GCF_023518235.1 - 5 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CP090423.1 (Stenotrophomonas maltophilia)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRP-metallophore,NRPS	676,218	724,585	High	2,3-dihydroxybenzoylserine	NRPS:Type I
Region 1.2	lanthipeptide-class-iv	829,901	852,594
Region 1.3	RiPP-like	1,904,424	1,915,299
Region 1.4	arylpolyene	3,438,188	3,481,790	Low	APE Vf	other:other
Region 1.5	terpene-precursor	4,673,563	4,694,441

No secondary metabolite regions were found in these records:: NZ_CP090426.1 (Stenotrophomonas maltophilia); NZ_CP090425.1 (Stenotrophomonas maltophilia); NZ_CP090424.1 (Stenotrophomonas maltophilia); NZ_CP090427.1 (Stenotrophomonas maltophilia)

Compact view

NZ_CP090423.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 676,218 - 724,585 nt. (total: 48,368 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

LZ605_RS03415: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

LZ605_RS03435: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

LZ605_RS03445: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

LZ605_RS03485: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

LZ605_RS03470: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

LZ605_RS03460: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

LZ605_RS03465: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

LZ605_RS03480: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002689.2	1.18	NRPS	2,3-dihydroxybenzoylserine	Stenotrophomonas maltophilia K279a
BGC0000343.5	0.77	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002689.2	0.84	NRPS	2,3-dihydroxybenzoylserine	Stenotrophomonas maltophilia K279a
BGC0000343.5	0.71	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.00 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.67 out of 20.01

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.12 out of 23.79

Confidence: medium

Additional weak hits (22):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.08 out of 26.85

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 27.05 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.92 out of 39.62

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.91 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.56 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 27.74 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.28 out of 39.62

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.81 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.91 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.10 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 26.18 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.59 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.16 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.08 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.98 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.81 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 26.35 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 676217 - 724585:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

LZ605_RS03465: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (39..444): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SASLFPMSSPGGGLQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PMPAQGVVNK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

LZ605_RS03480: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (457..845): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWELHFFTSGEHNLYGPTEAAVDVSY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP090423.1 - Region 2 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 829,901 - 852,594 nt. (total: 22,694 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

LZ605_RS04090: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

LZ605_RS04115: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002571.2	0.43	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0000515.4	0.39	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000043.5	0.39	PKS	curacin A	Moorea producens 19L
BGC0000556.5	0.39	ribosomal	streptin	Streptococcus pyogenes
BGC0000559.4	0.39	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001789.3	0.39	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000506.4	0.39	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000536.3	0.39	ribosomal	nisin Q	Lactococcus lactis
BGC0000535.4	0.39	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0000537.3	0.39	ribosomal	nisin U	Streptococcus uberis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002571.2	0.43	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0000515.4	0.39	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000043.5	0.39	PKS	curacin A	Moorea producens 19L
BGC0000556.5	0.39	ribosomal	streptin	Streptococcus pyogenes
BGC0000559.4	0.39	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001789.3	0.39	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000506.4	0.39	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000536.3	0.39	ribosomal	nisin Q	Lactococcus lactis
BGC0000535.4	0.39	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0000537.3	0.39	ribosomal	nisin U	Streptococcus uberis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for LZ605_RS04095

LZ605_RS23075

Leader:

MNNVLALQSLEIESLEAEAE

Core:

CVVCLSWYSSGLGIDEGSDKA

Core with dehydrations:

CysVVCysLDhaWYDhaDhaGLGIDEGDhaDKA

antiSMASH-DB 4.0 matches for LZ605_RS23075

100.0%

NC_011071.1and 1 other:

NZ_CP090423.1 Lanthipeptides: allorf_0839606_0839731_lanthipeptide

Lanthipeptides: SMAL_RS21270_lanthipeptide

CVVCLSWYSSGLGIDEGSDKA

50.0%

NZ_CP088240.1and 5 others:

NZ_JACLBN010000001.1 Lanthipeptides: ID830_RS20865_lanthipeptideNZ_JAEDVO010000004.1 Lanthipeptides: JAK68_RS01265_lanthipeptideNZ_JAEDWF010000055.1 Lanthipeptides: JAK40_RS19410_lanthipeptideNZ_JAEDWO010000035.1 Lanthipeptides: JAK43_RS13330_lanthipeptideNZ_KN849104.1 Lanthipeptides: WJ66_RS23200_lanthipeptide

Lanthipeptides: LQ331_RS20645_lanthipeptide

CVVCLSWYSSGLGIDEGSDKA

C CLS SS GI++G D+A

CTACLSLISSDAGIEDGMDQA

26.5%

NZ_CP014228.1:

Lanthipeptides: AXF14_RS11835_lanthipeptide

CVVCLSWYSS----GLGIDEGSDK

C C+ WYSS GL +G+ +

CCWCVPWYSSFTKCGLACSQGTCR

with 6 more sequence matches

25.7%

NZ_DS999644.1and 1 other:

NZ_LACR01000025.1 Lanthipeptides: YW5_RS27800_lanthipeptide

Lanthipeptides: SSGG_RS13160_lanthipeptide

CVVCLSWYSS----GLGIDEGSD

C CL WYS GL + G

CCSCLPWYSGWTVCGLACNPGKP

20.6%

NZ_CP063989.1and 1 other:

NZ_GL405260.1 Lanthipeptides: HMPREF0580_RS12195_lanthipeptide

Lanthipeptides: ID810_RS00795_lanthipeptide

CVVCLSWYSS

C CL WYSS

CCWCLPWYSS

20.0%

NZ_CP025701.1:

Lanthipeptides: C0569_RS26125_lanthipeptide

CLSWYSSGLGI

CL+ ++ GLGI

CLAGFTVGLGI

20.0%

NZ_NVAW01000030.1and 1 other:

NZ_NVEP01000021.1 Lanthipeptides: COL17_RS24445_lanthipeptide

Lanthipeptides: COK11_RS25885_lanthipeptide

CLSWYSSGLGI

CL+ ++ GLGI

CLAGFTIGLGI

17.1%

NZ_FNAD01000024.1:

Lanthipeptides: BLQ63_RS26050_lanthipeptide

CVVCLSWYS

C CL WYS

CCWCLPWYS

7.5%

NZ_CP076103.1:

Lanthipeptides: allorf_0730321_0730554_lanthipeptide

VCLSWYSSGLGI

CL W ++ +G+

ACLQWRANTIGV

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.74 out of 29.72

Confidence: medium

Additional weak hits (6):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.13 out of 26.33

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 22.17 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.03 out of 36.54

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.89 out of 33.73

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

LZ605_RS23075 - Class III

Cleavage pHMM score: 1.10

RODEO score: 0

Monoisotopic mass: 2116.0 Da

Molecular weight: 2117.3 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2135.4 Da N = 1; 2153.4 Da N = 2

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

NZ_CP090423.1 - Region 3 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1,904,424 - 1,915,299 nt. (total: 10,876 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001962.3	0.27	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000188.5	0.23	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001650.4	0.23	NRPS	Le-pyrrolopyrazines	Lysobacter enzymogenes
BGC0001536.4	0.22	NRPS	brevicidine	Brevibacillus laterosporus
BGC0002669.2	0.21	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000452.5	0.21	NRPS	tyrocidine	Brevibacillus brevis NBRC 100599
BGC0000651.5	0.20	terpene	KS-505a	Streptomyces argenteolus
BGC0001283.3	0.18	PKS	Bisenarsan	Streptomyces lividans 1326

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001962.3	0.27	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000188.5	0.23	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001650.4	0.23	NRPS	Le-pyrrolopyrazines	Lysobacter enzymogenes
BGC0001536.4	0.22	NRPS	brevicidine	Brevibacillus laterosporus
BGC0002669.2	0.21	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000452.5	0.21	NRPS	tyrocidine	Brevibacillus brevis NBRC 100599
BGC0000651.5	0.20	terpene	KS-505a	Streptomyces argenteolus
BGC0001283.3	0.18	PKS	Bisenarsan	Streptomyces lividans 1326

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.64 out of 26.85

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.19 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.64 out of 23.79

Confidence: medium

Additional weak hits (2):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.95 out of 30.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP090423.1 - Region 4 - arylpolyene

Download region GenBank file

Download region SVG

Location: 3,438,188 - 3,481,790 nt. (total: 43,603 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

LZ605_RS16175: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

LZ605_RS16230: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

LZ605_RS16255: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Transferases: acyltransferase halogenase

LZ605_RS16100: acyltransferase

smcogs: SMCOG1141: acyltransferase

LZ605_RS16155: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

Hydrolases: hydrolase

LZ605_RS16225: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

LZ605_RS16120: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

LZ605_RS16125: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

LZ605_RS16165: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

LZ605_RS16180: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.75	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0002008.3	0.63	other (other)	aryl polyenes	Xenorhabdus doucetiae
BGC0000836.5	0.62	other (other)	APE Ec	Escherichia coli CFT073
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002510.2	0.51	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0001895.4	0.50	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0002000.4	0.49	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.75	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0002008.3	0.63	other (other)	aryl polyenes	Xenorhabdus doucetiae
BGC0000836.5	0.62	other (other)	APE Ec	Escherichia coli CFT073
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002510.2	0.51	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0001895.4	0.50	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0002000.4	0.49	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.59 out of 29.72

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 20.30 out of 31.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.00 out of 36.54

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.61 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.22 out of 26.06

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

LZ605_RS16120: X

AMP-binding (128..302): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: THQ-----LFRWVAFSSGGTEVYGSSETGGIAWR
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP090423.1 - Region 5 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 4,673,563 - 4,694,441 nt. (total: 20,879 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

LZ605_RS21700: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000643.3	0.32	terpene	carotenoid	Brevundimonas vesicularis
BGC0000640.3	0.32	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000634.3	0.32	terpene	carotenoid	Brevundimonas sp. SD212
BGC0000630.3	0.31	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000639.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000642.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000643.3	0.32	terpene	carotenoid	Brevundimonas vesicularis
BGC0000640.3	0.32	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000634.3	0.32	terpene	carotenoid	Brevundimonas sp. SD212
BGC0000630.3	0.31	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000639.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000642.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

LZ605_RS21700: PT_FPPS_like

Domain 1 (32 - 292): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.47 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.42 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.63 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.45 out of 26.06

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein