%

NZ_CP048852.1:

Sactipeptides: G4P54_RS19300_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFE+AGATGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEVAGATGLFGLWG

33

with 15 more sequence matches

Only the first 10 are displayed here.

90.9%

NZ_JALAKO010000018.1and 1 other:

NZ_JALAOG010000035.1 Sactipeptides: MOC96_RS18415_sactipeptide

Sactipeptides: MOB26_RS11095_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFEI G TGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEIGGVTGLFGLWG

33

87.9%

NZ_CP026362.1and 3 others:

NZ_CP033052.1 Sactipeptides: D9779_RS19215_sactipeptideNZ_JALAPG010000031.1 Sactipeptides: MOC70_RS13155_sactipeptideNZ_JALAQI010000016.1 Sactipeptides: MOD13_RS11485_sactipeptide

Sactipeptides: BV11031_RS20865_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDG IPDFEI G TGLFGLWG

1

GCATCSIGAVCLVDGFIPDFEIGGVTGLFGLWG

33

78.8%

NZ_NXEM01000021.1:

Sactipeptides: CPT06_RS05595_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GC TCSIGA CLV+GPIPDF+ G TGLFGLWG

1

GCTTCSIGAVCLVNGPIPDFKTGGVTGLFGLWG

33

72.7%

NC_014925.1and 17 others:

NZ_ANOI01000001.1 Sactipeptides: F779_RS13290_sactipeptideNZ_CP031604.1 Sactipeptides: DNJ55_RS07055_sactipeptideNZ_CP031605.1 Sactipeptides: DRC71_RS00165_sactipeptideNZ_CP035741.1 Sactipeptides: EW136_RS01865_sactipeptideNZ_CP039747.1 Sactipeptides: EFT29_RS00935_sactipeptideNZ_CP054206.2 Sactipeptides: HP560_RS11995_sactipeptideNZ_CP060700.1 Sactipeptides: H9Q12_RS10940_sactipeptideNZ_CP065920.1 Sactipeptides: JC281_RS11580_sactipeptideNZ_CP076465.1 Sactipeptides: KDE16_RS00560_sactipeptideNZ_JANPRJ010000013.1 Sactipeptides: NVR03_RS10250_sactipeptideNZ_JANPRN010000039.1 Sactipeptides: NVR04_RS07875_sactipeptideNZ_JTKO01000012.1 Sactipeptides: NO87_RS10650_sactipeptideNZ_LR134267.1 Sactipeptides: EL085_RS11430_sactipeptideNZ_MQMO01000006.1 Sactipeptides: BSR38_RS07375_sactipeptideNZ_MQNF01000024.1 Sactipeptides: BSR36_RS12515_sactipeptideNZ_QQPJ01000025.1 Sactipeptides: DV949_RS11300_sactipeptideNZ_SEZW01000001.1 Sactipeptides: EWV33_RS08610_sactipeptide

Sactipeptides: SPSINT_RS00615_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+TCSIGAACL+DGP+PDFE+ G TG+FGL

1

GCSTCSIGAACLIDGPLPDFEVMGITGIFGL

31

69.7%

NZ_CP027770.1:

Sactipeptides: C7J90_RS04260_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ CSIGAACL+DGP PDFE+ G TG FGL

1

GCSACSIGAACLIDGPFPDFEVMGITGTFGL

31

69.7%

NZ_CP066885.1:

Sactipeptides: JGZ27_RS11325_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+TCSIG ACL+DGP+PDFE+ G TG+FGL

1

GCSTCSIGVACLIDGPLPDFEVMGITGIFGL

31

69.7%

NZ_CP094808.1and 3 others:

NZ_CP094809.1 Sactipeptides: MUA95_RS01320_sactipeptideNZ_CP094813.1 Sactipeptides: MUA84_RS01300_sactipeptideNZ_VKCY01000004.1 Sactipeptides: FNK43_RS05155_sactipeptide

Sactipeptides: MUA11_RS01375_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C+IGAACL DGPIPDFE+AG TG FG+

1

GCSACAIGAACLADGPIPDFEVAGITGTFGI

31

66.7%

NZ_ATDF02000020.1and 1 other:

NZ_KV827785.1 Sactipeptides: HMPREF2580_RS10900_sactipeptide

Sactipeptides: M462_RS08950_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C++GAACL DGPIPDFE+AG TG FG+

1

GCSACAVGAACLADGPIPDFEVAGITGTFGM

31

63.6%

NC_022584.1and 2 others:

NZ_CP047883.1 Sactipeptides: M594_RS05585_sactipeptideNZ_KV802690.1 Sactipeptides: HMPREF2764_RS03300_sactipeptide

Sactipeptides: N596_RS03165_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GC+ C+IGA CL DGPIPDFEIAG + +F +G

1

GCSVCAIGAVCLADGPIPDFEIAGVSAVFTAFG

33

63.6%

NZ_CP063367.1and 1 other:

NZ_LR134263.1 Sactipeptides: EL101_RS12790_sactipeptide

Sactipeptides: IPU22_RS12430_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C++GA CL DGPIPDFE+AG TG FG+

1

GCSACAVGAVCLADGPIPDFEVAGITGTFGI

31

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.21 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.64 out of 27.78

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.07 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.53 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.88 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.81 out of 33.14

Confidence: weak

RREFinder

Sactipeptides

TFBS Finder

RRE predictions

: RRE type: Subtilosin_rSAM_RRE; Location: 5 - 98; Score: 99.1

Core peptide predictions

MOB18_RS16080: Putative sactipeptide; RODEO score: 33.0; Core sequence, approximate: GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism

NZ_JALAJC010000013.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 39,252 nt. (total: 39,252 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOB18_RS16275: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: peptidase

MOB18_RS16265: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Ligases: ligase

MOB18_RS16215: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOB18_RS16220: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOB18_RS16225: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001133.4	0.69	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001133.4	0.69	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.93 out of 29.25

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.34 out of 28.19

Confidence: medium

Additional weak hits (3):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.38 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.85 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.25 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 39252:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Glu - D-Orn) + (Tyr - D-Thr) + (Glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOB18_RS16215: Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (469..870): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDASVWQWHFFAGGEIHGYGPTEATVDAAF
Nearest Stachelhaus code(s):: Glu DAWHFGGVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOB18_RS16220: Tyr - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (474..865): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: TWRFFDGCVTSTIITFAGEANEYGPTENSVATTI
Nearest Stachelhaus code(s):: Tyr DGTITAEVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1903): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LHQHFDFSVWEGNQIFGGEINMYGITETTVHVTF
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOB18_RS16225: Glu - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (463..864): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDASVWQWHFFAGGEIHGYGPTEATVDAAF
Nearest Stachelhaus code(s):: Glu DAWHFGGVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1503..1908): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: AAWAFDVFSGDRESILGSDINSYGVTEATIDSSC
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
SypG	Regulator of biofilm formation and host colonization
ZuR variant 1	Zinc-responsive repressor

NZ_JALAJC010000013.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 137,068 - 158,966 nt. (total: 21,899 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOB18_RS16935: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000313.4	0.36	NRPS	beauvericin	Beauveria bassiana
BGC0002316.2	0.36	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001535.3	0.34	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002255.3	0.29	PKS	lijiquinone	Ascomycota sp. F53
BGC0001496.3	0.29	ribosomal	actinokineosin	Actinokineospora spheciospongiae
BGC0001920.4	0.29	ribosomal	siamycin I	Streptomyces sp.
BGC0001674.5	0.29	ribosomal	MS-271	Streptomyces mirabilis
BGC0002669.2	0.28	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0001736.3	0.27	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000663.5	0.27	terpene	hopene	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000313.4	0.36	NRPS	beauvericin	Beauveria bassiana
BGC0002316.2	0.36	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001535.3	0.34	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002255.3	0.29	PKS	lijiquinone	Ascomycota sp. F53
BGC0001496.3	0.29	ribosomal	actinokineosin	Actinokineospora spheciospongiae
BGC0001920.4	0.29	ribosomal	siamycin I	Streptomyces sp.
BGC0001674.5	0.29	ribosomal	MS-271	Streptomyces mirabilis
BGC0002669.2	0.28	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0001736.3	0.27	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000663.5	0.27	terpene	hopene	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

MOB18_RS16940: T2TS

Domain 1 (4 - 629): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 26.30 out of 27.78

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.78 out of 20.97

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.34 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.70 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.50 out of 27.78

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.10 out of 21.84

Confidence: medium

Additional weak hits (5):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.86 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.62 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.69 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.69 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_JALAJC010000013.1 - Region 3 - T3PKS

Download region GenBank file

Download region SVG

Location: 208,141 - 249,238 nt. (total: 41,098 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOB18_RS17465: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase methyltransferase

MOB18_RS17415: isoprenylcysteine carboxyl methyltransferase

smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

MOB18_RS17450: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Ligases: synthase

MOB18_RS17420: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001831.3	0.51	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000282.3	0.49	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001962.3	0.45	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001847.2	0.44	other (other)	1-carbapen-2-em-3-carboxylic acid	Pectobacterium carotovorum
BGC0001475.4	0.43	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002332.2	0.42	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000509.4	0.37	ribosomal	epilancin 15x	Staphylococcus epidermidis
BGC0001882.3	0.36	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001831.3	0.51	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000282.3	0.49	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001962.3	0.45	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001847.2	0.44	other (other)	1-carbapen-2-em-3-carboxylic acid	Pectobacterium carotovorum
BGC0001475.4	0.43	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002332.2	0.42	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000509.4	0.37	ribosomal	epilancin 15x	Staphylococcus epidermidis
BGC0001882.3	0.36	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.87 out of 29.72

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.65 out of 29.38

Confidence: medium

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 28.05 out of 32.74

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.84 out of 29.38

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.89 out of 23.79

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.73 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.14 out of 28.19

Confidence: medium

Additional weak hits (7):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.31 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.59 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.03 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.46 out of 32.74

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.18 out of 25.75

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.01 out of 24.78

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
FuR variant 1	Ferric Uptake Regulator
FuR variant 2	Ferric Uptake Regulator
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
ZuR variant 1	Zinc-responsive repressor

NZ_JALAJC010000014.1 - Region 1 - NRP-metallophore,NRPS,terpene-precursor

Download region GenBank file

Download region SVG

Location: 66,338 - 132,605 nt. (total: 66,268 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

MOB18_RS18525: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOB18_RS18600: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MOB18_RS18650: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

MOB18_RS18655: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

MOB18_RS18700: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Hydrolases: esterase hydrolase

MOB18_RS18435: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

MOB18_RS18485: isochorismatase

smcogs: SMCOG1027: isochorismatase

MOB18_RS18585: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

MOB18_RS18595: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthetase

MOB18_RS18455: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

MOB18_RS18580: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOB18_RS18590: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000309.5	1.41	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0001185.5	1.10	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000401.5	1.05	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002695.2	0.74	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000309.5	0.89	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0001185.5	0.81	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000401.5	0.80	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002695.2	0.70	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

MOB18_RS18455: PT_FPPS_like

Domain 1 (23 - 284): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.03 out of 26.06

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.85 out of 25.31

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.21 out of 26.06

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.61 out of 29.38

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.73 out of 28.19

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 25.31

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.92 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.42 out of 27.78

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.49 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.93 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.36 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.52 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.97 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.08 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.18 out of 28.19

Confidence: medium

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 26.46 out of 33.14

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.87 out of 18.16

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.96 out of 28.19

Confidence: medium

Additional weak hits (16):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.62 out of 21.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.98 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.45 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.61 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.12 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.69 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.84 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.85 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.81 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.19 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.15 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.01 out of 35.63

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.22 out of 30.11

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 66337 - 132605:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 80830 - 132605:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOB18_RS18580: Gly - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (463..861): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDISALELQALVGGETNLYGPTETTIWSAA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1519..1935): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQIFGGEINMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MOB18_RS18590: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SLSLYPLSSPGGALQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVVNK (97% 8Å match); diOH-Bz or Sal PLPAQGVVNK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor
ZuR variant 2	Zinc-responsive repressor

NZ_JALAJC010000016.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 62,426 nt. (total: 62,426 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MOB18_RS20365: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MOB18_RS20380: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: formyltransferase

MOB18_RS20475: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: esterase hydrolase phosphatase

MOB18_RS20375: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

MOB18_RS20385: thioesterase

smcogs: SMCOG1004: thioesterase

MOB18_RS20395: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase synthase

MOB18_RS20340: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MOB18_RS20345: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MOB18_RS20350: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MOB18_RS20355: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOB18_RS20360: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOB18_RS20400: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

MOB18_RS20455: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000426.5	0.70	NRPS	sevadicin	Paenibacillus larvae
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001133.4	0.67	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000426.5	0.68	NRPS	sevadicin	Paenibacillus larvae
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001133.4	0.67	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 25.34 out of 29.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.10 out of 26.06

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.78 out of 20.97

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.78 out of 24.78

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 25.31

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.45 out of 26.85

Confidence: medium

Additional weak hits (3):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.28 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.83 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.12 out of 27.55

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 62426:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (Asn - ohmal - Glu) + (ohmal) + (mxmal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOB18_RS20340: mal

PKS_AT (534..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 148.1
inactive: 114.4
Methoxymalonyl-CoA: 76.2
Methylmalonyl-CoA: 63.0
Propionyl-CoA: 44.4
Isobutyryl-CoA: 35.3
Ethylmalonyl-CoA: 21.0
CHC-CoA: 17.1
fatty_acid: 16.9
2-Methylbutyryl-CoA: 16.1
3-Methylbutyryl-CoA: 10.0
trans-1,2-CPDA: 9.6
Benzoyl-CoA: 9.1
Acetyl-CoA: 0.0

MOB18_RS20345: mxmal - mal

PKS_AT (531..797): mxmal

ATSignature: (unknown)

No matches above 50%

minowa: Methoxymalonyl-CoA

Prediction, score:

Methoxymalonyl-CoA: 18.3
Malonyl-CoA: 17.8
Methylmalonyl-CoA: 9.4
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (1508..1796): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 167.1
inactive: 98.4
Methoxymalonyl-CoA: 69.5
Methylmalonyl-CoA: 48.6
Propionyl-CoA: 33.8
Ethylmalonyl-CoA: 20.9
Benzoyl-CoA: 17.8
fatty_acid: 15.2
Isobutyryl-CoA: 11.9
Acetyl-CoA: 11.6
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOB18_RS20350: mal

PKS_AT (521..804): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 144.3
inactive: 98.9
Methoxymalonyl-CoA: 54.9
Methylmalonyl-CoA: 40.3
Propionyl-CoA: 32.6
Isobutyryl-CoA: 15.5
fatty_acid: 13.2
Benzoyl-CoA: 11.8
Acetyl-CoA: 10.1
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOB18_RS20355: Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (273..674): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: LGIAFDASVQTPDAMAGGETNNYGPTECTVQSAA
Nearest Stachelhaus code(s):: Ile DAQDLGVVDK (68% 8Å match); Gln or Glu DAQDLGVVDK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

MOB18_RS20360: Asn - mal

Search NORINE for peptide: strict or relaxed

AMP-binding (480..874): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATFDLTVTSTKLILGGEFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

PKS_AT (1595..1889): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 88.1
inactive: 61.8
Methoxymalonyl-CoA: 40.7
Methylmalonyl-CoA: 29.2
Propionyl-CoA: 27.5
Isobutyryl-CoA: 10.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MOB18_RS20400: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (464..859): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YSASFDLTVTSTKLIVGGEFNEYGPTEATVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
RutR	Regulator of the pyrimidine and purine metabolism
SypG	Regulator of biofilm formation and host colonization

NZ_JALAJC010000019.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,877 nt. (total: 10,877 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

MOB18_RS21205: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MOB18_RS21210: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001050.5	0.69	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001050.5	0.69	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 10877:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X) + (Pro - Glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOB18_RS21205: X

AMP-binding (178..571): X

nrpys: Ala, Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNSSFDVVTFEAWLIIGGEWNGYGPTENTTFSTC
Nearest Stachelhaus code(s):: Ala or Val DVFWIGGTFK (97% 8Å match); Val DVFWIGGTFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

MOB18_RS21210: Pro - Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (468..865): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LFEAFDVCYQESFLITAGEHNHYGPSETHVVSTY
Nearest Stachelhaus code(s):: Pro DVQFIAHVVK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1499..1898): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: FSLTFDASIWEWHFFSGGETNSYGPTEATVEAAF
Nearest Stachelhaus code(s):: Glu DAWHFGSVEK (100% 8Å match); Gln DAWHFGSVEK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_JALAJC010000024.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 9,531 nt. (total: 9,531 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

MOB18_RS21770: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOB18_RS21775: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOB18_RS21785: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOB18_RS21790: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 9531:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (Asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOB18_RS21775: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNGGFDAGTFEGWLIIGGDWNGYGPTENTTFSTS
Nearest Stachelhaus code(s):: Val DAFWIGGTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

MOB18_RS21785: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (427..830): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YWFSFDLGYTSPKLVLGGEINHYGPTETTIGAIA
Nearest Stachelhaus code(s):: Asp DLTKVGHIGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_JALAJC010000025.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,368 nt. (total: 10,368 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

MOB18_RS21825: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase

MOB18_RS21805: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

MOB18_RS21795: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MOB18_RS21800: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

Additional weak hits (1):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.54 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 10368:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MOB18_RS21800: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LHVSFDAFTFDAFALFGGEINCYGPTEGTVFATA
Nearest Stachelhaus code(s):: Leu DAFFLGCVFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_JALAJC010000030.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 1,275 nt. (total: 1,275 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

MOB18_RS22065: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.64	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.64	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains