GCF_024213565.1 - 24 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JANAVN010000010.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	proteusin	101,781	122,017
Region 1.2	lassopeptide	228,769	252,887	Low	paeninodin	ribosomal:unmodified

NZ_JANAVN010000012.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	NRPS,t3nrps-iterative,transAT-PKS,NI-siderophore	1	71,097

NZ_JANAVN010000017.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	NRPS	1	28,781
Region 8.2	NRPS	103,522	139,174	Low	tyrocidine	NRPS:Type I

NZ_JANAVN010000018.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	lanthipeptide-class-iii	110,937	129,844	Medium	paenithipeptin	ribosomal:RiPP

NZ_JANAVN010000019.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	NRPS	85,575	125,194	Low	tridecaptin	NRPS:Type I

NZ_JANAVN010000001.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	NRPS-like	352,250	395,945
Region 11.2	cyclic-lactone-autoinducer	403,386	424,029

NZ_JANAVN010000021.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	NRPS	51,244	96,663	High	fusaricidin B	NRPS:Type I+PKS

NZ_JANAVN010000023.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	NRPS	43,687	71,293

NZ_JANAVN010000026.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	NRPS,transAT-PKS	1	27,376

NZ_JANAVN010000028.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	NRPS	1	22,925

NZ_JANAVN010000029.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	NRPS	1	19,556

NZ_JANAVN010000002.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 22.1	NRPS,T1PKS	1	33,748	Low	octapeptin C4	NRPS:Type I
Region 22.2	cyclic-lactone-autoinducer	166,945	187,493

NZ_JANAVN010000033.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	NRPS	1	10,372	High	tridecaptin	NRPS:Type I

NZ_JANAVN010000034.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 27.1	NRPS	1	5,041

NZ_JANAVN010000003.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 31.1	ranthipeptide	237,463	258,866	High	freyrasin	ribosomal:RiPP

NZ_JANAVN010000004.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 32.1	terpene-precursor	1	20,440
Region 32.2	transAT-PKS,NRPS,T3PKS,PKS-like	172,133	273,858	Low	aurantinin B/aurantinin C/aurantinin D	PKS

NZ_JANAVN010000006.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 34.1	lanthipeptide-class-i	186,916	213,222	Medium	paenicidin B	ribosomal:RiPP:Lanthipeptide
Region 34.2	terpene-precursor	240,180	262,567

NZ_JANAVN010000008.1 (Paenibacillus sp. Lou8.1)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 36.1	NRPS	35,720	115,297	High	polymyxin	NRPS:Type I

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	proteusin	101,781	122,017
Region 1.2	lassopeptide	228,769	252,887	Low	paeninodin	ribosomal:unmodified
Region 3.1	NRPS,t3nrps-iterative,transAT-PKS,NI-siderophore	1	71,097
Region 8.1	NRPS	1	28,781
Region 8.2	NRPS	103,522	139,174	Low	tyrocidine	NRPS:Type I
Region 9.1	lanthipeptide-class-iii	110,937	129,844	Medium	paenithipeptin	ribosomal:RiPP
Region 10.1	NRPS	85,575	125,194	Low	tridecaptin	NRPS:Type I
Region 11.1	NRPS-like	352,250	395,945
Region 11.2	cyclic-lactone-autoinducer	403,386	424,029
Region 13.1	NRPS	51,244	96,663	High	fusaricidin B	NRPS:Type I+PKS
Region 15.1	NRPS	43,687	71,293
Region 18.1	NRPS,transAT-PKS	1	27,376
Region 20.1	NRPS	1	22,925
Region 21.1	NRPS	1	19,556
Region 22.1	NRPS,T1PKS	1	33,748	Low	octapeptin C4	NRPS:Type I
Region 22.2	cyclic-lactone-autoinducer	166,945	187,493
Region 26.1	NRPS	1	10,372	High	tridecaptin	NRPS:Type I
Region 27.1	NRPS	1	5,041
Region 31.1	ranthipeptide	237,463	258,866	High	freyrasin	ribosomal:RiPP
Region 32.1	terpene-precursor	1	20,440
Region 32.2	transAT-PKS,NRPS,T3PKS,PKS-like	172,133	273,858	Low	aurantinin B/aurantinin C/aurantinin D	PKS
Region 34.1	lanthipeptide-class-i	186,916	213,222	Medium	paenicidin B	ribosomal:RiPP:Lanthipeptide
Region 34.2	terpene-precursor	240,180	262,567
Region 36.1	NRPS	35,720	115,297	High	polymyxin	NRPS:Type I

No secondary metabolite regions were found in these records:: NZ_JANAVN010000011.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000013.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000014.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000015.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000016.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000020.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000022.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000024.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000025.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000027.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000030.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000031.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000032.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000035.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000036.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000037.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000005.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000007.1 (Paenibacillus sp. Lou8.1); NZ_JANAVN010000009.1 (Paenibacillus sp. Lou8.1)

Compact view

NZ_JANAVN010000010.1 - Region 1 - proteusin

Download region GenBank file

Download region SVG

Location: 101,781 - 122,017 nt. (total: 20,237 nt) Show pHMM detection rules used

proteusin: (PoyD or TIGR03793)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

NLX78_RS15730: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: acyltransferase

NLX78_RS15760: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Lyases: hydratase

NLX78_RS15675: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000889.5	0.39	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.37	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000843.5	0.35	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001909.3	0.34	PKS	strobilurin A	Strobilurus tenacellus
BGC0001151.5	0.34	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0001594.3	0.33	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000668.5	0.32	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001126.4	0.32	other (other), terpene	12-epi-hapalindole J isonitrile, ambiguine A isonitrile, ambiguine B isonitrile, ambiguine C isonitrile, ambiguine D isonitrile, ambiguine E isonitrile, ambiguine K isonitrile, ambiguine L isonitrile, ambiguine I isonitrile, ambiguine J isonitrile	Fischerella ambigua UTEX 1903
BGC0001501.5	0.32	other (other)	ambiguine P	Fischerella sp. TAU
BGC0001612.3	0.32	other (other)	ambiguine H isonitrile	Fischerella ambigua UTEX 1903

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000889.5	0.39	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.37	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000843.5	0.35	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001909.3	0.34	PKS	strobilurin A	Strobilurus tenacellus
BGC0001151.5	0.34	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0001594.3	0.33	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000668.5	0.32	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001126.4	0.32	other (other), terpene	12-epi-hapalindole J isonitrile, ambiguine A isonitrile, ambiguine B isonitrile, ambiguine C isonitrile, ambiguine D isonitrile, ambiguine E isonitrile, ambiguine K isonitrile, ambiguine L isonitrile, ambiguine I isonitrile, ambiguine J isonitrile	Fischerella ambigua UTEX 1903
BGC0001501.5	0.32	other (other)	ambiguine P	Fischerella sp. TAU
BGC0001612.3	0.32	other (other)	ambiguine H isonitrile	Fischerella ambigua UTEX 1903

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.53 out of 20.97

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.62 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.27 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.01 out of 28.19

Confidence: medium

Additional weak hits (6):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.59 out of 30.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.42 out of 29.25

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.31 out of 20.47

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 24.87 out of 33.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.00 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ZuR variant 1	Zinc-responsive repressor

NZ_JANAVN010000010.1 - Region 2 - lassopeptide

Download region GenBank file

Download region SVG

Location: 228,769 - 252,887 nt. (total: 24,119 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

NLX78_RS16365: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Hydrolases: hydrolase

NLX78_RS16300: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

NLX78_RS16370: isochorismatase

smcogs: SMCOG1027: isochorismatase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001356.4	0.67	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0002150.2	0.53	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.53	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001552.3	0.53	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001634.3	0.53	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001549.3	0.52	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.52	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000575.5	0.52	ribosomal	lariatin	Rhodococcus jostii
BGC0001645.3	0.51	ribosomal	lagmysin	Streptomyces sp. NRRL S-118

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001356.4	0.67	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0002150.2	0.53	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.53	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001552.3	0.53	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001634.3	0.53	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001549.3	0.52	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.52	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000575.5	0.52	ribosomal	lariatin	Rhodococcus jostii
BGC0001645.3	0.51	ribosomal	lagmysin	Streptomyces sp. NRRL S-118

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.83 out of 27.78

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.27 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.75 out of 28.19

Confidence: medium

Additional weak hits (14):

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.79 out of 36.53

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.67 out of 23.43

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.86 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.44 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.35 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.74 out of 26.06

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.09 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.33 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.84 out of 29.38

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.46 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.68 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.79 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.29 out of 26.06

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 16 - 94; Score: 85.4

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ZuR variant 1	Zinc-responsive repressor

NZ_JANAVN010000012.1 - Region 1 - NI-siderophore,NRPS,t3nrps-iterative,transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 71,097 nt. (total: 71,097 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

NLX78_RS17630: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: acylase

NLX78_RS17510: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

NLX78_RS17520: hydrolase

smcogs: SMCOG1179: hydrolase

Lyases: decarboxylase

NLX78_RS17565: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

NLX78_RS17495: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

NLX78_RS17500: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

NLX78_RS17505: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.20	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	1.12	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	1.10	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	1.09	NRPS	AM-toxin	Alternaria alternata
BGC0001133.4	1.08	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001166.5	1.07	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	1.04	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	1.04	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	1.03	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000946.5	1.01	other (other)	vibrioferrin	Vibrio parahaemolyticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0000402.4	0.70	NRPS	paenilarvin A, paenilarvin B, paenilarvin C	Paenibacillus larvae subsp. larvae DSM 25430
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.53 out of 26.06

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 21.55

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.73 out of 27.78

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.49 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.04 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.38 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.64 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.90 out of 32.93

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.27 out of 28.19

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 25.31

Confidence: medium

Additional weak hits (18):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.57 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.59 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 26.30 out of 33.14

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.52 out of 30.11

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.93 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.61 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.29 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.49 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.14 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.27 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.74 out of 26.06

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.01 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.14 out of 30.11

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.48 out of 31.73

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.13 out of 29.72

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 71097:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - mal - Tyr - D-X) + (Ser - D-Ser) + (Ser - D-Ile - Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS17495: Ser - Ile - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (470..881): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSLWESHFFASGEHNLYGPTEATVEVAY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1533..1939): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LNSSFDGSVFDGFVLFGGELHMYGPTESTVFATC
Nearest Stachelhaus code(s):: Ile DGFFLGVVFK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (3061..3470): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSLWESHFFASGEHNLYGPTEATVEVAY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

NLX78_RS17500: Ser - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (469..873): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFASGEHNLYGPTEATVDATW
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1523..1934): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSLWESHFFASGEHNLYGPTEATVEVAY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

NLX78_RS17505: fatty_acid - Tyr - X

Search NORINE for peptide: strict or relaxed

CAL_domain (36..482): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 317.4
NH2: 17.3
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (3153..3549): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: TWRLFDAFVGATVCTLGGEFNEYGPTENSVVTTM
Nearest Stachelhaus code(s):: Tyr DALTTGEVVK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (4193..4596): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTYDSAVWQWDFILGGETNLYGPTEASIGCVA
Nearest Stachelhaus code(s):: Glu DVWHIGSIGK (65% 8Å match); Orn DVWNIGLIHK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

NLX78_RS17510: mal

PKS_AT (6..292): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 84.8
inactive: 40.1
Methoxymalonyl-CoA: 28.3
Propionyl-CoA: 17.2
Methylmalonyl-CoA: 14.0
Acetyl-CoA: 11.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor

NZ_JANAVN010000017.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 28,781 nt. (total: 28,781 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: dehalogenase glucosidase

NLX78_RS21840: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

NLX78_RS21875: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Ligases: ligase

NLX78_RS21775: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.67	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.67	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.78 out of 20.97

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.38 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.90 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.30 out of 28.19

Confidence: medium

Additional weak hits (8):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.30 out of 31.73

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.08 out of 20.47

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.08 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.91 out of 35.63

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 19.82 out of 30.12

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.04 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 28781:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ile - Glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS21775: Ile - Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (805..1199): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTGFDASTFEGFLLVGGDSNIYGPTENTTFSTV
Nearest Stachelhaus code(s):: Ile DAFFLGITFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1867..2292): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LALSFDASVKQADGLIGGETNVYGPTETTVDATA
Nearest Stachelhaus code(s):: Glu DAKDLGVVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JANAVN010000017.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 103,522 - 139,174 nt. (total: 35,653 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

NLX78_RS22235: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Transferases: aminotransferase

NLX78_RS22255: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

NLX78_RS22280: aminotransferase

smcogs: SMCOG1019: aminotransferase

NLX78_RS22290: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase

NLX78_RS22310: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

NLX78_RS22285: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

NLX78_RS22315: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

NLX78_RS22320: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000426.5	0.72	NRPS	sevadicin	Paenibacillus larvae
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001133.4	0.70	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000426.5	0.72	NRPS	sevadicin	Paenibacillus larvae
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001133.4	0.70	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.77 out of 20.97

Confidence: strong

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.09 out of 21.55

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 23.66 out of 29.25

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.05 out of 27.78

Confidence: medium

Additional weak hits (1):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.99 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 103521 - 139174:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ala) + (Phe - Gln - Glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS22315: Phe - Gln - Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (471..861): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LFFAFDAAVWEMTLIAAGSINAYGPTETTVCATV
Nearest Stachelhaus code(s):: Phe DAWTIAAVCK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1907): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDASVQQADGIIGGDTNVYGPTECCVDSTE
Nearest Stachelhaus code(s):: Gln DAQDLGVVDK (82% 8Å match); Glu DAKDIGVVDK (82% 8Å match); Ile DAQDLGVVDK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2549..2951): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLSFDASVKQADGIIGGETNVYGPTECCVDSTY
Nearest Stachelhaus code(s):: Glu DAKDIGVVDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

NLX78_RS22320: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (776..1176): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IALTFDVSVAEGNFFAAGEENIYGPTESTIYAAG
Nearest Stachelhaus code(s):: Ala DVANFAIIYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
SypG	Regulator of biofilm formation and host colonization

NZ_JANAVN010000018.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 110,937 - 129,844 nt. (total: 18,908 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: formyltransferase methyltransferase

NLX78_RS23065: methyltransferase

smcogs: SMCOG1248: methyltransferase

NLX78_RS23090: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Lyases: dehydratase

NLX78_RS23080: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	0.63	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002701.2	0.58	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0002111.3	0.53	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0001226.4	0.45	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000551.5	0.45	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.44	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000496.5	0.43	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000553.3	0.42	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000546.3	0.34	ribosomal	SAL-2242	Streptomyces albidoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	0.63	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002701.2	0.58	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0002111.3	0.53	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0001226.4	0.45	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000551.5	0.45	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.44	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000496.5	0.43	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000553.3	0.42	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000546.3	0.34	ribosomal	SAL-2242	Streptomyces albidoflavus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for NLX78_RS23055

NLX78_RS23060

Leader:

MNEVLELQKLAHDVDGKGQAME

Core:

ATITTITTTLTTVGNSSISIWGC

Core with dehydrations:

ADhbIDhbDhbIDhbDhbDhbLDhbDhbVGNDhaDhaIDhaIWGCys

antiSMASH-DB 4.0 matches for NLX78_RS23060

100.0%

NZ_JANAVN010000018.1:

Lanthipeptides: NLX78_RS23060_lanthipeptide

1

ATITTITTTLTTVGNSSISIWGC

23

ATITTITTTLTTVGNSSISIWGC

1

ATITTITTTLTTVGNSSISIWGC

23

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.28 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.71 out of 26.06

Confidence: medium

Lanthipeptides

TFBS Finder

Core peptide predictions

NLX78_RS23060 - Class III

Cleavage pHMM score: -1.90

RODEO score: 0

Monoisotopic mass: 2142.2 Da

Molecular weight: 2143.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2161.4 Da N = 1; 2179.5 Da N = 2; 2197.5 Da N = 3; 2215.5 Da N = 4; 2233.5 Da N = 5; 2251.5 Da N = 6; 2269.6 Da N = 7; 2287.6 Da N = 8; 2305.6 Da N = 9; 2323.6 Da N = 10

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes

NZ_JANAVN010000019.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 85,575 - 125,194 nt. (total: 39,620 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase glycosyltransferase

NLX78_RS23535: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

NLX78_RS23585: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: hydrolase

NLX78_RS23610: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase

NLX78_RS23615: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

NLX78_RS23620: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.02 out of 21.84

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.29 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.03 out of 28.19

Confidence: medium

Additional weak hits (2):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.46 out of 21.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 29.05 out of 39.62

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 85574 - 125194:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Phe - Glu - Val) + (D-Ile - Ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS23615: Val - Ile - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (268..727): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTGFDASTFEGWLLVGGDINGYGPTENTTFSTT
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1374..1781): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LNKGFDASTFEGFMLVGGDANIYGPTENTTFSTI
Nearest Stachelhaus code(s):: Ile DAFFLGITFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2916..3309): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTCFDVSTFEGWLLVGGDINGYGPTENTTFSTT
Nearest Stachelhaus code(s):: Ala DVFWLGGTFK (100% 8Å match); Val DVFWLGGTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

NLX78_RS23620: Phe - Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (633..1028): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LYFAFDAACWEQTLFTAGSYNGYGPTENSVATSI
Nearest Stachelhaus code(s):: Phe DAWTFAGVAK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1690..2115): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LALSFDASVKQADGLIGGETNVYGPTETTVDATA
Nearest Stachelhaus code(s):: Glu DAKDLGVVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
ZuR variant 1	Zinc-responsive repressor

NZ_JANAVN010000001.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 352,250 - 395,945 nt. (total: 43,696 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

NLX78_RS01875: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

NLX78_RS01745: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase

NLX78_RS01790: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

NLX78_RS01715: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.39 out of 27.78

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.07 out of 32.93

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.82 out of 32.93

Confidence: medium

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 24.68 out of 28.14

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

Additional weak hits (6):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.13 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.54 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.48 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.14 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 352249 - 395945:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS01790: X

AMP-binding (224..633): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LVVAFDASVWDGTLTVAGEVNVYGPTECTVATTT
Nearest Stachelhaus code(s):: bMe-Phe DAWTTAVAAK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 3	Repressor of DNA damage response
PerR	Peroxide regulator
ToxT	Regulator of MSHA biosynthesis

NZ_JANAVN010000001.1 - Region 2 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 403,386 - 424,029 nt. (total: 20,644 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

NLX78_RS01960: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Ligases: synthase

NLX78_RS02025: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Translocases: permease

NLX78_RS01955: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000779.3	0.42	saccharide	lipopolysaccharide	Aeromonas piscicola
BGC0002554.2	0.40	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0001810.3	0.40	PKS	trehangelin	Polymorphospora rubra
BGC0001440.5	0.39	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0000922.5	0.39	PKS	2-heptyl-3-hydroxy-4-quinolone, 2,4-Quinolinediol, 2-heptylquinolin-4(1H)-one	Pseudomonas aeruginosa PAO1
BGC0001080.5	0.39	other (phenazine)	endophenazine A, endophenazine B	Streptomyces anulatus
BGC0000286.3	0.38	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0002711.2	0.38	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000204.5	0.38	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0001903.3	0.38	other (other)	neocarazostatin A	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000779.3	0.42	saccharide	lipopolysaccharide	Aeromonas piscicola
BGC0002554.2	0.40	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0001810.3	0.40	PKS	trehangelin	Polymorphospora rubra
BGC0001440.5	0.39	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0000922.5	0.39	PKS	2-heptyl-3-hydroxy-4-quinolone, 2,4-Quinolinediol, 2-heptylquinolin-4(1H)-one	Pseudomonas aeruginosa PAO1
BGC0001080.5	0.39	other (phenazine)	endophenazine A, endophenazine B	Streptomyces anulatus
BGC0000286.3	0.38	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0002711.2	0.38	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000204.5	0.38	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0001903.3	0.38	other (other)	neocarazostatin A	Streptomyces sp. MA37

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.75 out of 18.57

Confidence: strong

Additional weak hits (5):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.49 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.94 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.40 out of 26.06

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 23.43

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.59 out of 36.54

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_JANAVN010000021.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 51,244 - 96,663 nt. (total: 45,420 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

NLX78_RS24465: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

NLX78_RS24475: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

NLX78_RS24480: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Hydrolases: hydrolase

NLX78_RS24500: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Isomerases: isomerase

NLX78_RS24405: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

NLX78_RS24400: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

NLX78_RS24410: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

NLX78_RS24470: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

NLX78_RS24485: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

NLX78_RS24495: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001152.5	0.95	NRPS, PKS	fusaricidin B	Paenibacillus polymyxa
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001152.5	0.95	NRPS, PKS	fusaricidin B	Paenibacillus polymyxa
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.16 out of 26.06

Confidence: strong

Additional weak hits (7):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.46 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.15 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.45 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.45 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.76 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.62 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.64 out of 30.97

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 51243 - 96663:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - D-Val - X - D-Thr - D-Asn - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS24470: X

AMP-binding (11..386): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NHSVHFYGISLSDACVGGSLNGYGLSELGNVTLG
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

NLX78_RS24495: Thr - Val - X - Thr - Asn - X

Search NORINE for peptide: strict or relaxed

AMP-binding (465..864): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNDHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1898): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LETGFDASTFEGWLLVGGDINGYGPTENTTFSTT
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3015..3405): X

nrpys: Ile, Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LVYAFDASVSETTLLTAGSSNGYGPTEDSVCTTI
Nearest Stachelhaus code(s):: Ile or Tyr DASTLAGVCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4046..4445): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNDHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5562..5957): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTMTSTKLIVGGEYNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (7077..7477): X

nrpys: Ala, D-Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TQLTFDFSVPECNLFACGEENIYGPTEAAVYATR
Nearest Stachelhaus code(s):: Ala or D-Ala DFPNFCIVYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
MogR	Repressor of flagellar motility genes

NZ_JANAVN010000023.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 43,687 - 71,293 nt. (total: 27,607 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

NLX78_RS25105: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Hydrolases: amidase

NLX78_RS25085: amidase

smcogs: SMCOG1105: amidase

Ligases: ligase

NLX78_RS25135: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.62	NRPS	enniatin	Fusarium equiseti
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.61	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.62	NRPS	enniatin	Fusarium equiseti
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.61	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.72 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.38 out of 27.78

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.55 out of 21.55

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.93 out of 26.33

Confidence: medium

Additional weak hits (7):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.65 out of 29.38

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.85 out of 36.53

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.83 out of 36.54

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.88 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.22 out of 20.01

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.28 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 43686 - 71293:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS25135: Gly - Dab

Search NORINE for peptide: strict or relaxed

AMP-binding (464..861): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDIFVLELQMMVGGEYNMYGPTETTVWSTV
Nearest Stachelhaus code(s):: Gly DILQMGMVWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1993..2452): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TAYAFDVFVGDRESITSSDMNSYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
ArcA	Repressor of carbon oxidation
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_JANAVN010000026.1 - Region 1 - NRPS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 27,376 nt. (total: 27,376 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

NLX78_RS25860: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: ligase synthase

NLX78_RS25850: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

NLX78_RS25855: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.65	NRPS	AM-toxin	Alternaria alternata
BGC0001133.4	0.65	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001133.4	0.66	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.91 out of 19.26

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.04 out of 26.06

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.04 out of 27.55

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.00 out of 27.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.20 out of 24.78

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.45 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.97 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.44 out of 26.06

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.44 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 27376:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - mal - D-Gly) + (D-Orn - Ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS25850: Orn - Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (474..886): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFAGDKEVTTGADMNTYGVTEVAIDSSF
Nearest Stachelhaus code(s):: Dab DVCETGTIEK (85% 8Å match); Orn DVGEIGSIDK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2009..2404): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTGFDACTFEGWLLVGGDINVYGPTENTTFSTY
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (91% 8Å match); Ile DAFFLGVTFK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

NLX78_RS25855: fatty_acid - Gly

Search NORINE for peptide: strict or relaxed

CAL_domain (34..480): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 232.8
NH2: 32.5
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (3170..3563): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDIFVLELQMMVGGEYNMYGPTETTVWSAV
Nearest Stachelhaus code(s):: Gly DILQMGMVWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

NLX78_RS25860: mal

PKS_AT (6..290): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.9
inactive: 48.3
Methoxymalonyl-CoA: 33.2
Methylmalonyl-CoA: 27.2
Benzoyl-CoA: 12.4
Propionyl-CoA: 10.0
Isobutyryl-CoA: 7.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes

NZ_JANAVN010000028.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 22,925 nt. (total: 22,925 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.67	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.67	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 22925:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Gly - D-Ser - D-Trp - Ser - Dab)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS26020: Gly - Ser - Trp - Ser - Dab - Dab

Search NORINE for peptide: strict or relaxed

AMP-binding (333..730): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDIFVLELQMMVGGEYNMYGPTETTVWSTV
Nearest Stachelhaus code(s):: Gly DILQMGMVWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1881..2294): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFASGEINLYGPTEATVDVSY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3416..3811): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LYFAFDAACWEQALFTAGSYNGYGPTENSVATSI
Nearest Stachelhaus code(s):: Trp DAWAFAGVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4951..5369): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFASGEVNLYGPTEATVDVSY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (6045..6504): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TAYAFDVFVGDRESITSSDMNSYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (7151..7610): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TAYAFDVFVGDRESITSSDMNSYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_JANAVN010000029.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 19,556 nt. (total: 19,556 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.67	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.67	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 19556:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ser - D-Trp - Ser - Dab)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS26025: Ser - Trp - Ser - Dab - Dab

Search NORINE for peptide: strict or relaxed

AMP-binding (900..1313): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFASGEINLYGPTEATVDVSY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2435..2830): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LYFAFDAACWEQALFTAGSYNGYGPTENSVATSI
Nearest Stachelhaus code(s):: Trp DAWAFAGVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3974..4392): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFASGEVNLYGPTEATVDVSY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5067..5526): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TAYAFDVFVGDRESITSSDMNSYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (6173..6517): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TAYAFDVFVGDRESITSSDMNSYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_JANAVN010000002.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 33,748 nt. (total: 33,748 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

NLX78_RS02830: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: hydrolase

NLX78_RS02855: isochorismatase

smcogs: SMCOG1027: isochorismatase

Ligases: ligase synthase

NLX78_RS02820: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

NLX78_RS02825: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.72	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.32 out of 30.22

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.86 out of 36.54

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.85 out of 32.93

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 20.49 out of 30.22

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 33748:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - X) + (Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS02820: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (501..900): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNSHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

NLX78_RS02825: pk - X

PKS_AT (536..823): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 62.5%; Isobutyryl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 123.0
Methoxymalonyl-CoA: 113.8
Malonyl-CoA: 106.8
Isobutyryl-CoA: 96.1
trans-1,2-CPDA: 87.9
Ethylmalonyl-CoA: 83.1
Propionyl-CoA: 70.3
2-Methylbutyryl-CoA: 65.4
CHC-CoA: 53.6
3-Methylbutyryl-CoA: 46.6
Benzoyl-CoA: 46.0
Acetyl-CoA: 45.3
inactive: 37.5
fatty_acid: 19.1

AMP-binding (2281..2686): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAESFDVSVWQAEVLITGEVNAYGPAEAADDITL
Nearest Stachelhaus code(s):: Dab DIWELTADDK (74% 8Å match); Ser DVWEMTADDK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_JANAVN010000002.1 - Region 2 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 166,945 - 187,493 nt. (total: 20,549 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

NLX78_RS03645: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Hydrolases: deacetylase

NLX78_RS03650: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000488.4	0.43	ribosomal	circularin A	Clostridium beijerinckii
BGC0002487.3	0.41	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0000504.5	0.41	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0002447.3	0.40	ribosomal	cerecyclin	Bacillus cereus
BGC0001407.5	0.39	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000916.5	0.39	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0002488.3	0.39	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002656.2	0.39	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002698.2	0.38	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000488.4	0.43	ribosomal	circularin A	Clostridium beijerinckii
BGC0002487.3	0.41	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0000504.5	0.41	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0002447.3	0.40	ribosomal	cerecyclin	Bacillus cereus
BGC0001407.5	0.39	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000916.5	0.39	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0002488.3	0.39	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002656.2	0.39	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002698.2	0.38	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.68 out of 28.19

Confidence: strong

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 19.49 out of 20.01

Confidence: strong

Additional weak hits (2):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.74 out of 26.06

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.99 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JANAVN010000033.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,372 nt. (total: 10,372 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: esterase

NLX78_RS26285: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

NLX78_RS26270: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000449.5	0.66	NRPS	tridecaptin	Paenibacillus terrae
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000449.5	0.66	NRPS	tridecaptin	Paenibacillus terrae
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.55 out of 21.55

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 21.55

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.02 out of 20.01

Confidence: medium

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 10372:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS26270: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (464..898): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTGFDASTFEGWLLVGGDINGYGPTENTTFSTT
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
ArgR	Regulator of arginine biosynthesis genes
ToxT	Regulator of MSHA biosynthesis

NZ_JANAVN010000034.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 5,041 nt. (total: 5,041 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

NLX78_RS26295: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 5041:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS26295: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (569..971): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: IAWAFDVFVGDRESILGSDVNSYGVTESTIDSSY
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_JANAVN010000003.1 - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 237,463 - 258,866 nt. (total: 21,404 nt) Show pHMM detection rules used

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or (YcaO or TIGR03604))))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

NLX78_RS05960: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Hydrolases: glucosidase

NLX78_RS05995: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Translocases: transporter

NLX78_RS05955: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002306.2	0.89	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.42	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0001210.5	0.42	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000626.3	0.41	ribosomal	thuricin	Bacillus thuringiensis
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000616.4	0.41	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000486.4	0.41	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000521.3	0.40	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002306.2	0.89	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.42	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0001210.5	0.42	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000626.3	0.41	ribosomal	thuricin	Bacillus thuringiensis
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000616.4	0.41	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000486.4	0.41	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000521.3	0.40	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.51 out of 27.55

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.58 out of 27.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.70 out of 24.78

Confidence: medium

Additional weak hits (1):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.54 out of 31.73

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Quinohemoprotein_rSAM_RRE; Location: 17 - 87; Score: 40.6; RRE type: Ranthipeptide_rSAM_RRE; Location: 15 - 90; Score: 34.4

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
LexA variant 2	Repressor of DNA damage response

NZ_JANAVN010000004.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1 - 20,440 nt. (total: 20,440 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase methyltransferase

NLX78_RS06565: methyltransferase

smcogs: SMCOG1089: methyltransferase

NLX78_RS06645: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

NLX78_RS06600: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

NLX78_RS06605: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000665.5	0.39	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001594.3	0.38	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000663.5	0.38	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000665.5	0.39	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001594.3	0.38	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000663.5	0.38	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

NLX78_RS06605: PT_FPPS_like

Domain 1 (41 - 307): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: IPP, DMAPP → FPP

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.22 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.52 out of 28.19

Confidence: medium

Additional weak hits (7):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.33 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.51 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.40 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.78 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.13 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.92 out of 31.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.89 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ZuR variant 1	Zinc-responsive repressor

NZ_JANAVN010000004.1 - Region 2 - NRPS,PKS-like,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 172,133 - 273,858 nt. (total: 101,726 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

NLX78_RS07420: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

NLX78_RS07425: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

NLX78_RS07435: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

NLX78_RS07525: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: PPTase acetyltransferase acylase

NLX78_RS07410: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

NLX78_RS07415: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

NLX78_RS07470: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

NLX78_RS07530: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

NLX78_RS07400: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

NLX78_RS07480: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: hydratase

NLX78_RS07430: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

NLX78_RS07445: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

NLX78_RS07450: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

NLX78_RS07440: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

NLX78_RS07455: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

NLX78_RS07460: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

NLX78_RS07535: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Translocases: transporter

NLX78_RS07340: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.44	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	1.36	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	1.33	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	1.32	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	1.32	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	1.31	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.28	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	1.26	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	1.24	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000205.3	1.11	PKS	bryostatin	Candidatus Endobugula sertula

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000205.3	0.65	PKS	bryostatin	Candidatus Endobugula sertula
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 24.98 out of 27.55

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.79 out of 20.97

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.96 out of 30.25

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.30 out of 27.78

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.54 out of 26.33

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.06 out of 26.06

Confidence: medium

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 24.68 out of 28.14

Confidence: medium

Additional weak hits (6):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.92 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.30 out of 21.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.73 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.79 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.56 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 172132 - 273858:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - Gly - ohmal - Me-mal) + (ohmal - mal - ccmal - ccmal - mal) + (ccmal - Me-ccmal - ohmal) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 172132 - 269567:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - Gly - ohmal - Me-mal) + (ohmal - mal - ccmal - ccmal - mal) + (ccmal - Me-ccmal - ohmal) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 231341 - 272604:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - Gly - ohmal - Me-mal) + (ohmal - mal - ccmal - ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 232619 - 273858:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - Gly - ohmal - Me-mal) + (ohmal - mal - ccmal - ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS07410: mal

PKS_AT (4..283): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 88.8
inactive: 36.8
Methoxymalonyl-CoA: 25.7
Methylmalonyl-CoA: 15.5
Propionyl-CoA: 13.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

NLX78_RS07415: mal

PKS_AT (7..296): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 40.9
inactive: 36.4
Methoxymalonyl-CoA: 21.2
Methylmalonyl-CoA: 16.7
Isobutyryl-CoA: 15.6
Propionyl-CoA: 13.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

NLX78_RS07440: Acetyl-CoA - Gly

Search NORINE for peptide: strict or relaxed

CAL_domain (66..485): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 109.8
fatty_acid: 14.5
NH2: 10.4
shikimic_acid: 0.0
AHBA: 0.0

AMP-binding (1163..1560): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDIAGLELQALCGGEWNMFGPTETTIWSTI
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
GnfM	Regulator of nitrogen-fixation genes
MogR	Repressor of flagellar motility genes
PerR	Peroxide regulator
ToxT	Regulator of MSHA biosynthesis

NZ_JANAVN010000006.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 186,916 - 213,222 nt. (total: 26,307 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

NLX78_RS10730: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: cyclase dehydratase

NLX78_RS10685: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

NLX78_RS10695: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.60	ribosomal	penisin	Paenibacillus ehimensis
BGC0000542.3	0.57	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.57	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0000538.3	0.55	ribosomal	nisin Z	Lactococcus lactis
BGC0000515.4	0.52	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000560.5	0.52	ribosomal	subtilomycin	Bacillus subtilis
BGC0002635.2	0.50	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000506.4	0.50	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.60	ribosomal	penisin	Paenibacillus ehimensis
BGC0000542.3	0.57	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.57	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0000538.3	0.55	ribosomal	nisin Z	Lactococcus lactis
BGC0000515.4	0.52	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000560.5	0.52	ribosomal	subtilomycin	Bacillus subtilis
BGC0002635.2	0.50	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000506.4	0.50	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for NLX78_RS10695

NLX78_RS10700

Leader:

MANDAFDLDVQVNKSKGSVEPQ

Core:

VLTSIAACSAVACGGQRTENCGKTYGNCVSNIGDWC

Core with dehydrations:

VLDhbDhaIAACysDhaAVACysGGQRDhbENCysGKDhbYGNCysVDhaNIGDWCys

antiSMASH-DB 4.0 matches for NLX78_RS10700

100.0%

NZ_JANAVN010000006.1:

Lanthipeptides: NLX78_RS10700_lanthipeptide

1

VLTSIAACSAVACGGQRTENCGKTYGNCVSNIGDWC

36

VLTSIAACSAVACGGQRTENCGKTYGNCVSNIGDWC

1

VLTSIAACSAVACGGQRTENCGKTYGNCVSNIGDWC

36

83.3%

NZ_CP084033.1:

Lanthipeptides: LAZ93_RS17080_lanthipeptide

1

VLTSIAACSAVACGGQRTENCGKTYGNCVSNIGDWC

36

VLTSIAACSA ACGG+RTE+CGKT GNC+SNIG+WC

1

VLTSIAACSAAACGGERTEHCGKTQGNCISNIGNWC

36

51.4%

NZ_CP006872.1:

Lanthipeptides: allorf_5538288_5538485_lanthipeptide

2

LTSIAACSAVACGGQRTEN------CGKTYGNCVSNIGDWC

36

LTS+A CS CG +T+N CGK NC +NIG +C

1

LTSVARCSG-GCGDDKTDNTKCVATCGK---NCYTNIGAFC

37

with 16 more sequence matches

Only the first 10 are displayed here.

51.4%

NZ_VEHS01000008.1:

Lanthipeptides: FS811_RS28905_lanthipeptide

2

LTSIAACSAVACGGQ-RTEN-CGKTYGN-CVSNIGDWC

36

LTS+ C+ CG Q RT N C T G C+SNIG C

1

LTSVWNCTG-GCGPQTRTANTCAPTAGKGCISNIGALC

37

40.5%

NZ_CP062165.1and 1 other:

NZ_LXQN01000019.1 Lanthipeptides: gpAD87_RS32325_lanthipeptide

Lanthipeptides: JNUCC31_RS12820_lanthipeptide

13

CGGQ-RTEN-CGKTYG-NCVSNIGDWC

36

CG Q RT N C T G C SNIG C

11

CGEQTRTANTCAPTAGVKCFSNIGALC

37

38.9%

NZ_CP013203.1:

Lanthipeptides: ASL14_RS13885_lanthipeptide

2

LTSIAACSAVACGGQRTENCGKTYGNCVSNIGDWC

36

+ SI ACS+ CG GKT +CV+ G+ C

1

VLSIVACSS-GCGS------GKTAASCVATCGNKC

28

38.9%

NZ_CP015423.1and 5 others:

NZ_CP025957.1 Lanthipeptides: C1A50_RS25095_lanthipeptideNZ_CP040829.1 Lanthipeptides: FGY93_RS09600_lanthipeptideNZ_FNYX01000002.1 Lanthipeptides: BMY87_RS25035_lanthipeptideNZ_JAOYTP010000003.1 Lanthipeptides: OIU26_RS12075_lanthipeptideNZ_POVT01000004.1 Lanthipeptides: C1T20_RS24975_lanthipeptide

Lanthipeptides: AOU00_RS26245_lanthipeptide

2

LTSIAACSAVACGGQRTENCGKTYGNCVSNIGDWC

36

+ SI ACS+ CG GKT +CV G+ C

1

VLSIVACSS-GCGS------GKTAASCVETCGNRC

28

38.9%

NZ_CP071875.1:

Lanthipeptides: J4I02_RS23985_lanthipeptide

2

LTSIAACSAVACGGQRTENCGKTYGNCVSNIGDWC

36

+ SI CS+ GG ++ C +T C SNIG C

1

IRSIWNCSSGCGGGNTSQTCVETCSPCFSNIGTLC

35

38.9%

NZ_CP075175.1:

Lanthipeptides: KIK04_RS00230_lanthipeptide

2

LTSIAACSAVACGGQRTENCGKTYGNCVSNIGDWC

36

+TS+ CS G C +T G C SNIG C

1

VTSVWNCSRGCGNGNTANTCVETCGKCFSNIGALC

35

36.1%

NZ_CP075175.1:

Lanthipeptides: KIK04_RS00235_lanthipeptide

2

LTSIAACSAVACGGQRTENCGKTYGNCVSNIGDWC

36

S+ CS G C +T G C SNIG C

1

FISVWNCSGGCGNGNTAGTCVETCGKCFSNIGALC

35

36.1%

NZ_CP092831.1and 1 other:

NZ_JAFJXZ010000017.1 Lanthipeptides: JYU28_RS12600_lanthipeptide

Lanthipeptides: MLD56_RS24395_lanthipeptide

2

LTSIAACSAVACGGQRTENCGKTYGNCVSNIGDWC

36

+ SI CS+ GG ++ C +T C SN+G C

1

IRSIWNCSSGCGGGNTSQTCVETCSPCFSNLGTLC

35

36.1%

NZ_JAKVDC010000003.1:

Lanthipeptides: MKN04_RS09455_lanthipeptide

4

SIAACSAVACGGQRTENCGKTYGNCVSNIGDWC

36

SI CS GG ++ C +T C SN+G C

3

SIWNCSIGCGGGNTSKTCVETCSPCFSNLGTLC

35

36.1%

NZ_LNZF01000002.1:

Lanthipeptides: allorf_0849299_0849475_lanthipeptide

11

VACGGQRTENCGKTYGNCVSNIGDWC

36

AC G+RT NC T CV+N WC

11

AACQGERTSNC-HTNKLCVTNFETWC

35

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.21 out of 27.04

Confidence: medium

Additional weak hits (1):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

NLX78_RS10700 - Class I

Cleavage pHMM score: 9.60

RODEO score: 23

Monoisotopic mass: 3542.6 Da

Molecular weight: 3545.0 Da

Number of bridges: 5

Alternative weights: (assuming N unmodified Ser/Thr residues); 3563.0 Da N = 1

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 115 - 205; Score: 40.2

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor

NZ_JANAVN010000006.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 240,180 - 262,567 nt. (total: 22,388 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

NLX78_RS10950: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	terpene-precursor	Similarity score	Type	Compound(s)	Organism
BGC0001910.4		0.29	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001156.5		0.19	terpene	platencin	Streptomyces platensis

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0001910.4		0.29	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001156.5		0.19	terpene	platencin	Streptomyces platensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

NLX78_RS10950: PT_FPPS_like

Domain 1 (536 - 761): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.57 out of 26.06

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.61 out of 24.78

Confidence: medium

Additional weak hits (1):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.40 out of 29.25

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes

NZ_JANAVN010000008.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 35,720 - 115,297 nt. (total: 79,578 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase glycosyltransferase

NLX78_RS12950: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

NLX78_RS13020: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Ligases: ligase

NLX78_RS12955: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

NLX78_RS12960: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

NLX78_RS12975: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

NLX78_RS13000: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001153.5	0.88	NRPS	polymyxin B	Paenibacillus polymyxa
BGC0000408.5	0.86	NRPS	polymyxin	Paenibacillus polymyxa
BGC0001192.5	0.86	NRPS	colistin A, colistin B	Paenibacillus alvei
BGC0002653.2	0.84	NRPS	macolacin	Paenibacillus xylanexedens
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000426.5	0.73	NRPS	sevadicin	Paenibacillus larvae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001153.5	0.88	NRPS	polymyxin B	Paenibacillus polymyxa
BGC0000408.5	0.86	NRPS	polymyxin	Paenibacillus polymyxa
BGC0001192.5	0.86	NRPS	colistin A, colistin B	Paenibacillus alvei
BGC0002653.2	0.84	NRPS	macolacin	Paenibacillus xylanexedens
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000426.5	0.73	NRPS	sevadicin	Paenibacillus larvae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.83 out of 27.78

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.55 out of 18.46

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.26 out of 26.06

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.12 out of 20.97

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.54 out of 20.97

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.24 out of 26.85

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.60 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.47 out of 28.19

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.07 out of 30.12

Confidence: medium

Additional weak hits (14):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.73 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.95 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 26.28 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.38 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.02 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.88 out of 31.73

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.58 out of 29.51

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.20 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.43 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.08 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.31 out of 26.06

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 22.15 out of 30.12

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.58 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.09 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 35719 - 115297:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Phe - Leu - Dab - Dab - Thr) + (Dab - Thr - Dab - Dab - Dab)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

NLX78_RS12955: Phe - Leu - Dab - Dab

Search NORINE for peptide: strict or relaxed

AMP-binding (293..683): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTFAFDASCWENTLITAGSYNAYGPTEASIATSV
Nearest Stachelhaus code(s):: Phe DAWTIAAIAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1800..2195): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: INTSFDGAIFDGLILFGGENHLYGPSESTVYTTY
Nearest Stachelhaus code(s):: Leu DGFLLGLVYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2837..3276): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINAYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISAIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3921..4360): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINAYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISAIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

NLX78_RS12960: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (269..676): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNDHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

NLX78_RS12975: Dab - Thr - Dab - Dab - Dab

Search NORINE for peptide: strict or relaxed

AMP-binding (466..878): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TAYAFDVFVGDRESITSSDINSYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1520..1927): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNDHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2585..3039): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINSYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3682..4094): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINAYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISAIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4737..5149): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TGYAFDVFVGDRESITSSDINAYGVTEAAIDSSF
Nearest Stachelhaus code(s):: Dab DVGEISAIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
MogR	Repressor of flagellar motility genes
OsdR	Development and stress management regulator
RpoN	Regulator of nitrogen assimilation and virulence
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor