GCF_025916195.1 - 17 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CP109848.1 (Paenibacillus polymyxa)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1	RRE-containing	485,599	507,053
Region 2	NRPS	750,256	813,994	High	fusaricidin B	NRPS:Type I+PKS
Region 3	phosphonate	999,609	1,031,728
Region 4	NRPS	1,653,527	1,732,024	High	macolacin	NRPS:Type I
Region 5	terpene-precursor	2,668,888	2,691,275
Region 6	PKS-like,T3PKS,transAT-PKS,NRPS	3,071,850	3,173,557	Low	aurantinin B/aurantinin C/aurantinin D	PKS
Region 7	terpene-precursor	3,339,907	3,360,830
Region 8	cyclic-lactone-autoinducer	3,690,747	3,711,295
Region 9	NRPS,T1PKS	3,898,768	3,995,068
Region 10	NRPS	4,229,343	4,323,109	High	tridecaptin	NRPS:Type I
Region 11	cyclic-lactone-autoinducer	4,659,425	4,680,068
Region 12	NRPS-like	4,686,193	4,729,888
Region 13	lanthipeptide-class-i	5,041,741	5,068,747	High	paenilan	ribosomal:RiPP
Region 14	lassopeptide	5,397,383	5,421,498	Low	paeninodin	ribosomal:unmodified
Region 15	NRPS,transAT-PKS	5,456,675	5,556,654
Region 16	proteusin	5,607,403	5,627,639
Region 17	NI-siderophore	5,785,941	5,821,333

NZ_CP109848.1 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 485,599 - 507,053 nt. (total: 21,455 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

OF859_RS02170: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Translocases: transporter

OF859_RS02220: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002306.2	0.48	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000504.5	0.44	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.5	0.42	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001638.4	0.41	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0002698.2	0.40	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002323.2	0.39	ribosomal	nisin J	Staphylococcus capitis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002306.2	0.48	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000504.5	0.44	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.5	0.42	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001638.4	0.41	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0002698.2	0.40	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002323.2	0.39	ribosomal	nisin J	Staphylococcus capitis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.42 out of 26.85

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.52 out of 28.19

Confidence: medium

Additional weak hits (4):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.36 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.18 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.49 out of 25.75

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 24.71 out of 35.63

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Other_Sactipeptide_rSAM_RRE; Location: 0 - 126; Score: 45.1

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_CP109848.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 750,256 - 813,994 nt. (total: 63,739 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase synthase

OF859_RS03380: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

OF859_RS03460: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

OF859_RS03465: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

OF859_RS03475: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase

OF859_RS03385: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase synthase

OF859_RS03380: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

OF859_RS03440: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Isomerases: isomerase

OF859_RS03535: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

OF859_RS03370: Pseudouridine synthase

smcogs: SMCOG1154: Pseudouridine synthase

OF859_RS03445: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

OF859_RS03455: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

OF859_RS03470: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

OF859_RS03530: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

OF859_RS03540: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001152.5	0.93	NRPS, PKS	fusaricidin B	Paenibacillus polymyxa
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001152.5	0.93	NRPS, PKS	fusaricidin B	Paenibacillus polymyxa
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.16 out of 26.06

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.05 out of 26.06

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.67 out of 21.55

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.71 out of 27.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.97 out of 24.78

Confidence: medium

Additional weak hits (9):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.59 out of 36.54

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.79 out of 32.93

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.64 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.62 out of 30.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.28 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.76 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.45 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.15 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.46 out of 36.54

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 750255 - 813994:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - D-Val - X - D-Thr - D-Asn - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

OF859_RS03445: Thr - Val - X - Thr - Asn - X

Search NORINE for peptide: strict or relaxed

AMP-binding (465..864): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNDHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1898): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LETGFDASTFEGWLLVGGDINCYGPTENTTFSTT
Nearest Stachelhaus code(s):: Val DAFWLGCTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3019..3409): X

nrpys: Ile, Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LVYAFDASVSETTLLTAGSSNGYGPTEDSVCTTI
Nearest Stachelhaus code(s):: Ile or Tyr DASTLAGVCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4050..4449): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNDHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5566..5961): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTMTSTKLIVGGEYNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (7081..7481): X

nrpys: Ala, D-Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TQLTFDFSVPECNLFACGEENIYGPTEAAVYATR
Nearest Stachelhaus code(s):: Ala or D-Ala DFPNFCIVYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

OF859_RS03470: X

AMP-binding (12..386): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NHSVHFYGISLSDACVGGSLNGYGLSELGNVTLG
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_CP109848.1 - Region 3 - phosphonate

Download region GenBank file

Download region SVG

Location: 999,609 - 1,031,728 nt. (total: 32,120 nt) Show pHMM detection rules used

phosphonate: (phosphonates and minimum(1, [2-Hacid_dh_C, Aldedh, Aminotran_1_2, Aminotran_5, AurF, CTP_transf_like, DUF4992, Fe-ADH, HMGL-like, Metallophos_2, NTP_transf_3, NTP_transf_5, PALP, PEP_mutase, TPP_enzyme_C, TPP_enzyme_N, phosphonates]) and not (phosphonatesHydrolase or phosphonatesMeIsocitrateLyase))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

OF859_RS04495: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

OF859_RS04545: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

OF859_RS04570: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

OF859_RS04605: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase

OF859_RS04470: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

OF859_RS04575: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002036.4	0.52	other (other)	dehydrofosmidomycin	Streptomyces lavendulae
BGC0001928.2	0.49	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000897.5	0.49	other (other)	dehydrophos	Streptomyces luridus
BGC0000888.5	0.48	other (other)	bacilysin	Bacillus sp. CS93
BGC0001184.4	0.48	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001859.4	0.48	other (phosphonate)	fosfomycin	Pseudomonas syringae
BGC0001739.3	0.48	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0000904.5	0.46	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0000926.5	0.46	other (other)	rhizocticin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0002670.2	0.45	other (other)	fosfonochlorin	Fusarium oxysporum f. sp. lycopersici 4287

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002036.4	0.52	other (other)	dehydrofosmidomycin	Streptomyces lavendulae
BGC0001928.2	0.49	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000897.5	0.49	other (other)	dehydrophos	Streptomyces luridus
BGC0000888.5	0.48	other (other)	bacilysin	Bacillus sp. CS93
BGC0001184.4	0.48	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001859.4	0.48	other (phosphonate)	fosfomycin	Pseudomonas syringae
BGC0001739.3	0.48	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0000904.5	0.46	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0000926.5	0.46	other (other)	rhizocticin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0002670.2	0.45	other (other)	fosfonochlorin	Fusarium oxysporum f. sp. lycopersici 4287

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.01 out of 30.25

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.31 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.37 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.00 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.36 out of 27.78

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.60 out of 26.06

Confidence: medium

Additional weak hits (5):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.71 out of 30.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.99 out of 33.14

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.88 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
MogR	Repressor of flagellar motility genes

NZ_CP109848.1 - Region 4 - NRPS

Download region GenBank file

Download region SVG

Location: 1,653,527 - 1,732,024 nt. (total: 78,498 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase

OF859_RS07580: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Ligases: ligase

OF859_RS07490: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

OF859_RS07495: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

OF859_RS07500: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

OF859_RS07505: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

OF859_RS07520: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001153.5	0.84	NRPS	polymyxin B	Paenibacillus polymyxa
BGC0000408.5	0.84	NRPS	polymyxin	Paenibacillus polymyxa
BGC0001192.5	0.83	NRPS	colistin A, colistin B	Paenibacillus alvei
BGC0002653.2	0.81	NRPS	macolacin	Paenibacillus xylanexedens
BGC0002135.2	0.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001153.5	0.84	NRPS	polymyxin B	Paenibacillus polymyxa
BGC0000408.5	0.84	NRPS	polymyxin	Paenibacillus polymyxa
BGC0001192.5	0.83	NRPS	colistin A, colistin B	Paenibacillus alvei
BGC0002653.2	0.81	NRPS	macolacin	Paenibacillus xylanexedens
BGC0002135.2	0.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.22 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 24.10 out of 29.72

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.03 out of 26.06

Confidence: medium

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 25.37 out of 28.14

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 20.33 out of 20.97

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.32 out of 26.06

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.93 out of 23.79

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.35 out of 27.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.73 out of 24.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.52 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.93 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.33 out of 18.16

Confidence: strong

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.28 out of 20.01

Confidence: medium

Additional weak hits (19):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.37 out of 31.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 26.61 out of 36.54

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.93 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.18 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.74 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.87 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.84 out of 30.25

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.36 out of 29.51

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.40 out of 20.47

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.20 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.93 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.34 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.16 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.47 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.86 out of 31.73

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 22.85 out of 30.12

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.50 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.27 out of 26.06

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.82 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 1653526 - 1732024:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Leu) + (Dab - Dab) + (Dab - Thr - D-Dab - Dab - Dab)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

OF859_RS07490: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (262..652): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LMFAFDASCWEKILVTGGSFNAYGPTEASIVTTL
Nearest Stachelhaus code(s):: Leu DAWIVGAIVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

OF859_RS07495: Dab - Dab

Search NORINE for peptide: strict or relaxed

AMP-binding (514..953): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINAYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISAIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1598..2015): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINAYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISAIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

OF859_RS07520: Dab - Thr - Dab - Dab - Dab

Search NORINE for peptide: strict or relaxed

AMP-binding (466..878): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TAYAFDVFVGDRESITSSDINSYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1520..1927): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNDHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2585..3036): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINSYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4155..4567): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINAYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISAIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5210..5649): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINAYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISAIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
ArgR	Regulator of arginine biosynthesis genes
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
NtrC	Nitrogen regulatory protein C
PerR	Peroxide regulator
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_CP109848.1 - Region 5 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 2,668,888 - 2,691,275 nt. (total: 22,388 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

OF859_RS11970: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	terpene-precursor	Similarity score	Type	Compound(s)	Organism
BGC0001910.4		0.29	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002007.2		0.24	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0001910.4		0.29	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002007.2		0.24	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

OF859_RS11970: PT_FPPS_like

Domain 1 (536 - 761): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 25.53 out of 30.25

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.61 out of 24.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.06 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.31 out of 28.19

Confidence: medium

Additional weak hits (4):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.40 out of 29.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 28.02 out of 39.62

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.71 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 25.20 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ColR	Phenol-responsive regulator
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_CP109848.1 - Region 6 - NRPS,PKS-like,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 3,071,850 - 3,173,557 nt. (total: 101,708 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

OF859_RS14110: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

OF859_RS14120: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

OF859_RS14125: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acylase kinase transketolase

OF859_RS14075: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

OF859_RS14130: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

OF859_RS14135: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

OF859_RS14170: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

OF859_RS14180: transketolase

smcogs: SMCOG1204: transketolase

Hydrolases: hydrolase

OF859_RS14065: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

OF859_RS14145: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: hydratase

OF859_RS14095: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

OF859_RS14100: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

OF859_RS14115: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

OF859_RS14085: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

OF859_RS14090: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

OF859_RS14105: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

OF859_RS14175: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.45	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	1.36	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	1.33	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	1.32	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	1.32	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.31	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.28	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	1.27	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	1.25	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000205.3	1.11	PKS	bryostatin	Candidatus Endobugula sertula

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.67	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000205.3	0.65	PKS	bryostatin	Candidatus Endobugula sertula
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.28 out of 26.06

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.30 out of 27.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.63 out of 18.46

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.76 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.33 out of 39.62

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.06 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.88 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 3071849 - 3173557:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - Gly - ohmal - Me-mal) + (ohmal - mal - ccmal - ccmal - mal) + (ccmal - Me-ccmal - ohmal) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 3071849 - 3113088:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - Gly - ohmal - Me-mal) + (ohmal - mal - ccmal - ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 3073103 - 3114366:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - Gly - ohmal - Me-mal) + (ohmal - mal - ccmal - ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 3076140 - 3173557:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - Gly - ohmal - Me-mal) + (ohmal - mal - ccmal - ccmal - mal) + (ccmal - Me-ccmal - ohmal) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

OF859_RS14105: Acetyl-CoA - Gly

Search NORINE for peptide: strict or relaxed

CAL_domain (66..485): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 111.6
NH2: 12.3
fatty_acid: 10.4
shikimic_acid: 0.0
AHBA: 0.0

AMP-binding (1163..1560): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDIAGLELQALCGGEWNMFGPTETTIWSTI
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

OF859_RS14130: mal

PKS_AT (0..289): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

minowa: inactive

Prediction, score:

inactive: 33.6
Malonyl-CoA: 29.8
Methoxymalonyl-CoA: 21.8
Methylmalonyl-CoA: 16.5
Isobutyryl-CoA: 14.7
Propionyl-CoA: 10.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

OF859_RS14135: mal

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 90.8
inactive: 32.5
Methoxymalonyl-CoA: 29.4
Methylmalonyl-CoA: 17.0
Propionyl-CoA: 13.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP109848.1 - Region 7 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 3,339,907 - 3,360,830 nt. (total: 20,924 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase methyltransferase

OF859_RS14980: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

OF859_RS15060: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthase synthetase

OF859_RS15020: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

OF859_RS15025: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000665.5	0.39	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001594.3	0.38	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000663.5	0.38	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000665.5	0.39	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001594.3	0.38	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000663.5	0.38	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

OF859_RS15020: PT_FPPS_like

Domain 1 (41 - 307): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: IPP, DMAPP → FPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.13 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.78 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.40 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.51 out of 36.54

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.89 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_CP109848.1 - Region 8 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 3,690,747 - 3,711,295 nt. (total: 20,549 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

OF859_RS16735: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Hydrolases: deacetylase

OF859_RS16730: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000488.4	0.43	ribosomal	circularin A	Clostridium beijerinckii
BGC0000504.5	0.41	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0002487.3	0.41	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0002447.3	0.40	ribosomal	cerecyclin	Bacillus cereus
BGC0001407.5	0.39	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000916.5	0.39	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0002488.3	0.39	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002656.2	0.39	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002698.2	0.38	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000488.4	0.43	ribosomal	circularin A	Clostridium beijerinckii
BGC0000504.5	0.41	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0002487.3	0.41	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0002447.3	0.40	ribosomal	cerecyclin	Bacillus cereus
BGC0001407.5	0.39	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000916.5	0.39	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0002488.3	0.39	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002656.2	0.39	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002698.2	0.38	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.74 out of 29.72

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 19.49 out of 20.01

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.67 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.68 out of 28.19

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

Additional weak hits (3):

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.99 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.74 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.86 out of 25.88

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
ArgR	Regulator of arginine biosynthesis genes
MogR	Repressor of flagellar motility genes
NtrC	Nitrogen regulatory protein C
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_CP109848.1 - Region 9 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 3,898,768 - 3,995,068 nt. (total: 96,301 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

OF859_RS17805: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

Transferases: aminotransferase kinase phosphotransferase

OF859_RS17745: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

OF859_RS17895: Glucose-specific phosphotransferase enzyme IIA

smcogs: SMCOG1145: Glucose-specific phosphotransferase enzyme IIA

OF859_RS17930: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: esterase hydrolase

OF859_RS17720: isochorismatase

smcogs: SMCOG1027: isochorismatase

OF859_RS17845: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

OF859_RS17750: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

OF859_RS17755: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

OF859_RS17850: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

OF859_RS17855: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

OF859_RS17860: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

OF859_RS17910: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.20	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.14	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	1.10	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	1.10	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	1.09	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	1.08	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	1.08	NRPS	enniatin	Fusarium equiseti
BGC0001166.5	1.07	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	1.07	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.05	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.69	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.26 out of 26.06

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.86 out of 27.55

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.12 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.12 out of 23.79

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 25.31

Confidence: medium

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 29.84 out of 36.54

Confidence: medium

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 30.94 out of 36.54

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.86 out of 21.84

Confidence: medium

Additional weak hits (7):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.32 out of 30.22

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.98 out of 29.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 25.08 out of 30.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 28.36 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.90 out of 36.54

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 24.35 out of 33.73

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 3898767 - 3995068:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Orn) + (D-Ala) + (Phe - Gln - Glu) + (Thr) + (pk - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 13, location 3898767 - >3952228:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - X) + (Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 14, location 3934203 - 3995068:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Orn) + (D-Ala) + (Phe - Gln - Glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

OF859_RS17750: pk - X

PKS_AT (536..823): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 62.5%; Isobutyryl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 123.0
Methoxymalonyl-CoA: 113.8
Malonyl-CoA: 106.8
Isobutyryl-CoA: 96.1
trans-1,2-CPDA: 87.9
Ethylmalonyl-CoA: 83.1
Propionyl-CoA: 70.3
2-Methylbutyryl-CoA: 65.4
CHC-CoA: 53.6
3-Methylbutyryl-CoA: 46.6
Benzoyl-CoA: 46.0
Acetyl-CoA: 45.3
inactive: 37.5
fatty_acid: 19.1

AMP-binding (2281..2686): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAESFDVSVWQAEVLITGEVNAYGPAEAADDITL
Nearest Stachelhaus code(s):: Dab DIWELTADDK (74% 8Å match); Ser DVWEMTADDK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

OF859_RS17755: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (501..900): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNSHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

OF859_RS17850: Phe - Gln - Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (471..861): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LFFAFDAAVWEMTLIAAGSINAYGPTETTVCATV
Nearest Stachelhaus code(s):: Phe DAWTIAAVCK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1907): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDASVQQADGIIGGDTNVYGPTECCVDSTE
Nearest Stachelhaus code(s):: Gln DAQDLGVVDK (82% 8Å match); Glu DAKDIGVVDK (82% 8Å match); Ile DAQDLGVVDK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2549..2951): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLSFDASVKQADGIIGGETNVYGPTECCVDSTY
Nearest Stachelhaus code(s):: Glu DAKDIGVVDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

OF859_RS17855: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (800..1200): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IALTFDVSVAEGNFFAAGEENIYGPTESTIYAAG
Nearest Stachelhaus code(s):: Ala DVANFAIIYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

OF859_RS17860: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (590..992): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: IAWAFDVFVGDRESILGSDVNSYGVTESTIDSSY
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
GnfM	Regulator of nitrogen-fixation genes
HgtR	Hydrogen-dependent regulator
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes

NZ_CP109848.1 - Region 10 - NRPS

Download region GenBank file

Download region SVG

Location: 4,229,343 - 4,323,109 nt. (total: 93,767 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase aminotransferase glycosyltransferase

OF859_RS19045: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

OF859_RS19095: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

OF859_RS19210: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Hydrolases: esterase hydrolase

OF859_RS19120: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

OF859_RS19145: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

OF859_RS19125: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

OF859_RS19130: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000449.5	0.86	NRPS	tridecaptin	Paenibacillus terrae
BGC0001843.2	0.85	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000449.5	0.86	NRPS	tridecaptin	Paenibacillus terrae
BGC0001843.2	0.85	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.36 out of 27.55

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.12 out of 26.06

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.02 out of 21.84

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.55 out of 21.55

Confidence: strong

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 21.55

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.06 out of 27.78

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.10 out of 21.84

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.29 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.03 out of 28.19

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.02 out of 20.01

Confidence: medium

Additional weak hits (10):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.01 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.46 out of 21.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.59 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.18 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.14 out of 28.14

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.53 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.11 out of 28.14

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.82 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 15, location 4229342 - 4323109:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Val - D-Dab - D-Gly - D-Ser - D-Trp - Ser - Dab - D-Dab - Trp - Glu - Val) + (D-Ile - Ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

OF859_RS19125: Val - Ile - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (270..727): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTGFDASTFEGWLLVGGDINGYGPTENTTFSTT
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1374..1781): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LNKGFDASTFEGFMLVGGDANIYGPTENTTFSTI
Nearest Stachelhaus code(s):: Ile DAFFLGITFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2916..3309): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTCFDVSTFEGWLLVGGDINGYGPTENTTFSTT
Nearest Stachelhaus code(s):: Ala DVFWLGGTFK (100% 8Å match); Val DVFWLGGTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

OF859_RS19130: Val - Dab - Gly - Ser - Trp - Ser - Dab - Dab - Trp - Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (464..898): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTGFDASTFEGWLLVGGDINGYGPTENTTFSTT
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2028..2487): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TAYAFDVFVGDRESITSSDMNSYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3620..4017): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDIFVLELQMMVGGEYNMYGPTETTVWSAV
Nearest Stachelhaus code(s):: Gly DILQMGMVWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5168..5581): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFASGEINLYGPTEATVDVSY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (6703..7098): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LYFAFDAACWEQALFTAGSYNGYGPTENSVATSI
Nearest Stachelhaus code(s):: Trp DAWAFAGVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (8242..8660): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFASGEINLYGPTEATVDVSY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (9336..9792): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TAYAFDVFVGDRESITSSDMNSYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (10439..10898): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TAYAFDVFVGDRESITSSDMNSYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (12016..12411): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LYFAFDAACWEQALFTAGSYNGYGPTENSVATSI
Nearest Stachelhaus code(s):: Trp DAWAFAGVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (13073..13498): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LALSFDASVKQADGLIGGETNVYGPTETTVDATA
Nearest Stachelhaus code(s):: Glu DAKDLGVVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
ArgR	Regulator of arginine biosynthesis genes
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_CP109848.1 - Region 11 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 4,659,425 - 4,680,068 nt. (total: 20,644 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

OF859_RS20855: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Ligases: synthase

OF859_RS20790: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Translocases: permease

OF859_RS20860: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000779.3	0.42	saccharide	lipopolysaccharide	Aeromonas piscicola
BGC0002554.2	0.40	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0001810.3	0.40	PKS	trehangelin	Polymorphospora rubra
BGC0001440.5	0.39	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0000922.5	0.39	PKS	2-heptyl-3-hydroxy-4-quinolone, 2,4-Quinolinediol, 2-heptylquinolin-4(1H)-one	Pseudomonas aeruginosa PAO1
BGC0001080.5	0.39	other (phenazine)	endophenazine A, endophenazine B	Streptomyces anulatus
BGC0000286.3	0.38	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0002711.2	0.38	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000204.5	0.38	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0001903.3	0.38	other (other)	neocarazostatin A	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000779.3	0.42	saccharide	lipopolysaccharide	Aeromonas piscicola
BGC0002554.2	0.40	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0001810.3	0.40	PKS	trehangelin	Polymorphospora rubra
BGC0001440.5	0.39	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0000922.5	0.39	PKS	2-heptyl-3-hydroxy-4-quinolone, 2,4-Quinolinediol, 2-heptylquinolin-4(1H)-one	Pseudomonas aeruginosa PAO1
BGC0001080.5	0.39	other (phenazine)	endophenazine A, endophenazine B	Streptomyces anulatus
BGC0000286.3	0.38	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0002711.2	0.38	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000204.5	0.38	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0001903.3	0.38	other (other)	neocarazostatin A	Streptomyces sp. MA37

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.75 out of 18.57

Confidence: strong

Additional weak hits (7):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.59 out of 36.54

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.90 out of 29.25

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 23.43

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.40 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.57 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.49 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_CP109848.1 - Region 12 - NRPS-like

Download region GenBank file

Download region SVG

Location: 4,686,193 - 4,729,888 nt. (total: 43,696 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

OF859_RS20930: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

OF859_RS21060: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase

OF859_RS21015: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

OF859_RS21090: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 24.68 out of 28.14

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.39 out of 27.78

Confidence: medium

Additional weak hits (6):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.54 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.18 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.13 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 17, location 4686192 - 4729888:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

OF859_RS21015: X

AMP-binding (224..633): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LVVAFDASVWDGTLTVAGEVNVYGPTECTVATTT
Nearest Stachelhaus code(s):: bMe-Phe DAWTTAVAAK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
PerR	Peroxide regulator
ToxT	Regulator of MSHA biosynthesis

NZ_CP109848.1 - Region 13 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 5,041,741 - 5,068,747 nt. (total: 27,007 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase

OF859_RS22590: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Lyases: cyclase dehydratase

OF859_RS22635: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

OF859_RS22645: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

OF859_RS22655: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001727.3	0.93	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.57	ribosomal	penisin	Paenibacillus ehimensis
BGC0000556.5	0.54	ribosomal	streptin	Streptococcus pyogenes
BGC0002635.2	0.54	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000541.5	0.53	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.53	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000506.4	0.52	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000560.5	0.52	ribosomal	subtilomycin	Bacillus subtilis
BGC0000540.5	0.51	ribosomal	paenibacillin	Paenibacillus polymyxa OSY-DF

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001727.3	0.93	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.57	ribosomal	penisin	Paenibacillus ehimensis
BGC0000556.5	0.54	ribosomal	streptin	Streptococcus pyogenes
BGC0002635.2	0.54	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000541.5	0.53	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.53	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000506.4	0.52	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000560.5	0.52	ribosomal	subtilomycin	Bacillus subtilis
BGC0000540.5	0.51	ribosomal	paenibacillin	Paenibacillus polymyxa OSY-DF

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for OF859_RS22635

OF859_RS22650

Leader:

MKNQFDLDLQVAKNEVAPKGVQPA

Core:

SGLICTPSCATGTLNCQVSLTFCKTC

Core with dehydrations:

DhaGLICysDhbPDhaCysADhbGDhbLNCysQVDhaLDhbFCysKDhbCys

antiSMASH-DB 4.0 matches for OF859_RS22650

100.0%

NZ_CP061172.1and 5 others:

NZ_CP109848.1 Lanthipeptides: OF859_RS22650_lanthipeptideNZ_CP113973.1 Lanthipeptides: OYT09_RS07785_lanthipeptideNZ_JAAMNR010000001.1 Lanthipeptides: G9G54_RS03500_lanthipeptideNZ_PNXQ01000013.1 Lanthipeptides: C1I60_RS14430_lanthipeptideNZ_POVS01000009.1 Lanthipeptides: C1T21_RS10630_lanthipeptide

Lanthipeptides: IAQ67_RS07480_lanthipeptide

1

SGLICTPSCATGTLNCQVSLTFCKTC

26

SGLICTPSCATGTLNCQVSLTFCKTC

1

SGLICTPSCATGTLNCQVSLTFCKTC

26

96.2%

NC_014483.2and 17 others:

NC_014622.2 Lanthipeptides: PPSC2_RS36205_lanthipeptideNC_017542.1 Lanthipeptides: PPM_RS07465_lanthipeptideNZ_CP006872.1 Lanthipeptides: PPSQR21_RS07740_lanthipeptideNZ_CP023711.1 Lanthipeptides: CPY53_RS22235_lanthipeptideNZ_CP025957.1 Lanthipeptides: C1A50_RS07530_lanthipeptideNZ_CP029370.1 Lanthipeptides: DI243_RS07495_lanthipeptideNZ_CP040829.1 Lanthipeptides: FGY93_RS00500_lanthipeptideNZ_CP049598.1 Lanthipeptides: G7L40_RS00115_lanthipeptideNZ_CP073682.1 Lanthipeptides: KAI36_RS07745_lanthipeptideNZ_CP084033.1 Lanthipeptides: LAZ93_RS07550_lanthipeptideNZ_CP085682.1 Lanthipeptides: LJR53_RS07370_lanthipeptideNZ_CP086373.1 Lanthipeptides: LMH85_RS07780_lanthipeptideNZ_CP092779.1 Lanthipeptides: MJ749_RS07440_lanthipeptideNZ_CP097766.1 Lanthipeptides: MF620_RS07485_lanthipeptideNZ_CP102865.1 Lanthipeptides: NWS42_RS21195_lanthipeptideNZ_JWJJ01000002.1 Lanthipeptides: U707_RS10390_lanthipeptideNZ_POVT01000009.1 Lanthipeptides: C1T20_RS05900_lanthipeptide

Lanthipeptides: PPE_RS07020_lanthipeptide

1

SGLICTPSCATGTLNCQVSLTFCKTC

26

SGLICTPSCATGTLNCQVSL+FCKTC

1

SGLICTPSCATGTLNCQVSLSFCKTC

26

96.2%

NC_023037.2and 5 others:

NZ_CP017967.2 Lanthipeptides: PPYC1_RS07755_lanthipeptideNZ_CP017968.3 Lanthipeptides: PPYC2_RS08330_lanthipeptideNZ_CP073683.1 Lanthipeptides: KAI37_RS07495_lanthipeptideNZ_FOYG01000001.1 Lanthipeptides: BM358_RS03525_lanthipeptideNZ_PTJM01000020.1 Lanthipeptides: C5G87_RS02825_lanthipeptide

Lanthipeptides: X809_RS07820_lanthipeptide

1

SGLICTPSCATGTLNCQVSLTFCKTC

26

SG+ICTPSCATGTLNCQVSLTFCKTC

1

SGIICTPSCATGTLNCQVSLTFCKTC

26

with 58 more sequence matches

Only the first 10 are displayed here.

92.3%

NZ_JAKVDC010000001.1:

Lanthipeptides: MKN04_RS02755_lanthipeptide

1

SGLICTPSCATGTLNCQVSLTFCKTC

26

SG+ICTPSCATGTLNCQVSL+FCKTC

1

SGIICTPSCATGTLNCQVSLSFCKTC

26

80.8%

NZ_JAIFIS010000001.1:

Lanthipeptides: K1X09_RS26315_lanthipeptide

1

SGLICTPSCATGTLNCQVSLTFCKTC

26

SGLICTPSC TGTLNC++SL+FC+TC

1

SGLICTPSCLTGTLNCKISLSFCRTC

26

80.8%

NZ_NIST01000001.1:

Lanthipeptides: CD001_RS09870_lanthipeptide

1

SGLICTPSCATGTLNCQVSLTFCKTC

26

+G ICTPSC TGTLNC+VSLTFC+TC

1

TGGICTPSCLTGTLNCRVSLTFCRTC

26

76.9%

NZ_WTWY01000020.1:

Lanthipeptides: GQY55_RS27090_lanthipeptide

1

SGLICTPSCATGTLNCQVSLTFCKTC

26

SG ICTPSC TGTLNC++SL+FC+TC

1

SGFICTPSCLTGTLNCKISLSFCRTC

26

53.8%

NZ_CP029370.1:

Lanthipeptides: DI243_RS07485_lanthipeptide

1

SGLICTPSCATGTLNCQVSLTFCKTC

26

SG+ICTP+C T LNC S++ C C

1

SGIICTPTCLTSILNCYTSISHCGPC

26

38.5%

NZ_CP090942.1:

Lanthipeptides: LZT96_RS12010_lanthipeptide

1

SGLICTPSCA-TGTLN

15

S ICTP CA TG+ N

3

SKFICTPGCAKTGSFN

18

36.4%

NC_006510.1and 5 others:

NZ_CP018058.1 Lanthipeptides: GT3921_RS18655_lanthipeptideNZ_CP023704.1 Lanthipeptides: CQJ30_RS18315_lanthipeptideNZ_CP025074.1 Lanthipeptides: CWI35_RS08795_lanthipeptideNZ_CP027303.2 Lanthipeptides: C1N76_RS05790_lanthipeptideNZ_CP038860.1 Lanthipeptides: E5Z46_RS04660_lanthipeptide

Lanthipeptides: GK_RS18085_lanthipeptide

4

ICTPSCATGTLNC--QVSLTFCKTC

26

+CTP C TG L C Q S C +C

6

LCTPGCITGILMCLTQNSCVSCNSC

30

36.4%

NC_009328.1and 6 others:

NZ_CP014140.1 Lanthipeptides: ACH33_RS18880_lanthipeptideNZ_CP014749.1 Lanthipeptides: A0V43_RS19510_lanthipeptideNZ_CP014749.1 Lanthipeptides: A0V43_RS19510_lanthipeptideNZ_CP017690.1 Lanthipeptides: GTID1_RS08690_lanthipeptideNZ_CP017694.1 Lanthipeptides: GD3902_RS07590_lanthipeptideNZ_PIJH01000004.1 Lanthipeptides: CV632_RS11810_lanthipeptide

Lanthipeptides: GTNG_RS18005_lanthipeptide

4

ICTPSCATGTLNC--QVSLTFCKTC

26

+CTP C TG L C Q S C +C

6

LCTPGCITGVLMCLTQNSCVSCNSC

30

34.6%

NZ_CP023076.1:

Lanthipeptides: CJ017_RS08945_lanthipeptide

1

SGLICTPSCA-TGTLN

15

S +CTP CA TG+ N

5

SHSLCTPGCAKTGSFN

20

34.6%

NZ_CP023477.1:

Lanthipeptides: CO204_RS07210_lanthipeptide

1

SGLICTPSCA-TGTLN

15

S +CTP CA TG+ N

3

SWSLCTPGCARTGSFN

18

MIBiG 4.0 matches for OF859_RS22650

21.6%

BGC0001229.4 (SBI_06989):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

1

SGLICTPSCATGTLNCQVSLTFCKT

25

+GLI + VS FC T

6

TGLILGIVAIQAGVAVGVSAAFCPT

30

20.6%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

4

ICTPSCATGTL

14

+CTP C TG L

6

LCTPGCKTGAL

16

14.3%

BGC0000517.4 (BAB04173.1):

Lanthipeptide: haloduracin β or haloduracin α

5

CTPSC

9

C PSC

23

CMPSC

27

with 1 more sequence matches

10.7%

BGC0000517.4 (BAB04173.1):

Lanthipeptide: haloduracin β or haloduracin α

9

CATGTLNCQV

18

CA ++C++

1

CAWYNISCRL

10

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.15 out of 26.06

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 22.30 out of 26.33

Confidence: medium

Additional weak hits (2):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.91 out of 28.14

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.67 out of 36.54

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

OF859_RS22650 - Class I

Cleavage pHMM score: 5.90

RODEO score: 22

Monoisotopic mass: 2506.2 Da

Molecular weight: 2508.0 Da

Number of bridges: 5

Alternative weights: (assuming N unmodified Ser/Thr residues); 2526.0 Da N = 1; 2544.0 Da N = 2; 2562.0 Da N = 3

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 137 - 232; Score: 54.8

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
MogR	Repressor of flagellar motility genes

NZ_CP109848.1 - Region 14 - lassopeptide

Download region GenBank file

Download region SVG

Location: 5,397,383 - 5,421,498 nt. (total: 24,116 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

OF859_RS24275: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Hydrolases: hydrolase

OF859_RS24340: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001356.4	0.76	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0001552.3	0.53	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002151.2	0.53	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.53	ribosomal	triculamin	Streptomyces triculaminicus
BGC0001634.3	0.53	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001549.3	0.52	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000575.5	0.52	ribosomal	lariatin	Rhodococcus jostii
BGC0001160.5	0.52	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002298.2	0.51	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001356.4	0.76	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0001552.3	0.53	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002151.2	0.53	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.53	ribosomal	triculamin	Streptomyces triculaminicus
BGC0001634.3	0.53	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001549.3	0.52	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000575.5	0.52	ribosomal	lariatin	Rhodococcus jostii
BGC0001160.5	0.52	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002298.2	0.51	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.77 out of 20.97

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.83 out of 27.78

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.90 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.52 out of 28.19

Confidence: medium

Additional weak hits (9):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.68 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.38 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.09 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.46 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.22 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.35 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.44 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.86 out of 31.73

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.67 out of 23.43

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 16 - 94; Score: 85.4

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor

NZ_CP109848.1 - Region 15 - NRPS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 5,456,675 - 5,556,654 nt. (total: 99,980 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

OF859_RS24580: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

OF859_RS24590: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: acylase acyltransferase aminotransferase

OF859_RS24625: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

OF859_RS24630: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

OF859_RS24650: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase hydrolase

OF859_RS24685: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

OF859_RS24800: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

smcogs: SMCOG1283: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

Ligases: ligase synthase

OF859_RS24615: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

OF859_RS24620: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

OF859_RS24640: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

OF859_RS24645: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

OF859_RS24655: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

OF859_RS24660: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

OF859_RS24670: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

OF859_RS24690: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.91	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.91	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.89	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.88	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.88	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.88	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.85	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.83	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.83	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.82	NRPS	dimethylcoprogen	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.16 out of 26.06

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.65 out of 27.78

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.22 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.64 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.83 out of 28.19

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.90 out of 24.78

Confidence: strong

Additional weak hits (9):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.27 out of 32.74

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.28 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.79 out of 39.62

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.70 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.84 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.33 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.22 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 20, location 5456674 - 5556654:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (X - Me-ohmal) + (mal) + (X) + (ohmal) + (X - Gly) + (ccmal - Lys - X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

OF859_RS24615: X

AMP-binding (459..851): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LEPCFDVSVFEGWFMTGGDVNAYGPSENTIFTSF
Nearest Stachelhaus code(s):: Ala DVFWTGGIFK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

OF859_RS24620: Lys - X

Search NORINE for peptide: strict or relaxed

AMP-binding (2059..2458): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YAFAFDASVEEPSAISGGDYNTYGPTEATVCATY
Nearest Stachelhaus code(s):: Lys DAESIGSVCK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (3045..3446): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWLAFDGSIVESFFMSGGELNLYGPTEASVFATA
Nearest Stachelhaus code(s):: Val DGYFLGVVFK (59% 8Å match); Ile DGFFLGVVFK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

OF859_RS24625: mal

PKS_AT (6..293): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 123.4
Methoxymalonyl-CoA: 47.3
inactive: 42.6
Methylmalonyl-CoA: 39.9
Ethylmalonyl-CoA: 17.3
fatty_acid: 14.4
Propionyl-CoA: 12.4
Isobutyryl-CoA: 12.4
2-Methylbutyryl-CoA: 9.3
Acetyl-CoA: 8.2
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

OF859_RS24630: X - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (472..903): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TWLTFTDSVWEWQFFNGGEANLYGMTESAIYATQ
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1561..1955): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LGITFDIFVLELQMMVGGEFNMYGPTETTVWSTV
Nearest Stachelhaus code(s):: Gly DILQMGMVWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

OF859_RS24645: X

AMP-binding (38..457): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TWLTFTDSVWEWQFFNGGEANIYGMTESAIYATC
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (62% 8Å match)
Stachelhaus code match:: 60% (weak)

OF859_RS24660: X

AMP-binding (268..664): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QGLAFDPSVQQLNTMVAGELNIYGPTEAAINTTL
Nearest Stachelhaus code(s):: Ala DVSNMAIIYK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

OF859_RS24690: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (457..852): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGEFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor

NZ_CP109848.1 - Region 16 - proteusin

Download region GenBank file

Download region SVG

Location: 5,607,403 - 5,627,639 nt. (total: 20,237 nt) Show pHMM detection rules used

proteusin: (PoyD or TIGR03793)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase

OF859_RS25065: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Lyases: hydratase

OF859_RS25105: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000889.5	0.35	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000668.5	0.30	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0002713.2	0.29	NRPS	mevalagmapeptide A, mevalagmapeptide B, mevalagmapeptide C, mevalagmapeptide D	Photorhabdus laumondii subsp. laumondii
BGC0001594.3	0.29	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0001126.4	0.28	other (other), terpene	12-epi-hapalindole J isonitrile, ambiguine A isonitrile, ambiguine B isonitrile, ambiguine C isonitrile, ambiguine D isonitrile, ambiguine E isonitrile, ambiguine K isonitrile, ambiguine L isonitrile, ambiguine I isonitrile, ambiguine J isonitrile	Fischerella ambigua UTEX 1903
BGC0001501.5	0.28	other (other)	ambiguine P	Fischerella sp. TAU
BGC0001612.3	0.28	other (other)	ambiguine H isonitrile	Fischerella ambigua UTEX 1903
BGC0002443.3	0.27	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus
BGC0001595.3	0.26	other (other)	fischerindole	Fischerella sp. SAG 46.79

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000889.5	0.35	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000668.5	0.30	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0002713.2	0.29	NRPS	mevalagmapeptide A, mevalagmapeptide B, mevalagmapeptide C, mevalagmapeptide D	Photorhabdus laumondii subsp. laumondii
BGC0001594.3	0.29	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0001126.4	0.28	other (other), terpene	12-epi-hapalindole J isonitrile, ambiguine A isonitrile, ambiguine B isonitrile, ambiguine C isonitrile, ambiguine D isonitrile, ambiguine E isonitrile, ambiguine K isonitrile, ambiguine L isonitrile, ambiguine I isonitrile, ambiguine J isonitrile	Fischerella ambigua UTEX 1903
BGC0001501.5	0.28	other (other)	ambiguine P	Fischerella sp. TAU
BGC0001612.3	0.28	other (other)	ambiguine H isonitrile	Fischerella ambigua UTEX 1903
BGC0002443.3	0.27	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus
BGC0001595.3	0.26	other (other)	fischerindole	Fischerella sp. SAG 46.79

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.09 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.01 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.27 out of 28.19

Confidence: medium

Additional weak hits (7):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.33 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.47 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.12 out of 36.54

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.42 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.59 out of 30.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.87 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_CP109848.1 - Region 17 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 5,785,941 - 5,821,333 nt. (total: 35,393 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

OF859_RS25850: hydrolase

smcogs: SMCOG1179: hydrolase

Lyases: decarboxylase

OF859_RS25900: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000943.5	0.58	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0001408.5	0.57	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002471.3	0.56	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0002682.2	0.56	other (other)	aerobactin	Vibrio mimicus
BGC0000939.5	0.55	other (other)	aerobactin	Grimontia hollisae
BGC0000947.5	0.53	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000946.5	0.52	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001572.3	0.52	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002073.3	0.52	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001870.3	0.51	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000943.5	0.58	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0001408.5	0.57	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002471.3	0.56	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0002682.2	0.56	other (other)	aerobactin	Vibrio mimicus
BGC0000939.5	0.55	other (other)	aerobactin	Grimontia hollisae
BGC0000947.5	0.53	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000946.5	0.52	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001572.3	0.52	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002073.3	0.52	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001870.3	0.51	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 23.51 out of 27.55

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.54 out of 29.38

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.49 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.38 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.18 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.27 out of 28.19

Confidence: medium

Additional weak hits (15):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.38 out of 26.06

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.88 out of 24.78

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.52 out of 30.11

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.00 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.93 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.43 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.03 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.34 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.49 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.14 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.37 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.86 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
FuR variant 1	Ferric Uptake Regulator
GnfM	Regulator of nitrogen-fixation genes
RpoN	Regulator of nitrogen assimilation and virulence
ZuR variant 1	Zinc-responsive repressor