GCF_026506375.1 - 4 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CP097721.1 (Escherichia coli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	azole-containing-RiPP	2,921,630	2,947,922
Region 1.2	NRP-metallophore,NRPS	3,250,770	3,305,923	High	enterobactin	NRPS:Type I
Region 1.3	terpene-precursor	3,446,267	3,467,166

NZ_CP097722.1 (Escherichia coli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	NI-siderophore,lassopeptide	83,323	133,249	High	aerobactin	other:other

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	azole-containing-RiPP	2,921,630	2,947,922
Region 1.2	NRP-metallophore,NRPS	3,250,770	3,305,923	High	enterobactin	NRPS:Type I
Region 1.3	terpene-precursor	3,446,267	3,467,166
Region 2.1	NI-siderophore,lassopeptide	83,323	133,249	High	aerobactin	other:other

No secondary metabolite regions were found in these records:: NZ_CP097723.1 (Escherichia coli)

Compact view

NZ_CP097721.1 - Region 1 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 2,921,630 - 2,947,922 nt. (total: 26,293 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer

M9O79_RS14330: flavodoxin

smcogs: SMCOG1134: flavodoxin

Translocases: permease

M9O79_RS14305: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001285.5	0.36	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0002197.2	0.34	NRPS, PKS	terrestric acid	Penicillium crustosum
BGC0000781.3	0.32	saccharide	O-antigen	Pseudomonas aeruginosa
BGC0001441.5	0.32	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0002439.3	0.31	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0001302.5	0.30	other (other)	lomofungin	Streptomyces lomondensis
BGC0000784.3	0.30	saccharide	O-antigen	Pseudomonas aeruginosa
BGC0000070.5	0.29	PKS	griseofulvin, epidechlorogriseofulvin	Penicillium aethiopicum
BGC0001127.5	0.29	NRPS	jagaricin	Janthinobacterium agaricidamnosum
BGC0002012.4	0.28	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001285.5	0.36	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0002197.2	0.34	NRPS, PKS	terrestric acid	Penicillium crustosum
BGC0000781.3	0.32	saccharide	O-antigen	Pseudomonas aeruginosa
BGC0001441.5	0.32	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0002439.3	0.31	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0001302.5	0.30	other (other)	lomofungin	Streptomyces lomondensis
BGC0000784.3	0.30	saccharide	O-antigen	Pseudomonas aeruginosa
BGC0000070.5	0.29	PKS	griseofulvin, epidechlorogriseofulvin	Penicillium aethiopicum
BGC0001127.5	0.29	NRPS	jagaricin	Janthinobacterium agaricidamnosum
BGC0002012.4	0.28	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.65 out of 28.19

Confidence: medium

Additional weak hits (3):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.12 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.81 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

TFBS Finder

Azole RiPPs

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
ZuR variant 1	Zinc-responsive repressor

Core peptide predictions

No core peptides found.

NZ_CP097721.1 - Region 2 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 3,250,770 - 3,305,923 nt. (total: 55,154 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

M9O79_RS15800: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

M9O79_RS15810: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

M9O79_RS15815: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

M9O79_RS15845: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

M9O79_RS15865: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

M9O79_RS15965: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

Transferases: PPTase aminotransferase

M9O79_RS15840: aminotransferase

smcogs: SMCOG1019: aminotransferase

M9O79_RS15935: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: esterase hydrolase

M9O79_RS15860: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

M9O79_RS15870: isochorismatase

smcogs: SMCOG1027: isochorismatase

M9O79_RS15925: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

Isomerases: isomerase

M9O79_RS15820: disulfide isomerase/thiol-disulfide oxidase

smcogs: SMCOG1233: disulfide isomerase/thiol-disulfide oxidase

M9O79_RS15880: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

M9O79_RS15875: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

M9O79_RS15915: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

M9O79_RS15950: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

Translocases: permease

M9O79_RS15975: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002476.2	1.67	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0002075.3	0.86	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.73	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002413.3	0.67	NRPS	frederiksenibactin	Yersinia frederiksenii ATCC 33641
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001185.5	0.65	NRPS	bacillibactin	Bacillus velezensis FZB42

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002476.2	0.94	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.69	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002413.3	0.67	NRPS	frederiksenibactin	Yersinia frederiksenii ATCC 33641
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001185.5	0.66	NRPS	bacillibactin	Bacillus velezensis FZB42

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.75 out of 27.55

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.61 out of 29.38

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 21.55

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.84 out of 29.38

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.40 out of 21.55

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.40 out of 30.25

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.70 out of 26.85

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.00 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.50 out of 28.19

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 30.17 out of 32.93

Confidence: strong

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.85 out of 32.93

Confidence: medium

Additional weak hits (26):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.36 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.20 out of 29.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 22.94 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.39 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.06 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.18 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.71 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.46 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.06 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.52 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.34 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.40 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.12 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.38 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.24 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.51 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.02 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.36 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.34 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.08 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.52 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.41 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.02 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.27 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.06 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 3250769 - 3305923:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

M9O79_RS15875: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (34..437): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SRSIYAMSSPGGALQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz AMPAQGVVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

M9O79_RS15915: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (461..863): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEHNLYGPTEAAVDVSW
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CRP	Cyclic AMP receptor protein
ColR	Phenol-responsive regulator
FuR variant 1	Ferric Uptake Regulator
GnfM	Regulator of nitrogen-fixation genes
LexA variant 3	Repressor of DNA damage response
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_CP097721.1 - Region 3 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 3,446,267 - 3,467,166 nt. (total: 20,900 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase synthase

M9O79_RS16675: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

M9O79_RS16700: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Hydrolases: synthase

M9O79_RS16700: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Ligases: synthase synthetase

M9O79_RS16665: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

M9O79_RS16670: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.50	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.50	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001594.3	0.38	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000929.3	0.38	other (other)	xanthothricin	Burkholderia glumae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.50	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.50	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001594.3	0.38	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000929.3	0.38	other (other)	xanthothricin	Burkholderia glumae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

M9O79_RS16665: PT_FPPS_like

Domain 1 (32 - 299): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: IPP, DMAPP → FPP

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.59 out of 18.57

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.49 out of 26.85

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.74 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.94 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.32 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.88 out of 30.98

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis

NZ_CP097722.1 - Region 1 - NI-siderophore,lassopeptide

Download region GenBank file

Download region SVG

Location: 83,323 - 133,249 nt. (total: 49,927 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC
lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

M9O79_RS23090: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Hydrolases: Hydrolysis

M9O79_RS23195: Hydrolysis

MITE: MITE0000056Hydrolysis (identity: 100.00%)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001499.5	0.61	other (other)	aerobactin	Pantoea ananatis
BGC0001498.5	0.40	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0000581.6	0.35	ribosomal	microcin J25	Escherichia coli AY25
BGC0002682.2	0.34	other (other)	aerobactin	Vibrio mimicus
BGC0002469.2	0.31	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001713.5	0.30	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0001572.3	0.29	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000939.5	0.29	other (other)	aerobactin	Grimontia hollisae
BGC0000295.5	0.22	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001478.5	0.22	other (other)	desferrioxamine E	Streptomyces sp. ID38640

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001499.5	0.84	other (other)	aerobactin	Pantoea ananatis
BGC0000581.6	0.77	ribosomal	microcin J25	Escherichia coli AY25
BGC0001498.5	0.72	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0002682.2	0.67	other (other)	aerobactin	Vibrio mimicus
BGC0002469.2	0.65	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001713.5	0.64	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0001572.3	0.63	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000939.5	0.62	other (other)	aerobactin	Grimontia hollisae
BGC0000295.5	0.55	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001478.5	0.55	other (other)	desferrioxamine E	Streptomyces sp. ID38640

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for M9O79_RS23190

M9O79_RS23190

Leader:

MIKHFHFNKLSSGKKNNVPSPAKGVIQIKKSASQLTK

Full core:

GGAGHVPEYFVGIGTPISFYG

Putative macrolactam:

GGAGHVPE

antiSMASH-DB 4.0 matches for M9O79_RS23190

100.0%

NZ_AP021947.1and 16 others:

NZ_CAJGEM010000015.1 Lassopeptides: JMT87_RS21655_lassopeptideNZ_CAJGGU010000008.1 Lassopeptides: JMU20_RS21490_lassopeptideNZ_CP010127.1 Lassopeptides: RG30_RS26380_lassopeptideNZ_CP031107.1 Lassopeptides: DUT84_RS26055_lassopeptideNZ_CP074577.1 Lassopeptides: KHZ70_RS24010_lassopeptideNZ_CP091672.1 Lassopeptides: L6L68_RS00080_lassopeptideNZ_CP097722.1 Lassopeptides: M9O79_RS23190_lassopeptideNZ_CP117571.1 Lassopeptides: PS035_RS23020_lassopeptideNZ_CP117612.1 Lassopeptides: PS038_RS23585_lassopeptideNZ_CP117622.1 Lassopeptides: PS039_RS24320_lassopeptideNZ_FZFT01000070.1 Lassopeptides: CPG75_RS26760_lassopeptideNZ_JABMLY010000084.1 Lassopeptides: HRQ70_RS23615_lassopeptideNZ_JZNY01000005.1 Lassopeptides: VE51_RS00690_lassopeptideNZ_JZOJ01000049.1 Lassopeptides: VE62_RS06215_lassopeptideNZ_MRDN01000066.1 Lassopeptides: BSF34_RS29250_lassopeptideNZ_OW968329.1 Lassopeptides: LQ108_RS23255_lassopeptide

Lassopeptides: H7R07_RS25795_lassopeptide

GGAGHVPEYFVGIGTPISFYG

52.4%

NZ_CP016898.1:

Lassopeptides: BEN76_RS17395_lassopeptide

GGAGHVPEYFVGIGTPISFYG

GG G +PEYF+ +G +FYG

GGKGPLPEYFL-MGGGGNFYG

33.3%

NZ_CP077406.1:

Lassopeptides: I6L51_RS27045_lassopeptide

GGAGHVPEYFVG

GG G + EYF+G

GGVGKIIEYFIG

with 5 more sequence matches

30.8%

NZ_VYKJ01000032.1:

Lassopeptides: FJU30_RS26370_lassopeptide

GGAGHVPEYFVGIGTPIS

GG G +PEYF P

GGDGGIPEYFEHSNPPTD

28.6%

NZ_JADPRT010000002.1:

Lassopeptides: I2501_RS04910_lassopeptide

GGAGHVPEYFVGIG

GG G VP++F +

GGLGTVPDWFFNMN

28.6%

NZ_JAERJD010000009.1:

Lassopeptides: allorf_022741_022872_lassopeptide

GGAGHVPEYFV

GG G + EYF

GGGGQIVEYFT

22.2%

NZ_RBZW01000021.1:

Lassopeptides: D8Y22_RS22300_lassopeptide

VPEYFVGIGTPIS

V E +GTPI+

VTEATAAVGTPIT

21.9%

NZ_CP031746.1:

Lanthipeptides: allorf_1813979_1814164_lanthipeptide

GGAGHVPEYFVGIGTPISF

G A VP +G G P+++

GCARWVPCSLLGAGCPVTW

MIBiG 4.0 matches for M9O79_RS23190

100.0%

BGC0000581.6 (AAD28494.1):

Lasso peptide: microcin J25

GGAGHVPEYFVGIGTPISFYG

33.3%

BGC0002322.3 (CEJ66604.1):

Lasso peptide: citrocin

GGAGHVPEYFVG

GG G + EYF+G

GGVGKIIEYFIG

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.22 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.91 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.50 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.44 out of 27.78

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.07 out of 29.38

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.67 out of 20.97

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.42 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.67 out of 27.78

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.43 out of 32.93

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.06 out of 28.19

Confidence: medium

Additional weak hits (24):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.89 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.10 out of 30.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.53 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 28.67 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 30.26 out of 39.62

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.65 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.49 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.56 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.61 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.34 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.52 out of 30.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.99 out of 28.14

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.02 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.93 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.12 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.84 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.64 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.76 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.63 out of 33.14

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.74 out of 27.04

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.27 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.55 out of 35.63

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.31 out of 20.47

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

M9O79_RS23190 - Class II: Cleavage pHMM score: 5.40; RODEO score: 21; Monoisotopic mass: 2106.0 Da; Molecular weight: 2107.3 Da; Number of bridges: 0

RRE predictions

: RRE type: Lasso_Fused_RRE; Location: 3 - 65; Score: 46.0

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
LexA variant 3	Repressor of DNA damage response
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor