GCF_025516705.1 - 11 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JAOPQQ010000013.1 (Bacillus tropicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	RiPP-like	1	9,482
Region 4.2	RiPP-like	56,777	67,043

NZ_JAOPQQ010000016.1 (Bacillus tropicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	NRPS	5,091	53,948

NZ_JAOPQQ010000001.1 (Bacillus tropicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	terpene-precursor	517,833	538,723
Region 11.2	terpene	1,180,358	1,202,211	Low	molybdenum cofactor	other:other

NZ_JAOPQQ010000020.1 (Bacillus tropicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	lanthipeptide-class-ii	1	16,806
Region 12.2	lanthipeptide-class-ii	22,970	36,236	Low	haloduracin β/haloduracin α	ribosomal:RiPP:Lanthipeptide

NZ_JAOPQQ010000002.1 (Bacillus tropicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 22.1	azole-containing-RiPP	174,894	198,400

NZ_JAOPQQ010000005.1 (Bacillus tropicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 38.1	NI-siderophore	109,200	140,867	High	petrobactin	other:other

NZ_JAOPQQ010000006.1 (Bacillus tropicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 39.1	betalactone	48,291	73,529	Low	fengycin	NRPS:Type I
Region 39.2	t3nrps-iterative,NRP-metallophore,NRPS	207,162	261,959	High	bacillibactin	NRPS:Type I

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	RiPP-like	1	9,482
Region 4.2	RiPP-like	56,777	67,043
Region 7.1	NRPS	5,091	53,948
Region 11.1	terpene-precursor	517,833	538,723
Region 11.2	terpene	1,180,358	1,202,211	Low	molybdenum cofactor	other:other
Region 12.1	lanthipeptide-class-ii	1	16,806
Region 12.2	lanthipeptide-class-ii	22,970	36,236	Low	haloduracin β/haloduracin α	ribosomal:RiPP:Lanthipeptide
Region 22.1	azole-containing-RiPP	174,894	198,400
Region 38.1	NI-siderophore	109,200	140,867	High	petrobactin	other:other
Region 39.1	betalactone	48,291	73,529	Low	fengycin	NRPS:Type I
Region 39.2	t3nrps-iterative,NRP-metallophore,NRPS	207,162	261,959	High	bacillibactin	NRPS:Type I

No secondary metabolite regions were found in these records:: NZ_JAOPQQ010000010.1 (Bacillus tropicus); NZ_JAOPQQ010000011.1 (Bacillus tropicus); NZ_JAOPQQ010000012.1 (Bacillus tropicus); NZ_JAOPQQ010000014.1 (Bacillus tropicus); NZ_JAOPQQ010000015.1 (Bacillus tropicus); NZ_JAOPQQ010000017.1 (Bacillus tropicus); NZ_JAOPQQ010000018.1 (Bacillus tropicus); NZ_JAOPQQ010000019.1 (Bacillus tropicus); NZ_JAOPQQ010000021.1 (Bacillus tropicus); NZ_JAOPQQ010000022.1 (Bacillus tropicus); NZ_JAOPQQ010000023.1 (Bacillus tropicus); NZ_JAOPQQ010000024.1 (Bacillus tropicus); NZ_JAOPQQ010000025.1 (Bacillus tropicus); NZ_JAOPQQ010000026.1 (Bacillus tropicus); NZ_JAOPQQ010000027.1 (Bacillus tropicus); NZ_JAOPQQ010000028.1 (Bacillus tropicus); NZ_JAOPQQ010000029.1 (Bacillus tropicus); NZ_JAOPQQ010000030.1 (Bacillus tropicus); NZ_JAOPQQ010000031.1 (Bacillus tropicus); NZ_JAOPQQ010000032.1 (Bacillus tropicus); NZ_JAOPQQ010000033.1 (Bacillus tropicus); NZ_JAOPQQ010000034.1 (Bacillus tropicus); NZ_JAOPQQ010000035.1 (Bacillus tropicus); NZ_JAOPQQ010000036.1 (Bacillus tropicus); NZ_JAOPQQ010000037.1 (Bacillus tropicus); NZ_JAOPQQ010000038.1 (Bacillus tropicus); NZ_JAOPQQ010000039.1 (Bacillus tropicus); NZ_JAOPQQ010000003.1 (Bacillus tropicus); NZ_JAOPQQ010000040.1 (Bacillus tropicus); NZ_JAOPQQ010000041.1 (Bacillus tropicus); NZ_JAOPQQ010000042.1 (Bacillus tropicus); NZ_JAOPQQ010000004.1 (Bacillus tropicus); NZ_JAOPQQ010000007.1 (Bacillus tropicus); NZ_JAOPQQ010000008.1 (Bacillus tropicus); NZ_JAOPQQ010000009.1 (Bacillus tropicus)

Compact view

NZ_JAOPQQ010000013.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1 - 9,482 nt. (total: 9,482 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

OCD70_RS24575: aminotransferase

smcogs: SMCOG1019: aminotransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000721.4	0.27	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000172.5	0.23	PKS	Basiliskamide A, Basiliskamide B	Brevibacillus laterosporus PE36
BGC0000381.5	0.23	NRPS	lichenysin	Bacillus licheniformis DSM 13 = ATCC 14580
BGC0000433.5	0.22	NRPS	surfactin	Bacillus velezensis FZB42
BGC0000455.6	0.22	NRPS, saccharide	vancomycin	Amycolatopsis orientalis HCCB10007 (ATCC43491)
BGC0002588.2	0.22	other (other)	enduracididine	uncultured bacterium
BGC0001233.5	0.22	NRPS	feglymycin	Streptomyces sp. DSM 11171
BGC0001461.5	0.22	NRPS	Actinoidin B	Amycolatopsis keratiniphila subsp. nogabecina
BGC0001459.5	0.22	NRPS	decaplanin	Amycolatopsis regifaucium
BGC0001460.5	0.21	NRPS	decaplanin	Amycolatopsis decaplanina DSM 44594

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000721.4	0.27	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000172.5	0.23	PKS	Basiliskamide A, Basiliskamide B	Brevibacillus laterosporus PE36
BGC0000381.5	0.23	NRPS	lichenysin	Bacillus licheniformis DSM 13 = ATCC 14580
BGC0000433.5	0.22	NRPS	surfactin	Bacillus velezensis FZB42
BGC0000455.6	0.22	NRPS, saccharide	vancomycin	Amycolatopsis orientalis HCCB10007 (ATCC43491)
BGC0002588.2	0.22	other (other)	enduracididine	uncultured bacterium
BGC0001233.5	0.22	NRPS	feglymycin	Streptomyces sp. DSM 11171
BGC0001461.5	0.22	NRPS	Actinoidin B	Amycolatopsis keratiniphila subsp. nogabecina
BGC0001459.5	0.22	NRPS	decaplanin	Amycolatopsis regifaucium
BGC0001460.5	0.21	NRPS	decaplanin	Amycolatopsis decaplanina DSM 44594

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.26 out of 26.06

Confidence: strong

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.87 out of 32.93

Confidence: medium

TFBS Finder

TFBS definitions

Regulator	Description
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes

NZ_JAOPQQ010000013.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 56,777 - 67,043 nt. (total: 10,267 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

OCD70_RS24895: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	RiPP-like	Similarity score	Type	Compound(s)	Organism
BGC0001994.4		0.35	other (other)	β-ethynylserine	Streptomyces cattleya NRRL 8057 = DSM 46488

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0001994.4		0.35	other (other)	β-ethynylserine	Streptomyces cattleya NRRL 8057 = DSM 46488

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

NZ_JAOPQQ010000016.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 5,091 - 53,948 nt. (total: 48,858 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase

OCD70_RS25985: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase

OCD70_RS25980: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

OCD70_RS25990: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

OCD70_RS25995: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

OCD70_RS26000: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 23.19 out of 29.25

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.81 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 15.13 out of 18.16

Confidence: strong

Additional weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.30 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.98 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 20.02 out of 30.22

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 20.52 out of 29.51

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.71 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 5090 - 53948:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Thr) + (X - Ala) + (Ser - Leu - D-X - Glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

OCD70_RS25990: Ser - Leu - X - Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (473..878): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFTSGEINLYGPTEATVDVTY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1535..1922): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: MWHAFDSAVQEPFAITGGDINQYGPSENTVVTTD
Nearest Stachelhaus code(s):: Pro DVQFIAQVVK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2577..2977): X

nrpys: Gln, Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDASIQQMDILVGGEYNVYGPTECTVDATC
Nearest Stachelhaus code(s):: Gln or Glu DAQDLGVVDK (88% 8Å match); Ile DAQDLGVVDK (85% 8Å match); Gln DAQDLGVVDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4092..4492): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDVSIQQMDILVGGEYNVYGPTECTVDATC
Nearest Stachelhaus code(s):: Gln or Glu DAQDLGVVDK (85% 8Å match); Ile DAQDLGVVDK (82% 8Å match); Gln DAQDLGVVDK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

OCD70_RS25995: X - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (466..870): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWMTFDVSVWEWQFFSGGETNFYGPTEATIYVNA
Nearest Stachelhaus code(s):: Glu DVWHFGRINK (71% 8Å match); Gln DAWQFGLIDK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1527..1919): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: MWATFDLSVFEVNTNLAGEYNLYGPSEDTTYSTY
Nearest Stachelhaus code(s):: Ala DLFNNALTYK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

OCD70_RS26000: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (457..866): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
SypG	Regulator of biofilm formation and host colonization
ZuR variant 1	Zinc-responsive repressor

NZ_JAOPQQ010000001.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 517,833 - 538,723 nt. (total: 20,891 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase

OCD70_RS02865: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

OCD70_RS02895: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

OCD70_RS02900: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

OCD70_RS02895: PT_FPPS_like

Domain 1 (32 - 295): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: IPP, DMAPP → FPP

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.32 out of 25.88

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.49 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.30 out of 28.19

Confidence: medium

Additional weak hits (2):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 27.88 out of 36.54

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 25.40 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
PsrA	Oleic acid responsive regulator
ZuR variant 1	Zinc-responsive repressor

NZ_JAOPQQ010000001.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 1,180,358 - 1,202,211 nt. (total: 21,854 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

OCD70_RS06335: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

OCD70_RS06340: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Lyases: lyase

OCD70_RS06365: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000917.3	0.52	other (other)	molybdenum cofactor	Rhodobacter capsulatus
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000916.5	0.46	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000812.3	0.45	other (other)	huperzine A	Shiraia sp. slf14
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002138.2	0.40	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000917.3	0.52	other (other)	molybdenum cofactor	Rhodobacter capsulatus
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000916.5	0.46	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000812.3	0.45	other (other)	huperzine A	Shiraia sp. slf14
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002138.2	0.40	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

OCD70_RS06325: T2TS

Domain 1 (4 - 614): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Terpene

Glossary

No acronyms to display

NZ_JAOPQQ010000020.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1 - 16,806 nt. (total: 16,806 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

OCD70_RS26680: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000554.4	0.47	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001861.4	0.46	ribosomal	bacillicin BAG2O	Bacillus cereus BAG2O-1
BGC0001210.5	0.46	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001863.4	0.46	ribosomal, terpene	bacillicn CER074	Bacillus mycoides
BGC0000500.5	0.45	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000501.3	0.44	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000539.5	0.44	ribosomal	nukacin ISK-1	Staphylococcus warneri
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000517.4	0.42	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000554.4	0.47	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001861.4	0.46	ribosomal	bacillicin BAG2O	Bacillus cereus BAG2O-1
BGC0001210.5	0.46	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001863.4	0.46	ribosomal, terpene	bacillicn CER074	Bacillus mycoides
BGC0000500.5	0.45	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000501.3	0.44	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000539.5	0.44	ribosomal	nukacin ISK-1	Staphylococcus warneri
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000517.4	0.42	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for OCD70_RS26680

OCD70_RS28310

Leader:

KNVVDTPLIVTLNGILTSNINNNISMTFQAG

Core:

DCISVKITIGSSNATTDTVVQVDIFLCFIVSK

Core with dehydrations:

DCysIDhaVKIDhbIGDhaDhaNADhbDhbDDhbVVQVDIFLCysFIVDhaK

antiSMASH-DB 4.0 matches for OCD70_RS28310

18.8%

NZ_CP053021.1:

Lassopeptides: HH800_RS11690_lassopeptide

10

GSSNATTDTVVQV

22

G S DTV+Q+

1

GGSPGANDTVIQL

13

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.66 out of 23.79

Confidence: medium

Additional weak hits (2):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.88 out of 33.73

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.36 out of 32.93

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

OCD70_RS28310 - Class II

Cleavage pHMM score: -6.80

RODEO score: 0

Monoisotopic mass: 3271.8 Da

Molecular weight: 3273.8 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3291.8 Da N = 1; 3309.8 Da N = 2; 3327.8 Da N = 3; 3345.9 Da N = 4; 3363.9 Da N = 5; 3381.9 Da N = 6

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis

NZ_JAOPQQ010000020.1 - Region 2 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 22,970 - 36,236 nt. (total: 13,267 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

OCD70_RS26800: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

OCD70_RS26805: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.71	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000554.4	0.55	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000623.3	0.54	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000517.4	0.53	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000500.5	0.52	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000539.5	0.52	ribosomal	nukacin ISK-1	Staphylococcus warneri
BGC0001555.4	0.52	ribosomal	colicin V	Escherichia coli chi7122
BGC0000504.5	0.52	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000590.5	0.51	ribosomal	microcin N	Escherichia coli
BGC0002005.2	0.51	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.71	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000554.4	0.55	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000623.3	0.54	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000517.4	0.53	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000500.5	0.52	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000539.5	0.52	ribosomal	nukacin ISK-1	Staphylococcus warneri
BGC0001555.4	0.52	ribosomal	colicin V	Escherichia coli chi7122
BGC0000504.5	0.52	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000590.5	0.51	ribosomal	microcin N	Escherichia coli
BGC0002005.2	0.51	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for OCD70_RS26805

allorf_23343_23531

Leader:

MVRSYSRYNLCFRNLMKIIGE

Core:

RGLSITHTTITRRVYCPKFVSIQVKPLIISFTVWIDVIHRD

Core with dehydrations:

RGLDhaIDhbHDhbDhbIDhbRRVYCysPKFVDhaIQVKPLIIDhaFDhbVWIDVIHRD

antiSMASH-DB 4.0 matches for allorf_23343_23531

43.9%

NZ_CM000721.1:

Lanthipeptides: BCERE0010_RS29580_lanthipeptide

1

RGLSITHTTITRRVYCPK

18

RGLSITHTTITRRVYCPK

1

RGLSITHTTITRRVYCPK

18

17.1%

NZ_AP025017.1:

Lanthipeptides: allorf_1459483_1459698_lanthipeptide

1

RGLSITHTTITRRVYCP

17

RGL++T + RV C

9

RGLALTQGSARGRVNCS

25

allorf_25273_25335

Leader:

MIYNNIGLSLSIGG

Core:

RESCNI

Core with dehydrations:

REDhaCysNI

antiSMASH-DB 4.0 matches for allorf_25273_25335

100.0%

NZ_CM000721.1and 5 others:

NZ_CP015591.1 Lanthipeptides: allorf_13725_13787_lanthipeptideNZ_CP078085.1 Lanthipeptides: allorf_18236_18298_lanthipeptideNZ_JACYOF010000027.1 Lanthipeptides: allorf_10964_11026_lanthipeptideNZ_JAOPQQ010000020.1 Lanthipeptides: allorf_25273_25335_lanthipeptideNZ_QNUC01000031.1 Lanthipeptides: allorf_12454_12516_lanthipeptide

Lanthipeptides: allorf_5190336_5190398_lanthipeptide

1

RESCNI

6

RESCNI

1

RESCNI

6

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.67 out of 25.31

Confidence: medium

Additional weak hits (2):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.58 out of 31.73

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_23343_23531 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 4663.7 Da

Molecular weight: 4666.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4684.5 Da N = 1; 4702.5 Da N = 2; 4720.6 Da N = 3; 4738.6 Da N = 4; 4756.6 Da N = 5; 4774.6 Da N = 6; 4792.6 Da N = 7

allorf_25273_25335 - Class II

Cleavage pHMM score: -4.20

RODEO score: 0

Monoisotopic mass: 702.3 Da

Molecular weight: 702.8 Da

Number of bridges: 1

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_JAOPQQ010000002.1 - Region 1 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 174,894 - 198,400 nt. (total: 23,507 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

OCD70_RS07465: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: methyltransferase

OCD70_RS07480: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000607.5	0.43	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001535.3	0.43	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0000569.5	0.41	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001146.5	0.41	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001173.5	0.41	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000606.5	0.39	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001860.4	0.38	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000628.4	0.38	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03
BGC0001145.5	0.38	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000613.5	0.38	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000607.5	0.43	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001535.3	0.43	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0000569.5	0.41	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001146.5	0.41	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001173.5	0.41	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000606.5	0.39	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001860.4	0.38	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000628.4	0.38	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03
BGC0001145.5	0.38	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000613.5	0.38	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.43 out of 32.93

Confidence: medium

Additional weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.85 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 27.82 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.69 out of 39.62

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Heterocycloanthracin_C_RRE; Location: 0 - 100; Score: 181.5; RRE type: Thiopeptide_F_RRE; Location: 10 - 89; Score: 39.0

TFBS definitions

Regulator	Description
LexA variant 3	Repressor of DNA damage response

Core peptide predictions

No core peptides found.

NZ_JAOPQQ010000005.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 109,200 - 140,867 nt. (total: 31,668 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

OCD70_RS16990: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: deacetylase

OCD70_RS16925: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Ligases: ligase synthase

OCD70_RS16885: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

OCD70_RS16955: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.4	0.88	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000295.5	0.53	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0001498.5	0.48	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0002683.2	0.47	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000943.5	0.47	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002694.2	0.46	other (other)	roseobactin	Phaeobacter inhibens 2.10
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.4	0.88	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000295.5	0.53	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0001498.5	0.48	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0002683.2	0.47	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000943.5	0.47	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002694.2	0.46	other (other)	roseobactin	Phaeobacter inhibens 2.10
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.38 out of 29.38

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 23.16 out of 27.55

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.11 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.93 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 15.13 out of 18.16

Confidence: strong

Additional weak hits (4):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.58 out of 19.52

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.50 out of 32.74

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.60 out of 36.54

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
FuR variant 1	Ferric Uptake Regulator
GnfM	Regulator of nitrogen-fixation genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JAOPQQ010000006.1 - Region 1 - betalactone

Download region GenBank file

Download region SVG

Location: 48,291 - 73,529 nt. (total: 25,239 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

OCD70_RS18455: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acetyltransferase carboxylase transferase

OCD70_RS18415: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

OCD70_RS18430: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

OCD70_RS18450: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Hydrolases: hydrolase

OCD70_RS18495: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: hydratase

OCD70_RS18435: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

OCD70_RS18425: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

OCD70_RS18440: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002284.3	0.55	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000131.5	0.46	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000234.5	0.44	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000623.3	0.42	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0001103.5	0.42	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.41	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0001095.5	0.41	NRPS	fengycin	Bacillus velezensis FZB42

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002284.3	0.55	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000131.5	0.46	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000234.5	0.44	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000623.3	0.42	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0001103.5	0.42	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.41	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0001095.5	0.41	NRPS	fengycin	Bacillus velezensis FZB42

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.31 out of 18.16

Confidence: strong

Additional weak hits (2):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 25.24 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_JAOPQQ010000006.1 - Region 2 - NRP-metallophore,NRPS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 207,162 - 261,959 nt. (total: 54,798 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

OCD70_RS19225: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

OCD70_RS19305: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

OCD70_RS19360: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

OCD70_RS19365: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

OCD70_RS19370: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase

OCD70_RS19270: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: hydrolase protease

OCD70_RS19245: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

OCD70_RS19290: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: hydratase

OCD70_RS19350: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Isomerases: isomerase

OCD70_RS19300: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

OCD70_RS19220: Pseudouridine synthase

smcogs: SMCOG1154: Pseudouridine synthase

OCD70_RS19285: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

OCD70_RS19295: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001185.5	1.58	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	1.38	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0000401.5	1.33	NRPS	paenibactin	Paenibacillus elgii B69
BGC0002075.3	1.29	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	1.28	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001833.4	1.13	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	1.13	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	1.12	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	1.11	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002695.2	1.09	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001185.5	0.80	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	0.76	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0000401.5	0.75	NRPS	paenibactin	Paenibacillus elgii B69
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.74	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002695.2	0.69	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 23.27 out of 27.55

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 27.77 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.61 out of 29.38

Confidence: strong

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 25.19 out of 30.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.67 out of 26.06

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.40 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.11 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.83 out of 27.78

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.76 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.13 out of 27.78

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.71 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.53 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.75 out of 28.19

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.20 out of 32.93

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 25.31

Confidence: medium

Additional weak hits (7):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 24.87 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.54 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.67 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 25.52 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.92 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.90 out of 36.54

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.30 out of 25.88

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 207161 - 261959:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

OCD70_RS19285: Gly - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (464..864): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDISALELQALVGGESNLYGPTETTIWSTV
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1524..1937): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEINMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

OCD70_RS19295: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SVSLYPMSSPGGALQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PMPAQGVVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
FuR variant 1	Ferric Uptake Regulator
GnfM	Regulator of nitrogen-fixation genes
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor