GCF_025655475.1 - 29 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JAHTIK010000001.1 (Kitasatospora sp. DSM 101779)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	linaridin	51,998	72,606
Region 1.2	terpene	96,443	121,545	High	raimonol	terpene
Region 1.3	lanthipeptide-class-iv,terpene-precursor	267,606	305,447
Region 1.4	NAPAA	466,880	500,737	High	ε-Poly-L-lysine	NRPS:Type I
Region 1.5	terpene	553,528	574,448
Region 1.6	RiPP-like	798,715	809,527
Region 1.7	NRPS,NRPS-like	1,233,158	1,296,467
Region 1.8	NRPS-like	1,425,976	1,468,963	Medium	Livipeptin	NRPS:Type V
Region 1.9	hydrogen-cyanide	1,737,178	1,750,117
Region 1.10	T2PKS	1,778,355	1,850,858	High	spore pigment	PKS
Region 1.11	NI-siderophore,CDPS,butyrolactone	2,005,198	2,046,087	Low	peucechelin	NRPS:Type I
Region 1.12	azole-containing-RiPP,lanthipeptide-class-ii	2,147,277	2,174,399
Region 1.13	thioamitides	2,313,041	2,335,493
Region 1.14	RiPP-like	2,679,965	2,690,816
Region 1.15	NI-siderophore	2,865,383	2,895,152
Region 1.16	butyrolactone	4,275,869	4,286,891	Low	gaburedin A/gaburedin B/gaburedin C/gaburedin D/gaburedin E/gaburedin F	other:other
Region 1.17	NI-siderophore	4,535,682	4,565,469	High	legonoxamine A/desferrioxamine B/legonoxamine B	other:other
Region 1.18	terpene-precursor	4,631,526	4,652,575
Region 1.19	terpene,hglE-KS,T1PKS	4,781,919	4,841,833
Region 1.20	T2PKS,aminocoumarin,HR-T2PKS	5,779,351	5,851,830	High	simocyclinone D8	PKS:Type I+saccharide+other:aminocoumarin
Region 1.21	terpene	5,902,851	5,925,130	High	geosmin	terpene:Sesquiterpene
Region 1.22	terpene-precursor	5,997,654	6,018,778
Region 1.23	melanin	6,273,156	6,283,548	Low	melanin	other:other
Region 1.24	T3PKS,terpene	6,419,213	6,485,494	Medium	hopene	terpene
Region 1.25	terpene	6,498,645	6,519,595
Region 1.26	NRPS	6,988,841	7,051,071	Medium	Ficellomycin	NRPS:Type I
Region 1.27	terpene	7,494,010	7,515,326
Region 1.28	azole-containing-RiPP	7,863,716	7,905,800	Low	clifednamide A	NRPS:Type I+PKS
Region 1.29	NAPAA	8,127,479	8,161,558	High	ε-Poly-L-lysine	NRPS:Type I

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	linaridin	51,998	72,606
Region 1.2	terpene	96,443	121,545	High	raimonol	terpene
Region 1.3	lanthipeptide-class-iv,terpene-precursor	267,606	305,447
Region 1.4	NAPAA	466,880	500,737	High	ε-Poly-L-lysine	NRPS:Type I
Region 1.5	terpene	553,528	574,448
Region 1.6	RiPP-like	798,715	809,527
Region 1.7	NRPS,NRPS-like	1,233,158	1,296,467
Region 1.8	NRPS-like	1,425,976	1,468,963	Medium	Livipeptin	NRPS:Type V
Region 1.9	hydrogen-cyanide	1,737,178	1,750,117
Region 1.10	T2PKS	1,778,355	1,850,858	High	spore pigment	PKS
Region 1.11	NI-siderophore,CDPS,butyrolactone	2,005,198	2,046,087	Low	peucechelin	NRPS:Type I
Region 1.12	azole-containing-RiPP,lanthipeptide-class-ii	2,147,277	2,174,399
Region 1.13	thioamitides	2,313,041	2,335,493
Region 1.14	RiPP-like	2,679,965	2,690,816
Region 1.15	NI-siderophore	2,865,383	2,895,152
Region 1.16	butyrolactone	4,275,869	4,286,891	Low	gaburedin A/gaburedin B/gaburedin C/gaburedin D/gaburedin E/gaburedin F	other:other
Region 1.17	NI-siderophore	4,535,682	4,565,469	High	legonoxamine A/desferrioxamine B/legonoxamine B	other:other
Region 1.18	terpene-precursor	4,631,526	4,652,575
Region 1.19	terpene,hglE-KS,T1PKS	4,781,919	4,841,833
Region 1.20	T2PKS,aminocoumarin,HR-T2PKS	5,779,351	5,851,830	High	simocyclinone D8	PKS:Type I+saccharide+other:aminocoumarin
Region 1.21	terpene	5,902,851	5,925,130	High	geosmin	terpene:Sesquiterpene
Region 1.22	terpene-precursor	5,997,654	6,018,778
Region 1.23	melanin	6,273,156	6,283,548	Low	melanin	other:other
Region 1.24	T3PKS,terpene	6,419,213	6,485,494	Medium	hopene	terpene
Region 1.25	terpene	6,498,645	6,519,595
Region 1.26	NRPS	6,988,841	7,051,071	Medium	Ficellomycin	NRPS:Type I
Region 1.27	terpene	7,494,010	7,515,326
Region 1.28	azole-containing-RiPP	7,863,716	7,905,800	Low	clifednamide A	NRPS:Type I+PKS
Region 1.29	NAPAA	8,127,479	8,161,558	High	ε-Poly-L-lysine	NRPS:Type I

No secondary metabolite regions were found in these records:: NZ_JAHTIK010000002.1 (Kitasatospora sp. DSM 101779); NZ_JAHTIK010000003.1 (Kitasatospora sp. DSM 101779); NZ_JAHTIK010000004.1 (Kitasatospora sp. DSM 101779); NZ_JAHTIK010000005.1 (Kitasatospora sp. DSM 101779); NZ_JAHTIK010000006.1 (Kitasatospora sp. DSM 101779); NZ_JAHTIK010000007.1 (Kitasatospora sp. DSM 101779); NZ_JAHTIK010000008.1 (Kitasatospora sp. DSM 101779); NZ_JAHTIK010000009.1 (Kitasatospora sp. DSM 101779); NZ_JAHTIK010000010.1 (Kitasatospora sp. DSM 101779); NZ_JAHTIK010000011.1 (Kitasatospora sp. DSM 101779); NZ_JAHTIK010000012.1 (Kitasatospora sp. DSM 101779); NZ_JAHTIK010000013.1 (Kitasatospora sp. DSM 101779); NZ_JAHTIK010000014.1 (Kitasatospora sp. DSM 101779); NZ_JAHTIK010000015.1 (Kitasatospora sp. DSM 101779)

Compact view

NZ_JAHTIK010000001.1 - Region 1 - linaridin

Download region GenBank file

Download region SVG

Location: 51,998 - 72,606 nt. (total: 20,609 nt) Show pHMM detection rules used

linaridin: (cypemycin or cypI)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KSNIM_RS00295: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: hydrolase

KSNIM_RS00285: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001735.5	0.49	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0002151.2	0.44	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.44	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000584.5	0.40	ribosomal	colicin V	Escherichia coli
BGC0001862.4	0.40	ribosomal	pallidocin	Aeribacillus pallidus
BGC0001188.3	0.40	ribosomal	legonaridin	Streptomyces sp. CT34
BGC0000500.5	0.40	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001861.4	0.39	ribosomal	bacillicin BAG2O	Bacillus cereus BAG2O-1
BGC0000496.5	0.38	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000520.5	0.38	ribosomal	lacticin 3147 A1, lacticin 3147 A2	Lactococcus lactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001735.5	0.49	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0002151.2	0.44	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.44	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000584.5	0.40	ribosomal	colicin V	Escherichia coli
BGC0001862.4	0.40	ribosomal	pallidocin	Aeribacillus pallidus
BGC0001188.3	0.40	ribosomal	legonaridin	Streptomyces sp. CT34
BGC0000500.5	0.40	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001861.4	0.39	ribosomal	bacillicin BAG2O	Bacillus cereus BAG2O-1
BGC0000496.5	0.38	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000520.5	0.38	ribosomal	lacticin 3147 A1, lacticin 3147 A2	Lactococcus lactis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

Additional weak hits (4):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.07 out of 21.84

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JAHTIK010000001.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 96,443 - 121,545 nt. (total: 25,103 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

KSNIM_RS00450: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

KSNIM_RS00465: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Lyases: cyclase

KSNIM_RS00470: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthetase

KSNIM_RS00455: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001911.3	0.78	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.69	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000677.5	0.57	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002309.2	0.52	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001969.3	0.51	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000286.3	0.49	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000678.5	0.44	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001911.3	0.78	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.69	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000677.5	0.57	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002309.2	0.52	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001969.3	0.51	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000286.3	0.49	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000678.5	0.44	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	none

Genes with terpene domains:

KSNIM_RS00455: PT_FPPS_like

Domain 1 (77 - 383): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

KSNIM_RS00460: T2TS

Domain 1 (17 - 529): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

KSNIM_RS00470: T1TS

Domain 1 (4 - 318): Type 1 terpene synthase

Subtype: Labdatriene synthase type

Reactions:: diterpene_C6-C11/C10-C15_PP → diterpene_C6-C11/C10-C15

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.95 out of 23.79

Confidence: medium

Additional weak hits (2):

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.23 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.41 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JAHTIK010000001.1 - Region 3 - lanthipeptide-class-iv,terpene-precursor

Download region GenBank file

Download region SVG

Location: 267,606 - 305,447 nt. (total: 37,842 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

KSNIM_RS01220: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KSNIM_RS01295: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KSNIM_RS01320: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Lyases: cyclase dehydratase

KSNIM_RS01255: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

KSNIM_RS01280: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

KSNIM_RS01340: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.47	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000188.5	0.21	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0002425.3	0.18	ribosomal	stlassin	Streptomyces sp.
BGC0000845.5	0.18	other (non-nrp beta-lactam)	clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0001760.5	0.18	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970
BGC0000253.4	0.17	PKS	oviedomycin	Streptomyces antibioticus
BGC0000220.4	0.17	PKS	enterocin	Streptomyces maritimus
BGC0002366.2	0.17	PKS	enterocin, neoenterocin A, neoenterocin B	Streptomyces sp. SCSIO 11863
BGC0001596.3	0.17	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0002081.3	0.16	PKS	streptoketide A, streptoketide B, streptoketide C, S2502, S2507, UWM5	Streptomyces sp. Tue6314

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000894.4	0.45	other (other)	citrinin	Monascus aurantiacus
BGC0002700.2	0.45	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002111.3	0.43	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0001458.4	0.42	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0000665.5	0.41	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000518.3	0.41	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001529.5	0.41	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000507.5	0.41	ribosomal	epicidin	Staphylococcus epidermidis
BGC0002701.2	0.40	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

KSNIM_RS01340: PT_FPPS_like

Domain 1 (60 - 323): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (10):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.20 out of 29.38

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.36 out of 29.51

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.22 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.25 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.33 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.56 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.35 out of 28.19

Confidence: weak

Lanthipeptides

Terpene

TFBS Finder

Core peptide predictions

No core peptides found.

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
OsdR	Development and stress management regulator

NZ_JAHTIK010000001.1 - Region 4 - NAPAA

Download region GenBank file

Download region SVG

Location: 466,880 - 500,737 nt. (total: 33,858 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

KSNIM_RS02220: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: dehalogenase hydrolase

KSNIM_RS02230: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

KSNIM_RS02245: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase

KSNIM_RS02255: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.59	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.59	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.77 out of 23.79

Confidence: medium

Additional weak hits (13):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.70 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.26 out of 28.14

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.20 out of 26.12

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.55 out of 29.72

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.56 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.84 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.54 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.33 out of 31.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.29 out of 24.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.50 out of 20.01

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.52 out of 29.38

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.60 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 466879 - 500737:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KSNIM_RS02255: X

AMP-binding (26..398): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JAHTIK010000001.1 - Region 5 - terpene

Download region GenBank file

Download region SVG

Location: 553,528 - 574,448 nt. (total: 20,921 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

KSNIM_RS02670: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

Transferases: methyltransferase

KSNIM_RS02705: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001077.4	0.40	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0000249.5	0.39	PKS	nogalamycin	Streptomyces nogalater
BGC0001227.3	0.39	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0002554.2	0.38	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0000649.3	0.36	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001366.5	0.34	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0001335.5	0.33	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0000908.3	0.33	other (other)	melanin	Streptomyces avermitilis
BGC0001235.4	0.32	NRPS, PKS	antalid	Polyangium spumosum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001077.4	0.40	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0000249.5	0.39	PKS	nogalamycin	Streptomyces nogalater
BGC0001227.3	0.39	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0002554.2	0.38	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0000649.3	0.36	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001366.5	0.34	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0001335.5	0.33	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0000908.3	0.33	other (other)	melanin	Streptomyces avermitilis
BGC0001235.4	0.32	NRPS, PKS	antalid	Polyangium spumosum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

KSNIM_RS02665: PT_phytoene_like

Domain 1 (30 - 292): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 17.94 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (8):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.36 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.40 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.44 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.06 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.78 out of 29.65

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.17 out of 39.62

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.03 out of 27.04

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

NZ_JAHTIK010000001.1 - Region 6 - RiPP-like

Download region GenBank file

Download region SVG

Location: 798,715 - 809,527 nt. (total: 10,813 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer

KSNIM_RS03780: flavodoxin

smcogs: SMCOG1134: flavodoxin

Transferases: aminotransferase

KSNIM_RS03805: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

KSNIM_RS03810: aminotransferase

smcogs: SMCOG1019: aminotransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002458.3	0.49	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0002716.2	0.37	NRPS	gamexpeptide A, gamexpeptide B, gamexpeptide E, luminmide B, luminmide D, luminmide E, luminmide F, luminmide G	Photorhabdus laumondii subsp. laumondii
BGC0001882.3	0.35	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0000715.5	0.31	saccharide	actinospectacin	Streptomyces spectabilis
BGC0001964.2	0.29	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0002536.3	0.28	NRPS	alazopeptin	Kitasatospora azatica KCTC 9699
BGC0000981.3	0.27	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E6
BGC0000950.5	0.24	NRPS, other (nucleoside)	napsamycin A, napsamycin B, napsamycin C, napsamycin D, mureidomycin A, mureidomycin B	Streptomyces sp. DSM 5940
BGC0000369.5	0.23	NRPS, saccharide	hassallidin C, hassallidin D	Anabaena sp. Syke748
BGC0001368.5	0.23	NRPS	JBIR-126	Streptomyces sp. NRRL F-4474

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002458.3	0.49	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0002716.2	0.37	NRPS	gamexpeptide A, gamexpeptide B, gamexpeptide E, luminmide B, luminmide D, luminmide E, luminmide F, luminmide G	Photorhabdus laumondii subsp. laumondii
BGC0001882.3	0.35	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0000715.5	0.31	saccharide	actinospectacin	Streptomyces spectabilis
BGC0001964.2	0.29	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0002536.3	0.28	NRPS	alazopeptin	Kitasatospora azatica KCTC 9699
BGC0000981.3	0.27	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E6
BGC0000950.5	0.24	NRPS, other (nucleoside)	napsamycin A, napsamycin B, napsamycin C, napsamycin D, mureidomycin A, mureidomycin B	Streptomyces sp. DSM 5940
BGC0000369.5	0.23	NRPS, saccharide	hassallidin C, hassallidin D	Anabaena sp. Syke748
BGC0001368.5	0.23	NRPS	JBIR-126	Streptomyces sp. NRRL F-4474

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

Additional weak hits (4):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.22 out of 30.22

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.59 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.36 out of 20.97

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAHTIK010000001.1 - Region 7 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1,233,158 - 1,296,467 nt. (total: 63,310 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

KSNIM_RS05780: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

KSNIM_RS05840: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Hydrolases: esterase hydrolase

KSNIM_RS05740: thioesterase

smcogs: SMCOG1004: thioesterase

KSNIM_RS05785: thioesterase

smcogs: SMCOG1004: thioesterase

KSNIM_RS05820: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

KSNIM_RS05875: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: lyase

KSNIM_RS05745: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase

KSNIM_RS05805: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KSNIM_RS05810: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KSNIM_RS05855: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.84	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.83	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.83	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.83	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.82	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.79	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.79	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.74	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.73	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

Additional weak hits (7):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.19 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.54 out of 26.85

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.74 out of 29.72

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.52 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.00 out of 30.98

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.92 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 9, location 1233157 - 1296467:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Asn - Asn) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 1233157 - 1285671:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Asn - Asn) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 11, location 1254706 - 1296467:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Asn - Asn) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KSNIM_RS05805: X - X

AMP-binding (21..410): X

nrpys: Ser, Thr, Dhpg, Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RDATFDPVVFQLELTSAGERNVYGPAECAIGVTD
Nearest Stachelhaus code(s):: Kiv DHVWTAVSGK (44% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1057..1459): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWTSYDMVVPDTKLLAVGDLNEYGPTEISVANST
Nearest Stachelhaus code(s):: Asn DGTKLGEVGK (53% 8Å match); D-Ala DMPQLGMVWK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

KSNIM_RS05810: Asn - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (496..890): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWSSFDLVVPNTKLIAAGDASEYGPTEITVGNSC
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1542..1945): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWAGFDLSVPNLKIVVGADINEYGPTETVVGCSV
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

KSNIM_RS05855: X

AMP-binding (9..402): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAFDASTFEGLLLTGGDVNGYGPTENTTYTCC
Nearest Stachelhaus code(s):: Dhpg or cl-me-dHpg DSFLLGGTYK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JAHTIK010000001.1 - Region 8 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1,425,976 - 1,468,963 nt. (total: 42,988 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase transferase

KSNIM_RS06590: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

KSNIM_RS06595: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: ligase

KSNIM_RS06660: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

KSNIM_RS06600: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001168.5	0.68	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001168.5	0.68	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.53 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 26.66 out of 30.11

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.07 out of 30.12

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.61 out of 23.43

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (11):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.31 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.09 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 17.67 out of 22.40

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.67 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.35 out of 36.53

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.61 out of 28.14

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.53 out of 26.85

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.24 out of 28.14

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.23 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.79 out of 33.14

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.20 out of 30.11

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 1425975 - 1468963:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KSNIM_RS06660: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (4..405): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TRVGFDTSLEQTDLIVGGDLNAYGLTETGITSTL
Nearest Stachelhaus code(s):: Arg DTEDIGAITK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
CelR	Cellobiose uptake repressor
OsdR	Development and stress management regulator

NZ_JAHTIK010000001.1 - Region 9 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 1,737,178 - 1,750,117 nt. (total: 12,940 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

KSNIM_RS08100: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

KSNIM_RS08115: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

KSNIM_RS08125: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0001424.4	0.33	NRPS, PKS	myxochromide C	Myxococcus virescens
BGC0001427.4	0.33	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001428.4	0.33	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001423.4	0.33	NRPS, PKS	myxochromide C	Myxococcus hansupus
BGC0001421.4	0.33	NRPS, PKS	myxochromide B	Myxococcus sp.
BGC0001422.4	0.32	NRPS, PKS	myxochromide A	Myxococcus fulvus HW-1
BGC0001739.3	0.30	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001108.5	0.28	NRPS, PKS	pederin, pseudopederin, pederone	Uncultured bacterium
BGC0002556.2	0.27	other (other)	cervinomycin B3, cervinomycin C1, cervinomycin C2, cervinomycin C3, cervinomycin C4	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0001424.4	0.33	NRPS, PKS	myxochromide C	Myxococcus virescens
BGC0001427.4	0.33	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001428.4	0.33	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001423.4	0.33	NRPS, PKS	myxochromide C	Myxococcus hansupus
BGC0001421.4	0.33	NRPS, PKS	myxochromide B	Myxococcus sp.
BGC0001422.4	0.32	NRPS, PKS	myxochromide A	Myxococcus fulvus HW-1
BGC0001739.3	0.30	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001108.5	0.28	NRPS, PKS	pederin, pseudopederin, pederone	Uncultured bacterium
BGC0002556.2	0.27	other (other)	cervinomycin B3, cervinomycin C1, cervinomycin C2, cervinomycin C3, cervinomycin C4	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.90 out of 30.12

Confidence: medium

Additional weak hits (3):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.88 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_JAHTIK010000001.1 - Region 10 - T2PKS

Download region GenBank file

Download region SVG

Location: 1,778,355 - 1,850,858 nt. (total: 72,504 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

KSNIM_RS08345: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

KSNIM_RS08350: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

KSNIM_RS08390: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

KSNIM_RS08395: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KSNIM_RS08465: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

KSNIM_RS08475: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

KSNIM_RS08580: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase methyltransferase transferase

KSNIM_RS08425: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

KSNIM_RS08480: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

KSNIM_RS08545: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: deacetylase

KSNIM_RS08380: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Lyases: cyclase

KSNIM_RS08430: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

KSNIM_RS08435: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Isomerases: mutase

KSNIM_RS08335: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

KSNIM_RS08400: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KSNIM_RS08445: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

KSNIM_RS08450: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport transporter

KSNIM_RS08290: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

KSNIM_RS08470: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.78	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.74	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.72	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.64	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.61	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.59	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001513.3	0.59	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001723.5	0.58	PKS	oviedomycin	Streptomyces antibioticus
BGC0000275.4	0.58	PKS	tetracenomycin C	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.78	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.74	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.72	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.64	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.61	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.59	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001513.3	0.59	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001723.5	0.58	PKS	oviedomycin	Streptomyces antibioticus
BGC0000275.4	0.58	PKS	tetracenomycin C	Streptomyces glaucescens

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

Additional weak hits (17):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.86 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.19 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.57 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.76 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.30 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.45 out of 30.25

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.56 out of 27.18

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.90 out of 32.93

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.67 out of 25.88

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.21 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.61 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.24 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.45 out of 32.93

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.14 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.25 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

KSNIM_RS08400: X

AMP-binding (46..443): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GSTSWAKHAWSACAVAAGERDGFGQTETTAQIGN
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 1778354 to 1850858
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

KSNIM_RS08350: KR (Score: 77.5; E-value: 2.9e-24)
KSNIM_RS08395: KR (Score: 98.9; E-value: 8.6e-31)
KSNIM_RS08425: MET C6|C8 (Score: 520.1; E-value: 4.5e-159)
KSNIM_RS08430: CYC C4-C21/C2-C23|C2-C19 (Score: 144.3; E-value: 2.7e-45)
KSNIM_RS08435: CYC C9-C14 (Score: 248.8; E-value: 3.6e-77)
KSNIM_RS08440: ACP (Score: 54.6; E-value: 1.9e-17)
KSNIM_RS08445: CLF (Score: 551.0; E-value: 3.5e-168)
KSNIM_RS08450: KS (Score: 716.8; E-value: 1.7e-218)
KSNIM_RS08455: CYC C5-C18 (Score: 212.6; E-value: 3.6e-66)
KSNIM_RS08465: OXY (Score: 289.1; E-value: 1.6e-88)
KSNIM_RS08475: OXY (Score: 10.6; E-value: 0.00049)
KSNIM_RS08580: KR (Score: 132.6; E-value: 4.5e-41)

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAHTIK010000001.1 - Region 11 - CDPS,NI-siderophore,butyrolactone

Download region GenBank file

Download region SVG

Location: 2,005,198 - 2,046,087 nt. (total: 40,890 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC
CDPS: CDPS
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

KSNIM_RS09330: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KSNIM_RS09340: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KSNIM_RS09395: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

KSNIM_RS09465: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

KSNIM_RS09475: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: aminotransferase methyltransferase

KSNIM_RS09410: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

KSNIM_RS09415: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: dehalogenase hydrolase phosphatase

KSNIM_RS09315: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

KSNIM_RS09345: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

KSNIM_RS09390: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Lyases: decarboxylase

KSNIM_RS09385: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

KSNIM_RS09405: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase

KSNIM_RS09450: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.67	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.52	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0001986.3	0.52	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0002683.2	0.49	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002633.2	0.48	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0000848.5	0.47	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002470.2	0.45	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001948.3	0.43	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002692.2	0.42	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000946.5	0.66	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.63	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0001986.3	0.60	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0002683.2	0.59	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000849.4	0.58	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002633.2	0.57	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002470.2	0.57	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000850.5	0.56	other (other)	γ-butyrolactone	Streptomyces acidiscabies

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.03 out of 36.53

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

Additional weak hits (16):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.29 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.67 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.76 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.42 out of 28.14

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.23 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.56 out of 21.55

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.69 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.97 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.84 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 35.63

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.57 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.48 out of 29.65

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.76 out of 29.25

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JAHTIK010000001.1 - Region 12 - azole-containing-RiPP,lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 2,147,277 - 2,174,399 nt. (total: 27,123 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

KSNIM_RS10080: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

KSNIM_RS10100: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: kinase

KSNIM_RS10025: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Lyases: cyclase

KSNIM_RS10060: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002698.2	0.50	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002699.2	0.46	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000565.5	0.43	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.41	ribosomal	microcin N	Escherichia coli
BGC0000483.5	0.38	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002551.2	0.38	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0000554.4	0.38	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002485.2	0.38	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000588.5	0.37	ribosomal	microcin L	Escherichia coli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002698.2	0.58	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002699.2	0.57	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000565.5	0.54	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001555.4	0.54	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.53	ribosomal	microcin N	Escherichia coli
BGC0000483.5	0.51	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002551.2	0.51	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0000554.4	0.51	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002485.2	0.51	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0001579.4	0.51	ribosomal	duramycin	Streptomyces cinnamoneus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for KSNIM_RS10060

KSNIM_RS10085

Leader:

MAENEITENEQFDIEVEELDTVNGG

Core:

ISVSSLACAACPVSSFSSVSNSVAETAAE

Core with dehydrations:

IDhaVDhaDhaLACysAACysPVDhaDhaFDhaDhaVDhaNDhaVAEDhbAAE

antiSMASH-DB 4.0 matches for KSNIM_RS10085

100.0%

NZ_JAHTIK010000001.1:

Lanthipeptides: KSNIM_RS10085_lanthipeptide

1

ISVSSLACAACPVSSFSSVSNSVAETAAE

29

ISVSSLACAACPVSSFSSVSNSVAETAAE

1

ISVSSLACAACPVSSFSSVSNSVAETAAE

29

89.7%

NZ_LMHX01000004.1:

Lanthipeptides: ASE03_RS35880_lanthipeptide

1

ISVSSLACAACPVSSFSSVSNSVAETAAE

29

+SVSSLACAACPVSSFSSVSNSVAE +AE

1

VSVSSLACAACPVSSFSSVSNSVAEVSAE

29

86.2%

NZ_CP113837.1and 1 other:

NZ_QLLT01000020.1 Lanthipeptides: K353_RS34505_lanthipeptide

Lanthipeptides: OU787_RS19220_lanthipeptide

1

ISVSSLACAACPVSSFSSVSNSVAETAAE

29

+SVSSL AACPVSSFSSVSNSVAE AAE

1

VSVSSLLSAACPVSSFSSVSNSVAEVAAE

29

with 3 more sequence matches

82.8%

NC_016109.1:

Lanthipeptides: KSE_RS42960_lanthipeptide

1

ISVSSLACAACPVSSFSSVSNSVAETAAE

29

+SVSSL AACPVSSFSSVSN+VAE AAE

1

VSVSSLLSAACPVSSFSSVSNAVAEVAAE

29

82.8%

NZ_CP054919.1:

Lanthipeptides: HUT16_RS21065_lanthipeptide

1

ISVSSLACAACPVSSFSSVSNSVAETAAE

29

+SVSSL AACPVSSFSSVSNSVAE +AE

1

VSVSSLLSAACPVSSFSSVSNSVAEVSAE

29

19.4%

NZ_FNPT01000012.1:

Lanthipeptides: allorf_041529_041675_lanthipeptide

4

SSLACAACPVSSFSSVSNSVAETAAE

29

++L C CP +F+ + T E

5

TALLCRICPHPAFARADRAALRTGPE

30

MIBiG 4.0 matches for KSNIM_RS10085

13.8%

BGC0000563.4 (AEA03263.1):

Lanthipeptide: venezuelin

9

AACPVSSFSSVSNSV

23

A C ++ N+V

1

ATCECVGLLTLLNTV

15

9.8%

BGC0002120.3 (NQE92413.1):

Lanthipeptide: nocathioamide A

2

SVSSLACAA

10

++SSL C A

42

TLSSLPCCA

50

allorf_2154987_2155154

Leader:

MRTPSHPPPSGSTGGSDRARAYRHRLEHRTLLRA

Core:

IPAVRWMNCERARTPVAHSPR

Core with dehydrations:

IPAVRWMNCysERARDhbPVAHDhaPR

antiSMASH-DB 4.0 matches for allorf_2154987_2155154

100.0%

NZ_JAHTIK010000001.1:

Lanthipeptides: allorf_2154987_2155154_lanthipeptide

1

IPAVRWMNCERARTPVAHSPR

21

IPAVRWMNCERARTPVAHSPR

1

IPAVRWMNCERARTPVAHSPR

21

20.8%

NZ_AULU01000012.1:

Lanthipeptides: H580_RS25790_lanthipeptide

1

IPAVRWMNC

9

P RW NC

15

CPGTRWFNC

23

allorf_2154999_2155214

Leader:

MSDLRLAATCHRRSGEAAA

Core:

PLPWRMRDGGPCPFTVHPSDRRDCPQECSVFEPVAICSRPVGSAGRPARGRV

Core with dehydrations:

PLPWRMRDGGPCysPFDhbVHPDhaDRRDCysPQECysDhaVFEPVAICysDhaRPVGDhaAGRPARGRV

antiSMASH-DB 4.0 matches for allorf_2154999_2155214

100.0%

NZ_JAHTIK010000001.1:

Lanthipeptides: allorf_2154999_2155214_lanthipeptide

1

PLPWRMRDGGPCPFTVHPSDRRDCPQECSVFEPVAICSRPVGSAGRPARGRV

52

PLPWRMRDGGPCPFTVHPSDRRDCPQECSVFEPVAICSRPVGSAGRPARGRV

1

PLPWRMRDGGPCPFTVHPSDRRDCPQECSVFEPVAICSRPVGSAGRPARGRV

52

17.3%

NZ_PIZC01000055.1:

Lanthipeptides: allorf_15638_15868_lanthipeptide

16

VHPSDRRDCPQECSVFEPVAICSRPVG

42

+ SD+ D PQ S + +C R +G

12

IWSSDKSDLPQTDSAIRFLVLCRRWLG

38

13.5%

NZ_CP017953.1and 12 others:

NZ_CP021011.1 Lanthipeptides: allorf_1239450_1239680_lanthipeptideNZ_CP033054.1 Lanthipeptides: allorf_3724234_3724464_lanthipeptideNZ_CP041784.1 Lanthipeptides: allorf_3263499_3263729_lanthipeptideNZ_CP047268.1 Lanthipeptides: allorf_3744242_3744472_lanthipeptideNZ_CP048002.1 Lanthipeptides: allorf_1130609_1130839_lanthipeptideNZ_CP072563.1 Lanthipeptides: allorf_3274357_3274587_lanthipeptideNZ_CP097784.1 Lanthipeptides: allorf_3221763_3221993_lanthipeptideNZ_CP116014.1 Lanthipeptides: allorf_3479615_3479845_lanthipeptideNZ_JAAKXX010000011.1 Lanthipeptides: allorf_316050_316280_lanthipeptideNZ_JAANHO010000006.1 Lanthipeptides: allorf_123482_123712_lanthipeptideNZ_JAIONG010000001.1 Lanthipeptides: allorf_273844_274074_lanthipeptideNZ_LMAG01000012.1 Lanthipeptides: allorf_316397_316627_lanthipeptide

Lanthipeptides: allorf_3287857_3288087_lanthipeptide

2

LPWRMRDGGPCP

13

LPW R PCP

19

LPWLRRRSAPCP

30

with 1 more sequence matches

11.5%

NZ_CP119804.1:

Lanthipeptides: allorf_0778740_0778847_lanthipeptide

14

FTVHPSDRRDCPQ

26

F + DRR+CP+

4

FEIFDPDRRNCPK

16

MIBiG 4.0 matches for allorf_2154999_2155214

7.7%

BGC0000503.5 (cinA):

Lanthipeptide: cinnamycin

24

CPQECSV

30

C Q CS

1

CRQSCSF

7

allorf_2155695_2155844

Leader:

MVSAERRTATGT

Core:

AAPTGARYGPAATRPLTPPHPGSSPRCSRTREDRASP

Core with dehydrations:

AAPDhbGARYGPAADhbRPLDhbPPHPGDhaDhaPRCysDhaRDhbREDRADhaP

antiSMASH-DB 4.0 matches for allorf_2155695_2155844

100.0%

NZ_JAHTIK010000001.1:

Lanthipeptides: allorf_2155695_2155844_lanthipeptide

1

AAPTGARYGPAATRPLTPPHPGSSPRCSRTREDRASP

37

AAPTGARYGPAATRPLTPPHPGSSPRCSRTREDRASP

1

AAPTGARYGPAATRPLTPPHPGSSPRCSRTREDRASP

37

24.3%

NZ_BNCA01000011.1and 1 other:

NZ_BNCA01000011.1 Lanthipeptides: allorf_157107_157286_lanthipeptide

Lanthipeptides: allorf_157107_157286_lanthipeptide

25

PRCSRTREDRASP

37

PRC REDR SP

1

PRCRADREDRRSP

13

21.6%

NZ_KB900614.1:

Lanthipeptides: allorf_2956655_2956819_lanthipeptide

3

PTGARYGPAATRPL

16

P A PAATRP+

4

PVAAARNPAATRPI

17

with 3 more sequence matches

20.5%

NZ_CP045729.1:

Lanthipeptides: allorf_1568662_1568871_lanthipeptide

11

AATRPLTPPHPGSSPRCSR

29

A T PL P SS RC++

11

AQTSPLIPISKASSVRCAK

29

16.9%

NZ_CP010407.1and 2 others:

NZ_CP010407.1 Lanthipeptides: allorf_8464855_8465094_lanthipeptideNZ_CP010407.1 Lanthipeptides: allorf_8464855_8465094_lanthipeptide

Lanthipeptides: allorf_8464855_8465094_lanthipeptide

4

TGARYGPAATRPLTPPHPGSSP

25

TG R G RP+ PHPG P

17

TGQRPGVRPVRPVHRPHPGRVP

38

12.5%

NZ_AP018172.1:

Lanthipeptides: allorf_1980623_1980829_lanthipeptide

22

GSSPRCSRTRE

32

G SPRCS R+

29

GGSPRCSNCRQ

39

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

Additional weak hits (2):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.19 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.37 out of 29.65

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Lanthipeptides

RREFinder

TFBS Finder

Azole RiPPs

Core peptide predictions

KSNIM_RS10085 - Class II

Cleavage pHMM score: 5.00

RODEO score: 0

Monoisotopic mass: 2609.3 Da

Molecular weight: 2610.8 Da

Number of bridges: 2

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 2628.8 Da N = 1; 2646.9 Da N = 2; 2664.9 Da N = 3; 2682.9 Da N = 4; 2700.9 Da N = 5; 2718.9 Da N = 6; 2737.0 Da N = 7; 2755.0 Da N = 8

allorf_2154987_2155154 - Class II

Cleavage pHMM score: -6.30

RODEO score: 0

Monoisotopic mass: 2426.3 Da

Molecular weight: 2427.8 Da

Number of bridges: 1

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 2445.8 Da N = 1

allorf_2154999_2155214 - Class II

Cleavage pHMM score: -4.90

RODEO score: 0

Monoisotopic mass: 5626.8 Da

Molecular weight: 5630.4 Da

Number of bridges: 4

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 5648.4 Da N = 1

allorf_2155695_2155844 - Class II

Cleavage pHMM score: -6.50

RODEO score: 0

Monoisotopic mass: 3712.9 Da

Molecular weight: 3715.1 Da

Number of bridges: 1

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 3733.1 Da N = 1; 3751.1 Da N = 2; 3769.1 Da N = 3; 3787.1 Da N = 4; 3805.2 Da N = 5; 3823.2 Da N = 6; 3841.2 Da N = 7

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 4 - 101; Score: 71.0; RRE type: NHLP_CD_RRE; Location: 5 - 96; Score: 64.0; RRE type: Cyanobactin_D_RRE; Location: 3 - 81; Score: 58.8
: RRE type: Goadsporin_CD_RRE; Location: 4 - 101; Score: 71.0; RRE type: NHLP_CD_RRE; Location: 5 - 96; Score: 64.0; RRE type: Cyanobactin_D_RRE; Location: 3 - 81; Score: 58.8

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
RpoN	Regulator of nitrogen assimilation and virulence

Core peptide predictions

No core peptides found.

NZ_JAHTIK010000001.1 - Region 13 - thioamitides

Download region GenBank file

Download region SVG

Location: 2,313,041 - 2,335,493 nt. (total: 22,453 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.56	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002560.3	0.45	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001226.4	0.45	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.45	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002701.2	0.44	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0001802.5	0.43	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0001696.5	0.43	ribosomal	neothioviridamide	Streptomyces sp.
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000571.3	0.41	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002128.3	0.41	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.56	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002560.3	0.45	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001226.4	0.45	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.45	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002701.2	0.44	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0001802.5	0.43	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0001696.5	0.43	ribosomal	neothioviridamide	Streptomyces sp.
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000571.3	0.41	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002128.3	0.41	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.32 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 25.75

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.21 out of 30.97

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.60 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_JAHTIK010000001.1 - Region 14 - RiPP-like

Download region GenBank file

Download region SVG

Location: 2,679,965 - 2,690,816 nt. (total: 10,852 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KSNIM_RS12460: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002788.2	0.24	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0000241.5	0.19	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.19	PKS	nenestatin	Micromonospora echinospora

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002788.2	0.24	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0000241.5	0.19	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.19	PKS	nenestatin	Micromonospora echinospora

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_JAHTIK010000001.1 - Region 15 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 2,865,383 - 2,895,152 nt. (total: 29,770 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.63	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001478.5	0.54	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.52	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001572.3	0.51	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002305.2	0.50	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0002692.2	0.47	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002464.3	0.46	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0001453.5	0.45	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.45	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002620.2	0.45	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.63	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001478.5	0.54	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.52	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001572.3	0.51	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002305.2	0.50	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0002692.2	0.47	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002464.3	0.46	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0001453.5	0.45	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.45	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002620.2	0.45	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 19.13 out of 20.01

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.09 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (9):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.69 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.69 out of 31.73

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.75 out of 27.18

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.59 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.32 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.57 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAHTIK010000001.1 - Region 16 - butyrolactone

Download region GenBank file

Download region SVG

Location: 4,275,869 - 4,286,891 nt. (total: 11,023 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KSNIM_RS19430: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

Transferases: aminotransferase

KSNIM_RS19465: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: ligase

KSNIM_RS19420: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.58	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.54	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001485.4	0.41	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001896.4	0.41	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0000925.5	0.39	other (other)	quinolobactin	Pseudomonas fluorescens
BGC0002578.2	0.38	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002554.2	0.38	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0001903.3	0.37	other (other)	neocarazostatin A	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.58	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.54	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001485.4	0.41	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001896.4	0.41	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0000925.5	0.39	other (other)	quinolobactin	Pseudomonas fluorescens
BGC0002578.2	0.38	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002554.2	0.38	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0001903.3	0.37	other (other)	neocarazostatin A	Streptomyces sp. MA37

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.20 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.08 out of 24.78

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

Additional weak hits (7):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.51 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.58 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.93 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.82 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.60 out of 29.65

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.22 out of 39.62

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.35 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAHTIK010000001.1 - Region 17 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 4,535,682 - 4,565,469 nt. (total: 29,788 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

KSNIM_RS20745: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

KSNIM_RS20790: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Lyases: decarboxylase

KSNIM_RS20750: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002305.2	0.84	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000940.5	0.75	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.74	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002690.2	0.61	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002073.3	0.60	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001870.3	0.55	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002305.2	0.84	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000940.5	0.75	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.74	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002690.2	0.61	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002073.3	0.60	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001870.3	0.55	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.03 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

Additional weak hits (1):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.04 out of 39.62

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_JAHTIK010000001.1 - Region 18 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 4,631,526 - 4,652,575 nt. (total: 21,050 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: transferase

KSNIM_RS21125: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase

KSNIM_RS21180: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

KSNIM_RS21175: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0001077.4	0.43	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002362.3	0.40	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001075.5	0.40	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0002313.3	0.40	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001864.3	0.39	ribosomal	listeriocytocin	Listeria monocytogenes SLCC2540

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0001077.4	0.43	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002362.3	0.40	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001075.5	0.40	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0002313.3	0.40	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001864.3	0.39	ribosomal	listeriocytocin	Listeria monocytogenes SLCC2540

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

KSNIM_RS21175: PT_FPPS_like

Domain 1 (61 - 348): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (10):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.40 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.85 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.51 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.00 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.49 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.74 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.94 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.46 out of 29.65

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.04 out of 39.62

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_JAHTIK010000001.1 - Region 19 - T1PKS,hglE-KS,terpene

Download region GenBank file

Download region SVG

Location: 4,781,919 - 4,841,833 nt. (total: 59,915 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KSNIM_RS21885: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

KSNIM_RS22015: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

KSNIM_RS22020: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase acylase aminotransferase

KSNIM_RS22010: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

KSNIM_RS22030: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

KSNIM_RS22065: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: synthase

KSNIM_RS21995: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

KSNIM_RS22000: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000863.3	0.59	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0002191.2	0.55	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.53	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.52	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.51	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002192.3	0.50	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.50	PKS	ACT-Toxin II	Alternaria alternata
BGC0000861.5	0.49	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0002648.2	0.49	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0001160.5	0.49	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000863.3	0.63	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0002191.2	0.61	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0000861.5	0.58	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0002648.2	0.58	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

KSNIM_RS21875: PT_phytoene_like

Domain 1 (34 - 282): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

Additional weak hits (13):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.18 out of 26.85

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.99 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.62 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.07 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.17 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.49 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.19 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.14 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.23 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.26 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 28, location 4781918 - 4841833:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 30, location 4787971 - >4836864:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 31, location 4796878 - 4841833:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KSNIM_RS21995: mal

PKS_AT (576..873): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 91.1
Methoxymalonyl-CoA: 45.3
Methylmalonyl-CoA: 36.9
inactive: 33.8
Isobutyryl-CoA: 17.9
Propionyl-CoA: 16.9
2-Methylbutyryl-CoA: 14.6
CHC-CoA: 13.4
fatty_acid: 7.8
Ethylmalonyl-CoA: 7.3
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

KSNIM_RS22005: pk

PKS_AT (253..570): pk

ATSignature: (unknown)

No matches above 50%

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_JAHTIK010000001.1 - Region 20 - HR-T2PKS,T2PKS,aminocoumarin

Download region GenBank file

Download region SVG

Location: 5,779,351 - 5,851,830 nt. (total: 72,480 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
aminocoumarin: (novK or novJ or novI or novH or SpcDK_cou)
HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

KSNIM_RS26370: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KSNIM_RS26380: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KSNIM_RS26390: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

KSNIM_RS26405: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KSNIM_RS26420: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

KSNIM_RS26455: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KSNIM_RS26460: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

KSNIM_RS26470: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KSNIM_RS26495: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

KSNIM_RS26520: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

KSNIM_RS26535: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: PPTase glycosyltransferase halogenase transferase

KSNIM_RS26410: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

KSNIM_RS26440: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

KSNIM_RS26445: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

KSNIM_RS26530: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

KSNIM_RS26575: flavin-dependent cycline orsellinic halogenase

halogenases: flavin-dependent cycline orsellinic halogenase
smcogs: SMCOG1119: halogenase

Hydrolases: esterase hydrolase

KSNIM_RS26430: thioesterase

smcogs: SMCOG1004: thioesterase

KSNIM_RS26605: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: cyclase dehydratase

KSNIM_RS26465: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

KSNIM_RS26490: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

KSNIM_RS26525: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: mutase

KSNIM_RS26340: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

KSNIM_RS26395: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KSNIM_RS26400: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KSNIM_RS26480: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

KSNIM_RS26485: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

KSNIM_RS26515: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

KSNIM_RS26540: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	1.32	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001723.5	1.12	PKS	oviedomycin	Streptomyces antibioticus
BGC0000234.5	1.09	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002341.2	0.93	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.92	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0000270.5	0.73	PKS	simocyclinone D8	Streptomyces antibioticus
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002047.2	0.71	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0000253.4	0.70	PKS	oviedomycin	Streptomyces antibioticus
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.83	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001723.5	0.77	PKS	oviedomycin	Streptomyces antibioticus
BGC0000234.5	0.77	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002341.2	0.76	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.76	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.22 out of 18.57

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.35 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.48 out of 23.79

Confidence: medium

Additional weak hits (15):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.88 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.22 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.99 out of 26.33

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.99 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.50 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 19.26

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.27 out of 30.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.62 out of 26.12

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.33 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.80 out of 21.55

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.37 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Type II PKS

TFBS Finder

Predicted core structure(s)

For candidate cluster 32, location 5779350 - 5851830:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KSNIM_RS26395: Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (435..830): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAKAFDAFLTEAVLVLAGEINAYGPTEATVCATM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (76% 8Å match); Tyr DASTVAAVCK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

KSNIM_RS26400: X

AMP-binding (17..415): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AATS--GFAADDVLFYTGLMQVYGTIETNMISWL
Nearest Stachelhaus code(s):: Pro DIAVITVLIK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 5779350 to 5851830
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 8|9 (Score: 707.8; E-value: 7.6e-216)
Product class(es):: angucycline
Product molecular weight(s):: acetyl-CoA_8: 593 Da
acetyl-CoA_9: 635 Da

KSNIM_RS26370: KR (Score: 207.5; E-value: 6.4e-64)
KSNIM_RS26380: KR (Score: 224.1; E-value: 5.6e-69)
KSNIM_RS26405: KR (Score: 92.1; E-value: 1.1e-28)
KSNIM_RS26450: KR (Score: 41.7; E-value: 2.5e-13)
KSNIM_RS26455: KR C15 (Score: 484.0; E-value: 2.2e-148)
KSNIM_RS26460: OXY (Score: 598.0; E-value: 3.3e-182)
KSNIM_RS26465: CYC C7-C12 (Score: 479.1; E-value: 1.1e-146)
KSNIM_RS26470: KR C9 (Score: 484.7; E-value: 1.4e-148)
KSNIM_RS26475: ACP (Score: 134.1; E-value: 3e-42)
KSNIM_RS26480: CLF 8|9 (Score: 707.8; E-value: 7.6e-216)
KSNIM_RS26485: KS (Score: 783.2; E-value: 1.3e-238)
KSNIM_RS26490: CYC C4-C17/C2-C19 (Score: 193.6; E-value: 7.4e-60)
KSNIM_RS26495: OXY (Score: 608.1; E-value: 2.9e-185)
KSNIM_RS26530: GT (Score: 387.7; E-value: 1.9e-118)
KSNIM_RS26535: KR (Score: 166.9; E-value: 1.6e-51)
KSNIM_RS26575: HAL (Score: 382.1; E-value: 8e-117)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis

NZ_JAHTIK010000001.1 - Region 21 - terpene

Download region GenBank file

Download region SVG

Location: 5,902,851 - 5,925,130 nt. (total: 22,280 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

KSNIM_RS26880: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KSNIM_RS26935: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: esterase hydrolase

KSNIM_RS26885: putative esterase

smcogs: SMCOG1104: putative esterase

KSNIM_RS26905: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase

KSNIM_RS26915: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.74	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000658.3	0.57	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002707.2	0.48	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000631.5	0.44	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0002482.2	0.43	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0001605.3	0.43	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000671.3	0.42	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002246.3	0.42	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.74	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000658.3	0.57	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002707.2	0.48	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000631.5	0.44	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0002482.2	0.43	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0001605.3	0.43	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000671.3	0.42	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002246.3	0.42	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

KSNIM_RS26915: T1TS + T1TS

Domain 1 (1 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (327 - 701): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.13 out of 30.11

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.54 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.66 out of 30.11

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.19 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (5):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.89 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.69 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.71 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.51 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism

NZ_JAHTIK010000001.1 - Region 22 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 5,997,654 - 6,018,778 nt. (total: 21,125 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

KSNIM_RS27365: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

KSNIM_RS27370: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

KSNIM_RS27400: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: phosphorylase

KSNIM_RS27380: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

Ligases: synthetase

KSNIM_RS27385: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.44	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.41	terpene	carotenoid	Myxococcus xanthus
BGC0002561.3	0.40	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.44	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.41	terpene	carotenoid	Myxococcus xanthus
BGC0002561.3	0.40	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

KSNIM_RS27385: PT_FPPS_like

Domain 1 (52 - 373): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.44 out of 23.79

Confidence: medium

Additional weak hits (9):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.75 out of 29.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.66 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.18 out of 27.55

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.07 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.41 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.08 out of 36.53

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

NZ_JAHTIK010000001.1 - Region 23 - melanin

Download region GenBank file

Download region SVG

Location: 6,273,156 - 6,283,548 nt. (total: 10,393 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.79	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.61	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.57	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.39	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.38	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000662.5	0.37	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001592.5	0.37	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.31	other (other)	iso-A82775C	Pestalotiopsis fici

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.79	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.61	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.57	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.39	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.38	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000662.5	0.37	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001592.5	0.37	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.31	other (other)	iso-A82775C	Pestalotiopsis fici

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 25.31

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (5):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.37 out of 29.51

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.70 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.58 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.68 out of 20.97

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CatR	H2O2-responsive repressor

NZ_JAHTIK010000001.1 - Region 24 - T3PKS,terpene

Download region GenBank file

Download region SVG

Location: 6,419,213 - 6,485,494 nt. (total: 66,282 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

KSNIM_RS29220: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KSNIM_RS29225: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KSNIM_RS29230: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

KSNIM_RS29245: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

KSNIM_RS29250: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

KSNIM_RS29255: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

KSNIM_RS29290: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

KSNIM_RS29310: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

KSNIM_RS29370: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

KSNIM_RS29385: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

KSNIM_RS29430: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

KSNIM_RS29465: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

KSNIM_RS29525: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acyltransferase aminotransferase methyltransferase transferase

KSNIM_RS29295: Methylation

MITE: MITE0000155Methylation (identity: 71.30%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

KSNIM_RS29355: acyltransferase

smcogs: SMCOG1141: acyltransferase

KSNIM_RS29425: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

KSNIM_RS29495: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: dehydratase

KSNIM_RS29500: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase synthetase

KSNIM_RS29300: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

KSNIM_RS29470: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

KSNIM_RS29490: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Translocases: permease

KSNIM_RS29265: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

KSNIM_RS29325: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.56	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.44	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000663.5	0.38	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002218.2	0.26	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0001156.5	0.26	terpene	platencin	Streptomyces platensis
BGC0002246.3	0.25	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0001987.2	0.25	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0001850.4	0.25	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001928.2	0.24	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000678.5	0.24	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.82	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000663.5	0.70	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001361.3	0.54	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.54	terpene	sodorifen	Serratia plymuthica
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001077.4	0.52	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

KSNIM_RS29455: PT_phytoene_like

Domain 1 (21 - 298): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

KSNIM_RS29460: PT_phytoene_like

Domain 1 (2 - 279): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

KSNIM_RS29470: PT_FPPS_like

Domain 1 (36 - 329): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

KSNIM_RS29475: T2TS

Domain 1 (7 - 626): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.03 out of 36.53

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.07 out of 30.12

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.28 out of 20.01

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 25.31

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.87 out of 23.79

Confidence: medium

Additional weak hits (32):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.39 out of 21.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.30 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.17 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.39 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.35 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.43 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.01 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.14 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.07 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.29 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.14 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.06 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.81 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.55 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.09 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.71 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.34 out of 26.12

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.31 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.77 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.47 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.02 out of 36.53

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.74 out of 32.74

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.93 out of 27.04

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.89 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.45 out of 23.43

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
ArgR	Regulator of arginine biosynthesis genes
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAHTIK010000001.1 - Region 25 - terpene

Download region GenBank file

Download region SVG

Location: 6,498,645 - 6,519,595 nt. (total: 20,951 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucosidase hydrolase

KSNIM_RS29625: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

KSNIM_RS29670: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Lyases: cyclase

KSNIM_RS29640: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Translocases: transporter

KSNIM_RS29655: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000683.3	0.78	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002285.2	0.54	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000804.5	0.38	saccharide	acarviostatin I03, acarviostatin II03, acarviostatin III03, acarviostatin IV03	Streptomyces coelicoflavus ZG0656
BGC0001510.5	0.35	other (other)	anisomycin	Streptomyces hygrospinosus
BGC0001137.5	0.35	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0000709.5	0.34	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0000711.5	0.34	saccharide	neomycin	Streptomyces fradiae
BGC0001972.4	0.33	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000495.5	0.32	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0001011.5	0.28	NRPS, PKS	meridamycin	Streptomyces sp. NRRL 30748

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000683.3	0.78	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002285.2	0.54	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000804.5	0.38	saccharide	acarviostatin I03, acarviostatin II03, acarviostatin III03, acarviostatin IV03	Streptomyces coelicoflavus ZG0656
BGC0001510.5	0.35	other (other)	anisomycin	Streptomyces hygrospinosus
BGC0001137.5	0.35	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0000709.5	0.34	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0000711.5	0.34	saccharide	neomycin	Streptomyces fradiae
BGC0001972.4	0.33	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000495.5	0.32	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0001011.5	0.28	NRPS, PKS	meridamycin	Streptomyces sp. NRRL 30748

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

KSNIM_RS29640: T1TS

Domain 1 (5 - 313): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.34 out of 27.04

Confidence: medium

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NZ_JAHTIK010000001.1 - Region 26 - NRPS

Download region GenBank file

Download region SVG

Location: 6,988,841 - 7,051,071 nt. (total: 62,231 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: phosphate reductase

KSNIM_RS31850: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

Transferases: aminotransferase kinase methyltransferase sulfotransferase transketolase

KSNIM_RS31795: methyltransferase

smcogs: SMCOG1248: methyltransferase

KSNIM_RS31810: Sulfotransferase domain

extras: Sulfotransfer_5: Sulfotransferase domain

KSNIM_RS31825: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

KSNIM_RS31830: transketolase

smcogs: SMCOG1204: transketolase

KSNIM_RS31855: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

Hydrolases: deacetylase hydrolase

KSNIM_RS31725: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

KSNIM_RS31750: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

KSNIM_RS31860: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

KSNIM_RS31880: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

KSNIM_RS31935: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Ligases: ligase synthase

KSNIM_RS31790: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KSNIM_RS31800: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KSNIM_RS31835: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

KSNIM_RS31865: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.71	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.71	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.54 out of 18.46

Confidence: medium

Additional weak hits (19):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.45 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.12 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.90 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.96 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.79 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.87 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.57 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.45 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.75 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.16 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.39 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.49 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.98 out of 20.01

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.87 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.39 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 42, location 6988840 - 7051071:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Leu) + (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KSNIM_RS31790: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (500..895): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: HWLTFDVSLWEVHFLCSGEDNLYGPTEAAVHVTR
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

KSNIM_RS31800: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (512..922): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDAAVWEPFLLTGGEVNHYGPTENAVVATE
Nearest Stachelhaus code(s):: Leu DAWFLGHVVK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

KSNIM_RS31865: X

AMP-binding (499..896): X

nrpys: dn-dohHep

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FSVAFDVSVFEADLFVGGEFNGYGPTECTVTMIV
Nearest Stachelhaus code(s):: dn-dohHep DVFDFGGVTK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JAHTIK010000001.1 - Region 27 - terpene

Download region GenBank file

Download region SVG

Location: 7,494,010 - 7,515,326 nt. (total: 21,317 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

KSNIM_RS34075: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

KSNIM_RS34080: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.86	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000583.5	0.41	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002698.2	0.39	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002319.3	0.39	ribosomal	salinipeptin A, salinipeptin B, salinipeptin C, salinipeptin D	Streptomyces sp.
BGC0000582.4	0.39	ribosomal	cypemycin	Streptomyces sp. OH-4156
BGC0000520.5	0.37	ribosomal	lacticin 3147 A1, lacticin 3147 A2	Lactococcus lactis
BGC0001229.4	0.36	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.86	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000583.5	0.41	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002698.2	0.39	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002319.3	0.39	ribosomal	salinipeptin A, salinipeptin B, salinipeptin C, salinipeptin D	Streptomyces sp.
BGC0000582.4	0.39	ribosomal	cypemycin	Streptomyces sp. OH-4156
BGC0000520.5	0.37	ribosomal	lacticin 3147 A1, lacticin 3147 A2	Lactococcus lactis
BGC0001229.4	0.36	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

KSNIM_RS34080: T1TS

Domain 1 (60 - 432): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (7):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.60 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.51 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.18 out of 20.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.27 out of 30.12

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.33 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.15 out of 27.04

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAHTIK010000001.1 - Region 28 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 7,863,716 - 7,905,800 nt. (total: 42,085 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KSNIM_RS36145: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Lyases: dehydratase

KSNIM_RS36090: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

KSNIM_RS36110: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Translocases: transporter

KSNIM_RS36155: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001146.5	0.59	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001145.5	0.57	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000603.5	0.55	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0001640.3	0.52	ribosomal	kocurin	Kocuria rosea
BGC0000605.5	0.52	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0001753.3	0.50	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000606.5	0.50	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0000615.4	0.50	ribosomal	TP-1161	Nocardiopsis sp. TFS65-07
BGC0001860.4	0.49	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000613.5	0.48	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001146.5	0.59	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001145.5	0.57	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000603.5	0.55	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0001640.3	0.52	ribosomal	kocurin	Kocuria rosea
BGC0000605.5	0.52	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0001753.3	0.50	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000606.5	0.50	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0000615.4	0.50	ribosomal	TP-1161	Nocardiopsis sp. TFS65-07
BGC0001860.4	0.49	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000613.5	0.48	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.21 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.54 out of 23.79

Confidence: medium

Additional weak hits (11):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.89 out of 20.01

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.27 out of 30.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.67 out of 25.75

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.59 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.12 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.34 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.19 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.28 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 8 - 88; Score: 64.1; RRE type: Heterocycloanthracin_C_RRE; Location: 13 - 98; Score: 49.8

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_JAHTIK010000001.1 - Region 29 - NAPAA

Download region GenBank file

Download region SVG

Location: 8,127,479 - 8,161,558 nt. (total: 34,080 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KSNIM_RS37290: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

Transferases: glycosyltransferase

KSNIM_RS37285: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

KSNIM_RS37295: sugar transferase

smcogs: SMCOG1146: sugar transferase

Hydrolases: protease

KSNIM_RS37355: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: ligase

KSNIM_RS37320: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.29 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.74 out of 23.79

Confidence: medium

Additional weak hits (13):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.08 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.54 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.28 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.98 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.54 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.73 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.02 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.48 out of 24.78

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 25.75

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.75 out of 39.62

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 45, location 8127478 - 8161558:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KSNIM_RS37320: X

AMP-binding (41..416): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIVGGEWNTYGPTETTVVATA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism