GCF_023008405.1 - 39 region(s)

Download region SVG

Location: 94,738 - 221,719 nt. (total: 126,982 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

MUY14_RS00450: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

MUY14_RS00575: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MUY14_RS00580: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MUY14_RS00585: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MUY14_RS00590: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MUY14_RS00640: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: esterase hydrolase

MUY14_RS00470: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

MUY14_RS00595: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

MUY14_RS00490: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

MUY14_RS00525: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS00535: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS00545: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS00550: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS00555: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS00560: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MUY14_RS00565: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MUY14_RS00570: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.77	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0000113.5	0.68	PKS	niddamycin	Streptomyces caelestis
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.77	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0000113.5	0.68	PKS	niddamycin	Streptomyces caelestis
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.21 out of 20.47

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.79 out of 20.97

Confidence: medium

Additional weak hits (15):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.58 out of 29.38

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.12 out of 25.88

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.98 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.91 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.06 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.57 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.84 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.30 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.34 out of 26.85

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.77 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.34 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.07 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.74 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.54 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 94737 - 221719:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - pk) + (Me-mal) + (mal - ohmal) + (Me-ohmal - redmal) + (ccmal - ccmal - ccmal) + (pk - Me-ohmal - Me-ohmal) + (pk) + (mal - ccmal) + (ccmal - pk)
Non-colinear ordering:: MUY14_RS00525 + MUY14_RS00535 + MUY14_RS00545 + MUY14_RS00550 + MUY14_RS00555 + MUY14_RS00560 + MUY14_RS00565 + MUY14_RS00570 + MUY14_RS00575

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MUY14_RS00525: mal - mal - pk

PKS_AT (502..780): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 204.9
inactive: 109.7
Methoxymalonyl-CoA: 68.0
Methylmalonyl-CoA: 51.0
Propionyl-CoA: 32.7
Ethylmalonyl-CoA: 29.6
Isobutyryl-CoA: 24.8
Benzoyl-CoA: 19.3
2-Methylbutyryl-CoA: 16.2
CHC-CoA: 13.8
Acetyl-CoA: 12.9
trans-1,2-CPDA: 10.2
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (1449..1726): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 205.2
inactive: 103.0
Methoxymalonyl-CoA: 72.9
Methylmalonyl-CoA: 69.3
Propionyl-CoA: 35.8
Isobutyryl-CoA: 35.2
Acetyl-CoA: 23.4
Ethylmalonyl-CoA: 21.6
2-Methylbutyryl-CoA: 20.3
CHC-CoA: 19.7
Benzoyl-CoA: 18.0
trans-1,2-CPDA: 9.2
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3074..3350): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 223.9
Methylmalonyl-CoA: 216.9
Methoxymalonyl-CoA: 179.5
2-Methylbutyryl-CoA: 150.5
trans-1,2-CPDA: 128.6
Propionyl-CoA: 109.8
CHC-CoA: 107.1
Isobutyryl-CoA: 98.8
Malonyl-CoA: 91.1
Benzoyl-CoA: 87.5
Acetyl-CoA: 51.6
inactive: 34.4
fatty_acid: 30.7
3-Methylbutyryl-CoA: 27.2

MUY14_RS00535: mmal

PKS_AT (547..830): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 216.2
Ethylmalonyl-CoA: 210.0
Methoxymalonyl-CoA: 176.8
trans-1,2-CPDA: 138.1
2-Methylbutyryl-CoA: 130.7
Propionyl-CoA: 111.9
Malonyl-CoA: 104.9
CHC-CoA: 91.4
Isobutyryl-CoA: 84.4
Benzoyl-CoA: 80.9
Acetyl-CoA: 43.2
inactive: 38.3
3-Methylbutyryl-CoA: 38.3
fatty_acid: 29.2

MUY14_RS00545: mal - mal

PKS_AT (552..830): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 177.3
inactive: 76.8
Methoxymalonyl-CoA: 73.3
Methylmalonyl-CoA: 68.4
Ethylmalonyl-CoA: 33.9
Isobutyryl-CoA: 31.9
Propionyl-CoA: 29.3
fatty_acid: 27.0
trans-1,2-CPDA: 18.8
Acetyl-CoA: 17.0
2-Methylbutyryl-CoA: 15.0
CHC-CoA: 13.9
Benzoyl-CoA: 11.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (1504..1768): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 183.7
inactive: 82.4
Methoxymalonyl-CoA: 72.6
Methylmalonyl-CoA: 64.3
Ethylmalonyl-CoA: 28.4
Isobutyryl-CoA: 27.6
Propionyl-CoA: 26.8
fatty_acid: 20.9
Benzoyl-CoA: 17.2
Acetyl-CoA: 14.9
2-Methylbutyryl-CoA: 12.5
trans-1,2-CPDA: 11.7
CHC-CoA: 10.8
3-Methylbutyryl-CoA: 0.0

MUY14_RS00550: mmal - mal

PKS_AT (527..816): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 202.4
Ethylmalonyl-CoA: 197.1
Methoxymalonyl-CoA: 160.3
2-Methylbutyryl-CoA: 134.9
Propionyl-CoA: 115.7
trans-1,2-CPDA: 110.6
CHC-CoA: 92.6
Malonyl-CoA: 88.9
Isobutyryl-CoA: 86.5
Benzoyl-CoA: 73.8
Acetyl-CoA: 53.3
3-Methylbutyryl-CoA: 44.7
inactive: 32.3
fatty_acid: 26.0

PKS_AT (1941..2199): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 190.8
inactive: 80.0
Methoxymalonyl-CoA: 69.0
Methylmalonyl-CoA: 63.6
Propionyl-CoA: 31.4
Ethylmalonyl-CoA: 29.1
Isobutyryl-CoA: 27.1
Acetyl-CoA: 23.6
fatty_acid: 19.1
Benzoyl-CoA: 18.6
trans-1,2-CPDA: 13.8
CHC-CoA: 7.4
2-Methylbutyryl-CoA: 6.8
3-Methylbutyryl-CoA: 0.0

MUY14_RS00555: mal - mal - mal

PKS_AT (543..802): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 194.7
inactive: 87.5
Methoxymalonyl-CoA: 67.4
Methylmalonyl-CoA: 59.6
Isobutyryl-CoA: 38.7
Acetyl-CoA: 29.0
Ethylmalonyl-CoA: 28.4
Propionyl-CoA: 27.1
Benzoyl-CoA: 25.6
2-Methylbutyryl-CoA: 17.3
fatty_acid: 15.2
trans-1,2-CPDA: 8.2
CHC-CoA: 6.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2129..2385): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Propionyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 182.6
inactive: 94.5
Methoxymalonyl-CoA: 78.6
Methylmalonyl-CoA: 65.3
Isobutyryl-CoA: 42.5
Ethylmalonyl-CoA: 37.0
Propionyl-CoA: 35.5
Benzoyl-CoA: 23.0
Acetyl-CoA: 21.8
fatty_acid: 21.1
trans-1,2-CPDA: 13.3
CHC-CoA: 13.0
2-Methylbutyryl-CoA: 9.1
3-Methylbutyryl-CoA: 6.7

PKS_AT (3789..4044): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.5
inactive: 102.5
Methoxymalonyl-CoA: 81.6
Methylmalonyl-CoA: 69.5
Propionyl-CoA: 44.1
Isobutyryl-CoA: 43.1
Ethylmalonyl-CoA: 32.0
Benzoyl-CoA: 28.5
2-Methylbutyryl-CoA: 24.5
fatty_acid: 21.0
Acetyl-CoA: 17.6
trans-1,2-CPDA: 16.7
CHC-CoA: 15.6
3-Methylbutyryl-CoA: 11.1

MUY14_RS00560: pk - mmal - mmal

PKS_AT (548..816): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 215.8
Methylmalonyl-CoA: 211.7
Methoxymalonyl-CoA: 169.4
2-Methylbutyryl-CoA: 149.3
trans-1,2-CPDA: 115.2
Propionyl-CoA: 108.3
CHC-CoA: 105.7
Malonyl-CoA: 91.1
Isobutyryl-CoA: 80.6
Benzoyl-CoA: 70.2
Acetyl-CoA: 42.5
3-Methylbutyryl-CoA: 33.7
fatty_acid: 25.1
inactive: 20.9

PKS_AT (2153..2441): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 204.3
Ethylmalonyl-CoA: 189.3
Methoxymalonyl-CoA: 161.7
2-Methylbutyryl-CoA: 141.6
trans-1,2-CPDA: 121.3
Propionyl-CoA: 115.4
CHC-CoA: 91.3
Malonyl-CoA: 90.3
Isobutyryl-CoA: 68.7
Benzoyl-CoA: 58.9
Acetyl-CoA: 49.1
3-Methylbutyryl-CoA: 47.4
inactive: 31.4
fatty_acid: 29.8

PKS_AT (3615..3907): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 212.0
Ethylmalonyl-CoA: 203.1
Methoxymalonyl-CoA: 171.2
2-Methylbutyryl-CoA: 140.5
Propionyl-CoA: 109.2
trans-1,2-CPDA: 105.6
Malonyl-CoA: 97.7
CHC-CoA: 84.2
Isobutyryl-CoA: 72.8
Benzoyl-CoA: 62.9
Acetyl-CoA: 44.3
3-Methylbutyryl-CoA: 37.2
inactive: 31.6
fatty_acid: 29.3

MUY14_RS00565: pk

PKS_AT (550..842): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 220.6
Methylmalonyl-CoA: 214.5
Methoxymalonyl-CoA: 180.4
2-Methylbutyryl-CoA: 152.2
trans-1,2-CPDA: 143.2
CHC-CoA: 117.5
Propionyl-CoA: 113.9
Malonyl-CoA: 102.1
Isobutyryl-CoA: 87.9
Benzoyl-CoA: 80.5
fatty_acid: 57.2
Acetyl-CoA: 53.1
3-Methylbutyryl-CoA: 44.1
inactive: 22.7

MUY14_RS00570: mal - mal

PKS_AT (547..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 197.2
inactive: 100.3
Methoxymalonyl-CoA: 67.8
Methylmalonyl-CoA: 58.0
Propionyl-CoA: 50.1
Isobutyryl-CoA: 28.1
Ethylmalonyl-CoA: 21.5
Acetyl-CoA: 20.9
CHC-CoA: 19.5
2-Methylbutyryl-CoA: 18.5
Benzoyl-CoA: 11.2
fatty_acid: 10.9
trans-1,2-CPDA: 9.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (1521..1789): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Propionyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 190.6
inactive: 101.9
Methoxymalonyl-CoA: 89.3
Methylmalonyl-CoA: 76.0
Isobutyryl-CoA: 44.4
Ethylmalonyl-CoA: 44.2
Propionyl-CoA: 36.9
Acetyl-CoA: 30.2
fatty_acid: 27.9
Benzoyl-CoA: 25.7
trans-1,2-CPDA: 17.1
2-Methylbutyryl-CoA: 15.9
CHC-CoA: 14.2
3-Methylbutyryl-CoA: 7.6

MUY14_RS00575: mal - pk

PKS_AT (552..821): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 206.8
inactive: 103.5
Methoxymalonyl-CoA: 69.3
Methylmalonyl-CoA: 69.0
Propionyl-CoA: 46.7
Isobutyryl-CoA: 33.5
Ethylmalonyl-CoA: 27.6
Benzoyl-CoA: 23.8
fatty_acid: 23.2
Acetyl-CoA: 22.0
trans-1,2-CPDA: 19.4
CHC-CoA: 19.2
2-Methylbutyryl-CoA: 17.2
3-Methylbutyryl-CoA: 0.0

PKS_AT (2195..2485): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 213.5
Methylmalonyl-CoA: 209.7
Methoxymalonyl-CoA: 171.6
2-Methylbutyryl-CoA: 150.8
Propionyl-CoA: 127.5
trans-1,2-CPDA: 124.7
CHC-CoA: 101.8
Malonyl-CoA: 91.7
Isobutyryl-CoA: 90.0
Benzoyl-CoA: 69.9
Acetyl-CoA: 58.5
3-Methylbutyryl-CoA: 50.3
fatty_acid: 42.5
inactive: 31.2

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CcpA	Catabolite control protein A
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP095376.1 - Region 2 - RiPP-like

Download region SVG

Location: 528,668 - 540,974 nt. (total: 12,307 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.41	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002551.2	0.40	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0002485.2	0.40	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000483.5	0.39	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000902.4	0.38	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002311.3	0.38	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0000565.5	0.37	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002584.2	0.37	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000480.5	0.36	ribosomal	tenuecyclamide A, tenuecyclamide C	Nostoc spongiaeforme var. tenue str. Carmeli
BGC0000475.5	0.36	ribosomal	patellamide A, patellamide C	Prochloron didemni

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.41	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002551.2	0.40	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0002485.2	0.40	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000483.5	0.39	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000902.4	0.38	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002311.3	0.38	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0000565.5	0.37	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002584.2	0.37	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000480.5	0.36	ribosomal	tenuecyclamide A, tenuecyclamide C	Nostoc spongiaeforme var. tenue str. Carmeli
BGC0000475.5	0.36	ribosomal	patellamide A, patellamide C	Prochloron didemni

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.25 out of 29.72

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

Additional weak hits (5):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.00 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.85 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 22 - 121; Score: 70.4; RRE type: NHLP_CD_RRE; Location: 19 - 117; Score: 60.9; RRE type: Cyanobactin_D_RRE; Location: 19 - 97; Score: 59.1; RRE type: NHLP_CD_RRE; Location: 153 - 223; Score: 37.5

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
NtrC	Nitrogen regulatory protein C

NZ_CP095376.1 - Region 3 - T1PKS,oligosaccharide

Download region SVG

Location: 542,690 - 627,203 nt. (total: 84,514 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase reductase

MUY14_RS02200: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

MUY14_RS02235: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

MUY14_RS02315: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

MUY14_RS02335: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MUY14_RS02355: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

MUY14_RS02400: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MUY14_RS02430: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

MUY14_RS02460: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MUY14_RS02495: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

MUY14_RS02500: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: acetyltransferase acyltransferase aminotransferase glycosyltransferase methyltransferase transferase

MUY14_RS02250: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

MUY14_RS02330: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

MUY14_RS02360: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

MUY14_RS02380: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

MUY14_RS02385: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

MUY14_RS02405: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

MUY14_RS02440: aminotransferase

smcogs: SMCOG1019: aminotransferase

MUY14_RS02465: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

MUY14_RS02505: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

Hydrolases: dehalogenase hydrolase

MUY14_RS02300: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

MUY14_RS02485: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: dehydratase

MUY14_RS02240: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

MUY14_RS02415: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

MUY14_RS02480: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

MUY14_RS02510: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

MUY14_RS02225: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MUY14_RS02490: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Translocases: permease

MUY14_RS02375: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.32	PKS	esperamicin	Actinomadura verrucosospora
BGC0000245.5	0.27	PKS	medermycin	Streptomyces sp. AM-7161
BGC0001335.5	0.26	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0002070.3	0.26	PKS	SEK90, pentangumycin	Saccharothrix espanaensis DSM 44229
BGC0002482.2	0.26	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0000715.5	0.26	saccharide	actinospectacin	Streptomyces spectabilis
BGC0001060.5	0.25	PKS	dynemicin A	Micromonospora chersina
BGC0000253.4	0.25	PKS	oviedomycin	Streptomyces antibioticus
BGC0000235.5	0.25	PKS	kiamycin	Streptomyces sp. W007
BGC0000248.5	0.25	PKS	α naphtocyclinoic acid, fogacin	Streptomyces arenae DSM 40737

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.65	PKS	esperamicin	Actinomadura verrucosospora
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001276.3	0.56	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002192.3	0.55	PKS	FR901512	fungal sp. No.14919
BGC0002043.3	0.55	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002387.2	0.52	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000898.5	0.50	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000674.5	0.50	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0000813.3	0.49	other (other)	K-252a	Nonomuraea longicatena

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.36 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.90 out of 28.19

Confidence: medium

Additional weak hits (21):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.59 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.11 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.60 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.13 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.87 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.13 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.16 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.55 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.82 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.99 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.17 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.28 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.15 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.90 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.88 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.60 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.96 out of 29.65

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

MUY14_RS02225: mal

PKS_AT (619..849): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 77.7
Methoxymalonyl-CoA: 52.5
Methylmalonyl-CoA: 50.7
inactive: 31.9
Propionyl-CoA: 31.6
Ethylmalonyl-CoA: 25.9
Isobutyryl-CoA: 25.4
trans-1,2-CPDA: 17.6
fatty_acid: 14.4
2-Methylbutyryl-CoA: 9.9
CHC-CoA: 7.6
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
ZuR variant 1	Zinc-responsive repressor

NZ_CP095376.1 - Region 4 - RiPP-like

Download region SVG

Location: 629,202 - 640,563 nt. (total: 11,362 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Isomerases: mutase

MUY14_RS02575: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001151.5	0.29	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0002386.2	0.29	NRPS, PKS	cyclo(n-Me-L-Leu-L-Val), cyclo(n-Me-L-Leu-L-Leu), cyclo(n-Me-L-Leu-L-Ile)	Sorangium cellulosum So0157-2
BGC0001797.3	0.27	ribosomal	telomestatin	Streptomyces anulatus
BGC0000236.5	0.26	PKS	kinamycin	Streptomyces murayamaensis
BGC0002098.2	0.21	PKS	ECO-0501	Amycolatopsis keratiniphila
BGC0002558.2	0.19	PKS	scopranone A, scopranone B, scopranone C	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001151.5	0.29	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0002386.2	0.29	NRPS, PKS	cyclo(n-Me-L-Leu-L-Val), cyclo(n-Me-L-Leu-L-Leu), cyclo(n-Me-L-Leu-L-Ile)	Sorangium cellulosum So0157-2
BGC0001797.3	0.27	ribosomal	telomestatin	Streptomyces anulatus
BGC0000236.5	0.26	PKS	kinamycin	Streptomyces murayamaensis
BGC0002098.2	0.21	PKS	ECO-0501	Amycolatopsis keratiniphila
BGC0002558.2	0.19	PKS	scopranone A, scopranone B, scopranone C	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 20.32 out of 20.97

Confidence: strong

Additional weak hits (5):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.28 out of 31.73

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.51 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_CP095376.1 - Region 5 - NRPS,T1PKS

Download region SVG

Location: 670,090 - 825,635 nt. (total: 155,546 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxidoreductase oxygenase

MUY14_RS02775: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MUY14_RS02800: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

MUY14_RS02930: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: acylase aminotransferase glycosyltransferase

MUY14_RS02720: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

MUY14_RS02725: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

MUY14_RS02745: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

MUY14_RS02805: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MUY14_RS02840: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MUY14_RS47205: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase

MUY14_RS02875: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: dehydratase

MUY14_RS02715: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

MUY14_RS02780: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS02785: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS02810: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS02815: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS02820: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS02825: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MUY14_RS02830: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS02845: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS02850: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata
BGC0001276.3	0.69	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.65	NRPS	peramine	Epichloe festucae
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0001240.4	0.66	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0000041.3	0.66	PKS	oronofacic acid	Pseudomonas syringae
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.89 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.42 out of 27.78

Confidence: medium

Additional weak hits (12):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.23 out of 30.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.38 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.70 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.79 out of 23.43

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.81 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.65 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.29 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.33 out of 24.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.67 out of 20.01

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.75 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.62 out of 27.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 670089 - 825635:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (X) + (emal) + (Me-ohmal - Me-ohmal - redmal - ohmal) + (ohmal - Me-redmal - ohmal) + (ohmal - ohmal) + (Me-ccmal - Me-ohmal - pk) + (pk) + (ohmal - redmal) + (pk - Me-ohmal) + (redmal - ohmal - ohmal) + (Me-ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 670089 - 712960:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (X) + (emal) + (Me-ohmal - Me-ohmal - redmal - ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 679761 - 825635:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (X) + (emal) + (Me-ohmal - Me-ohmal - redmal - ohmal) + (ohmal - Me-redmal - ohmal) + (ohmal - ohmal) + (Me-ccmal - Me-ohmal - pk) + (pk) + (ohmal - redmal) + (pk - Me-ohmal) + (redmal - ohmal - ohmal) + (Me-ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MUY14_RS02780: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (21..409): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDWLWDAFGLDGFPGTGGEYNMYGPVESSVAATC
Nearest Stachelhaus code(s):: Val DALFVGLVAK (47% 8Å match)
Stachelhaus code match:: 80% (moderate)

MUY14_RS02785: X

AMP-binding (451..747): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AHSTTGAAVAELHALIGAE---------TVFSGA
Nearest Stachelhaus code(s):: Leu DAFFLGCVFK (29% 8Å match); Val DALWLGGVFK (26% 8Å match)
Stachelhaus code match:: 60% (weak)

MUY14_RS02805: emal

PKS_AT (108..404): emal

ATSignature: Isobutyryl-CoA

Top 3 matches:: Isobutyryl-CoA: 95.8%; Methoxymalonyl-CoA: 70.8%; Methylmalonyl-CoA: 70.8%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 179.2
Methylmalonyl-CoA: 178.7
2-Methylbutyryl-CoA: 153.3
Methoxymalonyl-CoA: 146.7
Propionyl-CoA: 126.4
trans-1,2-CPDA: 104.5
CHC-CoA: 97.7
Malonyl-CoA: 83.8
Isobutyryl-CoA: 78.1
Benzoyl-CoA: 61.5
3-Methylbutyryl-CoA: 44.2
Acetyl-CoA: 39.8
inactive: 34.4
fatty_acid: 21.5

MUY14_RS02810: mmal - mmal - mal - mal

PKS_AT (559..836): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 218.8
Ethylmalonyl-CoA: 212.0
Methoxymalonyl-CoA: 176.6
2-Methylbutyryl-CoA: 158.9
trans-1,2-CPDA: 133.3
Propionyl-CoA: 119.9
CHC-CoA: 115.0
Malonyl-CoA: 102.7
Isobutyryl-CoA: 75.7
Benzoyl-CoA: 72.2
Acetyl-CoA: 47.0
3-Methylbutyryl-CoA: 43.4
fatty_acid: 38.8
inactive: 36.3

PKS_AT (2055..2330): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 216.3
Ethylmalonyl-CoA: 211.2
Methoxymalonyl-CoA: 174.8
trans-1,2-CPDA: 145.4
2-Methylbutyryl-CoA: 132.4
Propionyl-CoA: 120.8
CHC-CoA: 114.2
Malonyl-CoA: 105.5
Isobutyryl-CoA: 84.4
Benzoyl-CoA: 72.8
Acetyl-CoA: 48.6
3-Methylbutyryl-CoA: 48.6
inactive: 43.9
fatty_acid: 35.2

PKS_AT (3504..3772): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 220.9
inactive: 119.3
Methoxymalonyl-CoA: 66.3
Methylmalonyl-CoA: 60.0
Isobutyryl-CoA: 47.5
Propionyl-CoA: 26.4
Ethylmalonyl-CoA: 24.0
Benzoyl-CoA: 21.8
2-Methylbutyryl-CoA: 20.3
CHC-CoA: 19.9
Acetyl-CoA: 18.3
fatty_acid: 11.1
trans-1,2-CPDA: 10.2
3-Methylbutyryl-CoA: 0.0

PKS_AT (5471..5754): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 229.6
inactive: 122.7
Methoxymalonyl-CoA: 60.7
Methylmalonyl-CoA: 52.9
Isobutyryl-CoA: 26.2
Propionyl-CoA: 22.8
Acetyl-CoA: 16.6
Benzoyl-CoA: 15.2
CHC-CoA: 14.8
2-Methylbutyryl-CoA: 11.6
Ethylmalonyl-CoA: 10.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

MUY14_RS02815: mal - mmal - mal

PKS_AT (536..798): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 222.4
inactive: 115.7
Methoxymalonyl-CoA: 63.9
Methylmalonyl-CoA: 61.7
Isobutyryl-CoA: 35.4
Propionyl-CoA: 29.2
Benzoyl-CoA: 23.3
Acetyl-CoA: 21.6
Ethylmalonyl-CoA: 16.0
CHC-CoA: 12.2
2-Methylbutyryl-CoA: 7.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (1950..2222): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 214.2
Ethylmalonyl-CoA: 214.0
Methoxymalonyl-CoA: 171.7
2-Methylbutyryl-CoA: 137.7
trans-1,2-CPDA: 136.9
Propionyl-CoA: 120.0
CHC-CoA: 118.4
Malonyl-CoA: 105.9
Isobutyryl-CoA: 76.2
Benzoyl-CoA: 69.3
Acetyl-CoA: 50.9
3-Methylbutyryl-CoA: 44.4
inactive: 29.2
fatty_acid: 29.1

PKS_AT (3947..4296): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 229.5
inactive: 130.3
Methoxymalonyl-CoA: 74.3
Methylmalonyl-CoA: 68.3
Isobutyryl-CoA: 55.1
Propionyl-CoA: 33.4
Ethylmalonyl-CoA: 24.0
2-Methylbutyryl-CoA: 22.2
Benzoyl-CoA: 20.5
Acetyl-CoA: 18.4
3-Methylbutyryl-CoA: 11.9
CHC-CoA: 9.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0

MUY14_RS02820: mal - mal

PKS_AT (539..803): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 224.1
inactive: 115.8
Methoxymalonyl-CoA: 62.9
Methylmalonyl-CoA: 62.2
Isobutyryl-CoA: 37.4
Propionyl-CoA: 28.1
Benzoyl-CoA: 21.6
Acetyl-CoA: 19.3
Ethylmalonyl-CoA: 16.9
CHC-CoA: 15.5
2-Methylbutyryl-CoA: 9.9
fatty_acid: 8.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (1977..2238): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 221.3
inactive: 112.1
Methoxymalonyl-CoA: 63.4
Methylmalonyl-CoA: 61.5
Isobutyryl-CoA: 39.3
Propionyl-CoA: 30.7
Acetyl-CoA: 21.3
Benzoyl-CoA: 20.5
Ethylmalonyl-CoA: 15.5
2-Methylbutyryl-CoA: 15.0
CHC-CoA: 13.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

MUY14_RS02825: mmal - mmal - pk

PKS_AT (554..826): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 213.4
Ethylmalonyl-CoA: 212.9
Methoxymalonyl-CoA: 168.4
2-Methylbutyryl-CoA: 141.3
trans-1,2-CPDA: 133.1
Propionyl-CoA: 122.4
Malonyl-CoA: 115.2
CHC-CoA: 112.4
Benzoyl-CoA: 68.5
Isobutyryl-CoA: 68.0
Acetyl-CoA: 55.7
3-Methylbutyryl-CoA: 35.8
inactive: 28.0
fatty_acid: 25.0

PKS_AT (2178..2449): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 211.4
Ethylmalonyl-CoA: 211.1
Methoxymalonyl-CoA: 167.8
2-Methylbutyryl-CoA: 143.7
trans-1,2-CPDA: 134.0
Propionyl-CoA: 121.9
Malonyl-CoA: 116.1
CHC-CoA: 109.3
Isobutyryl-CoA: 62.5
Benzoyl-CoA: 62.0
Acetyl-CoA: 56.0
3-Methylbutyryl-CoA: 36.4
inactive: 29.2
fatty_acid: 26.0

PKS_AT (3602..3873): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 221.4
Methylmalonyl-CoA: 217.2
Methoxymalonyl-CoA: 175.6
2-Methylbutyryl-CoA: 146.3
trans-1,2-CPDA: 143.3
Propionyl-CoA: 128.0
CHC-CoA: 116.6
Malonyl-CoA: 115.0
Isobutyryl-CoA: 71.6
Benzoyl-CoA: 71.4
Acetyl-CoA: 62.0
3-Methylbutyryl-CoA: 46.6
fatty_acid: 35.3
inactive: 31.2

MUY14_RS47205: pk

PKS_AT (555..827): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 217.6
Methylmalonyl-CoA: 211.4
Methoxymalonyl-CoA: 171.4
2-Methylbutyryl-CoA: 141.9
Propionyl-CoA: 124.5
CHC-CoA: 123.4
trans-1,2-CPDA: 122.0
Malonyl-CoA: 110.7
Isobutyryl-CoA: 82.6
Benzoyl-CoA: 76.9
Acetyl-CoA: 54.3
inactive: 42.4
3-Methylbutyryl-CoA: 41.1
fatty_acid: 35.8

MUY14_RS02830: mal - mal

PKS_AT (514..779): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 221.1
inactive: 115.8
Methoxymalonyl-CoA: 61.6
Methylmalonyl-CoA: 57.2
Isobutyryl-CoA: 35.3
Propionyl-CoA: 24.0
Benzoyl-CoA: 20.9
Acetyl-CoA: 19.6
CHC-CoA: 13.6
Ethylmalonyl-CoA: 13.4
2-Methylbutyryl-CoA: 12.2
trans-1,2-CPDA: 7.2
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (1955..2252): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 204.2
inactive: 112.2
Methoxymalonyl-CoA: 62.6
Methylmalonyl-CoA: 49.5
Isobutyryl-CoA: 35.3
Propionyl-CoA: 24.4
Acetyl-CoA: 18.0
Ethylmalonyl-CoA: 11.9
Benzoyl-CoA: 9.5
trans-1,2-CPDA: 6.2
2-Methylbutyryl-CoA: 4.1
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0
CHC-CoA: -0.7

MUY14_RS02840: pk - mmal

PKS_AT (532..804): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 219.0
Methylmalonyl-CoA: 215.7
Methoxymalonyl-CoA: 179.3
2-Methylbutyryl-CoA: 135.3
trans-1,2-CPDA: 133.8
Propionyl-CoA: 113.8
CHC-CoA: 94.9
Malonyl-CoA: 93.5
Isobutyryl-CoA: 77.4
Benzoyl-CoA: 77.1
Acetyl-CoA: 52.9
3-Methylbutyryl-CoA: 33.3
inactive: 29.0
fatty_acid: 18.6

PKS_AT (2035..2322): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 211.0
Ethylmalonyl-CoA: 209.6
Methoxymalonyl-CoA: 164.6
2-Methylbutyryl-CoA: 162.1
trans-1,2-CPDA: 132.3
Propionyl-CoA: 122.1
CHC-CoA: 105.0
Malonyl-CoA: 103.5
Isobutyryl-CoA: 72.8
Benzoyl-CoA: 47.7
Acetyl-CoA: 40.2
fatty_acid: 33.9
3-Methylbutyryl-CoA: 22.3
inactive: 15.9

MUY14_RS02845: mal - mal - mal

PKS_AT (549..813): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 225.4
inactive: 123.7
Methoxymalonyl-CoA: 64.8
Methylmalonyl-CoA: 63.1
Isobutyryl-CoA: 42.3
Propionyl-CoA: 29.7
Benzoyl-CoA: 26.0
Ethylmalonyl-CoA: 20.7
CHC-CoA: 20.6
Acetyl-CoA: 18.3
2-Methylbutyryl-CoA: 14.9
fatty_acid: 14.0
trans-1,2-CPDA: 10.2
3-Methylbutyryl-CoA: 0.0

PKS_AT (2525..2791): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 225.3
inactive: 113.2
Methoxymalonyl-CoA: 64.5
Methylmalonyl-CoA: 64.3
Isobutyryl-CoA: 47.0
Propionyl-CoA: 27.5
Ethylmalonyl-CoA: 20.3
Benzoyl-CoA: 20.0
CHC-CoA: 18.6
Acetyl-CoA: 16.9
2-Methylbutyryl-CoA: 16.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3983..4253): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 229.0
inactive: 129.1
Methoxymalonyl-CoA: 60.0
Methylmalonyl-CoA: 54.1
Isobutyryl-CoA: 46.0
Propionyl-CoA: 23.5
Benzoyl-CoA: 17.4
Acetyl-CoA: 15.7
2-Methylbutyryl-CoA: 14.5
Ethylmalonyl-CoA: 14.0
CHC-CoA: 11.6
fatty_acid: 9.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

MUY14_RS02850: mmal - mal

PKS_AT (553..829): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 223.4
Ethylmalonyl-CoA: 222.9
Methoxymalonyl-CoA: 178.0
2-Methylbutyryl-CoA: 166.1
trans-1,2-CPDA: 137.6
Propionyl-CoA: 117.1
CHC-CoA: 116.1
Malonyl-CoA: 103.7
Isobutyryl-CoA: 90.5
Benzoyl-CoA: 73.8
3-Methylbutyryl-CoA: 54.8
Acetyl-CoA: 45.2
fatty_acid: 31.7
inactive: 29.3

PKS_AT (2187..2461): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 225.5
inactive: 112.3
Methoxymalonyl-CoA: 67.2
Methylmalonyl-CoA: 63.6
Propionyl-CoA: 33.7
Isobutyryl-CoA: 33.6
2-Methylbutyryl-CoA: 20.0
Benzoyl-CoA: 19.7
Acetyl-CoA: 19.3
Ethylmalonyl-CoA: 15.0
CHC-CoA: 13.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP095376.1 - Region 6 - indole

Download region SVG

Location: 1,053,343 - 1,074,293 nt. (total: 20,951 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

MUY14_RS04130: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Hydrolases: dehalogenase

MUY14_RS04140: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001294.5	0.51	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001868.4	0.45	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001197.5	0.38	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002007.2	0.37	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002805.2	0.36	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0002387.2	0.36	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001910.4	0.35	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus
BGC0001596.3	0.34	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001294.5	0.51	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001868.4	0.45	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001197.5	0.38	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002007.2	0.37	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002805.2	0.36	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0002387.2	0.36	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001910.4	0.35	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus
BGC0001596.3	0.34	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

Additional weak hits (12):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.79 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.48 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.62 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.29 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.53 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.62 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.40 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.51 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.03 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.86 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.65 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP095376.1 - Region 7 - butyrolactone

Download region SVG

Location: 1,126,646 - 1,137,503 nt. (total: 10,858 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

MUY14_RS04490: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: methyltransferase

MUY14_RS04445: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002127.3	0.48	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001986.3	0.45	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0000844.5	0.45	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001223.5	0.39	other (other)	hydroxysporine	uncultured bacterium
BGC0001458.4	0.39	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0002582.3	0.37	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0001483.4	0.37	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001529.5	0.35	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002127.3	0.48	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001986.3	0.45	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0000844.5	0.45	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001223.5	0.39	other (other)	hydroxysporine	uncultured bacterium
BGC0001458.4	0.39	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0002582.3	0.37	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0001483.4	0.37	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001529.5	0.35	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.75 out of 23.43

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.14 out of 30.22

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CP095376.1 - Region 8 - NRPS,NRPS-like

Download region SVG

Location: 1,225,819 - 1,298,436 nt. (total: 72,618 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

MUY14_RS04920: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

MUY14_RS05065: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

MUY14_RS05115: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MUY14_RS05135: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: aminotransferase methyltransferase

MUY14_RS05015: methyltransferase

smcogs: SMCOG1089: methyltransferase

MUY14_RS05035: aminotransferase

smcogs: SMCOG1019: aminotransferase

MUY14_RS05070: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: esterase

MUY14_RS05200: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Lyases: lyase

MUY14_RS05090: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

MUY14_RS05005: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS05045: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MUY14_RS05075: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MUY14_RS05085: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS05100: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

MUY14_RS05110: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS05120: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS05140: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	1.13	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	1.12	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	1.12	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	1.09	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	1.09	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	1.09	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.07	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	1.06	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	1.05	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000342.4	1.02	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

Additional weak hits (11):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.19 out of 26.85

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.61 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.89 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.28 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.90 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.13 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.00 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 1225818 - 1298436:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (Arg) + (Ala)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 13, location 1225818 - 1268218:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 14, location 1242678 - 1285219:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (Arg) + (Ala)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 15, location 1251119 - 1298436:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala) + (Arg) + (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MUY14_RS05005: X

AMP-binding (212..617): X

nrpys: Asp, Dab, dnmeProp, L-Dbu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQAQVVVTGETNAYGATEASDDTTH
Nearest Stachelhaus code(s):: L-Dbu DIWQGTADDK (91% 8Å match); dnmeProp or Dab DIWQSTADDK (82% 8Å match); Asp DIWQSTADDK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

MUY14_RS05085: X

AMP-binding (30..425): X

nrpys: L-Dbu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQAQLGITGEVNGYGATEASDDTTH
Nearest Stachelhaus code(s):: L-Dbu DIWQGTADDK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

MUY14_RS05110: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (459..845): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HRTSFDVALEESNLVLGGELNVYGVTEAVVTTTA
Nearest Stachelhaus code(s):: Arg DVENVGAVTK (76% 8Å match); Ahp DVENAGVVTK (56% 8Å match)
Stachelhaus code match:: 90% (moderate)

MUY14_RS05120: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (438..817): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWASFDVSMWETTAISNGEYNMYAPTETTTFSLY
Nearest Stachelhaus code(s):: Ala or Val DVFWIGGTFK (56% 8Å match); Ser DVWSIAMVHK (47% 8Å match)
Stachelhaus code match:: 60% (weak)

MUY14_RS05140: X

AMP-binding (16..412): X

nrpys: Htia

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YQLFFDPGIHDAHSFFGGEENLYGPTEFSIGISW
Nearest Stachelhaus code(s):: Htia DPHHFGLIGK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein

NZ_CP095376.1 - Region 9 - NAPAA

Download region SVG

Location: 1,434,371 - 1,468,267 nt. (total: 33,897 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

MUY14_RS05945: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acyltransferase

MUY14_RS05905: acyltransferase

smcogs: SMCOG1141: acyltransferase

Ligases: ligase synthase

MUY14_RS05860: Pseudouridine synthase

smcogs: SMCOG1154: Pseudouridine synthase

MUY14_RS05915: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002276.2	0.57	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001268.4	0.55	NRPS, PKS	fusarin C	Fusarium fujikuroi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002276.2	0.57	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001268.4	0.55	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.32 out of 26.85

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.09 out of 30.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.96 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.81 out of 25.88

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.75 out of 32.93

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.42 out of 39.62

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 16, location 1434370 - 1468267:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MUY14_RS05915: X

AMP-binding (43..414): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description

NZ_CP095376.1 - Region 10 - RiPP-like

Download region SVG

Location: 1,493,601 - 1,505,784 nt. (total: 12,184 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MUY14_RS06090: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000565.5	0.42	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002115.3	0.42	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000866.5	0.42	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000483.5	0.41	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000477.3	0.41	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0002493.3	0.40	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000867.3	0.40	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002551.2	0.38	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000565.5	0.42	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002115.3	0.42	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000866.5	0.42	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000483.5	0.41	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000477.3	0.41	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0002493.3	0.40	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000867.3	0.40	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002551.2	0.38	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (4):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.40 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.98 out of 30.22

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.80 out of 35.63

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.24 out of 27.18

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 7 - 99; Score: 64.3; RRE type: Cyanobactin_D_RRE; Location: 6 - 83; Score: 58.7; RRE type: NHLP_CD_RRE; Location: 7 - 98; Score: 51.8

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_CP095376.1 - Region 11 - phosphonate

Download region SVG

Location: 1,712,288 - 1,725,423 nt. (total: 13,136 nt) Show pHMM detection rules used

phosphonate: (phosphonates and minimum(1, [2-Hacid_dh_C, Aldedh, Aminotran_1_2, Aminotran_5, AurF, CTP_transf_like, DUF4992, Fe-ADH, HMGL-like, Metallophos_2, NTP_transf_3, NTP_transf_5, PALP, PEP_mutase, TPP_enzyme_C, TPP_enzyme_N, phosphonates]) and not (phosphonatesHydrolase or phosphonatesMeIsocitrateLyase))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase

MUY14_RS07210: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000897.5	0.46	other (other)	dehydrophos	Streptomyces luridus
BGC0000904.5	0.44	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0002670.2	0.42	other (other)	fosfonochlorin	Fusarium oxysporum f. sp. lycopersici 4287
BGC0001859.4	0.41	other (phosphonate)	fosfomycin	Pseudomonas syringae
BGC0002036.4	0.41	other (other)	dehydrofosmidomycin	Streptomyces lavendulae
BGC0000938.5	0.40	other (aminocoumarin)	fosfomycin	Streptomyces fradiae
BGC0000937.5	0.39	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001739.3	0.36	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0000926.5	0.35	other (other)	rhizocticin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000807.3	0.32	saccharide	phosphonoglycans	Stackebrandtia nassauensis DSM 44728

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000897.5	0.46	other (other)	dehydrophos	Streptomyces luridus
BGC0000904.5	0.44	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0002670.2	0.42	other (other)	fosfonochlorin	Fusarium oxysporum f. sp. lycopersici 4287
BGC0001859.4	0.41	other (phosphonate)	fosfomycin	Pseudomonas syringae
BGC0002036.4	0.41	other (other)	dehydrofosmidomycin	Streptomyces lavendulae
BGC0000938.5	0.40	other (aminocoumarin)	fosfomycin	Streptomyces fradiae
BGC0000937.5	0.39	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001739.3	0.36	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0000926.5	0.35	other (other)	rhizocticin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000807.3	0.32	saccharide	phosphonoglycans	Stackebrandtia nassauensis DSM 44728

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.91 out of 28.19

Confidence: medium

Additional weak hits (5):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.88 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.23 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.69 out of 28.14

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_CP095376.1 - Region 12 - RiPP-like

Download region SVG

Location: 2,030,346 - 2,049,586 nt. (total: 19,241 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.38	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000598.5	0.31	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001148.5	0.29	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0001387.5	0.29	other (other)	nucleocidin	Streptomyces calvus
BGC0001157.6	0.26	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.26	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0000470.6	0.26	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0001753.3	0.26	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000469.6	0.25	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0002591.2	0.24	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.38	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000598.5	0.31	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001148.5	0.29	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0001387.5	0.29	other (other)	nucleocidin	Streptomyces calvus
BGC0001157.6	0.26	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.26	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0000470.6	0.26	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0001753.3	0.26	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000469.6	0.25	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0002591.2	0.24	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.36 out of 27.04

Confidence: medium

Additional weak hits (5):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.12 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.73 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.81 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.29 out of 24.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.87 out of 25.88

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NZ_CP095376.1 - Region 13 - NRPS,RiPP-like

Download region SVG

Location: 2,076,351 - 2,131,336 nt. (total: 54,986 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

MUY14_RS09075: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: dehalogenase hydrolase

MUY14_RS09030: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

MUY14_RS09095: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

MUY14_RS09115: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Ligases: ligase

MUY14_RS09015: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

MUY14_RS08910: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.35	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.33	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.31	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.31	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.30	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.30	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.30	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002075.3	0.30	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000307.4	0.29	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.29	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.62	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.02 out of 21.84

Confidence: medium

Additional weak hits (21):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 25.75

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.39 out of 30.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.75 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.25 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.05 out of 36.54

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.47 out of 30.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.98 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.43 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.30 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.89 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.83 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.08 out of 33.14

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.66 out of 27.18

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.66 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 20, location 2076350 - 2131336:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - D-X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 21, location 2076350 - 2123274:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - D-X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MUY14_RS09015: X - X

AMP-binding (16..406): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SARHFDVTVGTWLYSVGGEHNEYGPSEATVWCSQ
Nearest Stachelhaus code(s):: Trp DAGLVGEVWK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1068..1466): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AARLFDVAGSMWNFAIGGEHNEYGPTEATVWCSA
Nearest Stachelhaus code(s):: Trp DVSAVGEVAK (50% 8Å match); Ahp DVENAGVVTK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
MexT	Global virulence regulator

NZ_CP095376.1 - Region 14 - PKS-like

Download region SVG

Location: 2,342,464 - 2,383,504 nt. (total: 41,041 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MUY14_RS10120: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

MUY14_RS10225: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Ligases: ligase synthase

MUY14_RS10165: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

MUY14_RS10250: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000903.3	0.45	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002573.2	0.41	other (other)	phosphoramidon	Streptomyces mozunensis
BGC0000706.3	0.40	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000131.5	0.36	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0001627.4	0.36	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0001775.3	0.36	terpene	sespendole	Cordana terrestris
BGC0000217.5	0.36	PKS	daunorubicin	Streptomyces sp.
BGC0001928.2	0.36	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000195.5	0.35	PKS	alnumycin A, alnumycin B, alnumycin C, alnumycin P, prealnumycin, thalnumycin A, thalnumycin B, K1115A, 1,6-dihydro-8-propylanthraquinone	Streptomyces sp. CM020
BGC0002318.2	0.35	ribosomal	canucin A, canucin B	Streptomyces canus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000903.3	0.45	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002573.2	0.41	other (other)	phosphoramidon	Streptomyces mozunensis
BGC0000706.3	0.40	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000131.5	0.36	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0001627.4	0.36	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0001775.3	0.36	terpene	sespendole	Cordana terrestris
BGC0000217.5	0.36	PKS	daunorubicin	Streptomyces sp.
BGC0001928.2	0.36	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000195.5	0.35	PKS	alnumycin A, alnumycin B, alnumycin C, alnumycin P, prealnumycin, thalnumycin A, thalnumycin B, K1115A, 1,6-dihydro-8-propylanthraquinone	Streptomyces sp. CM020
BGC0002318.2	0.35	ribosomal	canucin A, canucin B	Streptomyces canus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.29 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.47 out of 23.79

Confidence: medium

Additional weak hits (32):

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.01 out of 30.11

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.58 out of 20.01

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 26.59 out of 32.93

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.45 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.91 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.34 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.75 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.25 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.06 out of 20.97

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.01 out of 30.11

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.53 out of 30.25

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 24.53 out of 32.38

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 25.23 out of 32.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.13 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.46 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.27 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.68 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.22 out of 28.14

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.88 out of 25.88

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.16 out of 32.74

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.82 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.85 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.25 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.59 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.25 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.53 out of 20.01

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.52 out of 39.62

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

MUY14_RS10250: X

AMP-binding (16..403): X

nrpys: Asp, Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: PMLH-NAIMAGVNYVYGNEVDAFGSTEGGVGFAR
Nearest Stachelhaus code(s):: Tyr DAIDVGAVGK (29% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP095376.1 - Region 15 - NRPS,NRPS-like,t3nrps-iterative

Download region SVG

Location: 2,392,343 - 2,536,319 nt. (total: 143,977 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

MUY14_RS10385: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

MUY14_RS10435: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MUY14_RS10510: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

MUY14_RS10530: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MUY14_RS10535: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MUY14_RS10575: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

MUY14_RS10580: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

MUY14_RS10715: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

MUY14_RS10745: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: PPTase acyltransferase sulfhydrylase

MUY14_RS10445: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

MUY14_RS10525: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

MUY14_RS10590: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: esterase hydrolase

MUY14_RS10375: thioesterase

smcogs: SMCOG1004: thioesterase

MUY14_RS10430: thioesterase

smcogs: SMCOG1004: thioesterase

MUY14_RS10640: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: decarboxylase dehydratase

MUY14_RS10470: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

MUY14_RS10545: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase

MUY14_RS10380: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS10410: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MUY14_RS10415: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MUY14_RS10515: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS10550: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS10660: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS46845: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	1.79	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	1.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	1.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	1.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	1.67	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	1.56	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	1.49	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.78	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.78	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.76	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.03 out of 36.53

Confidence: medium

Additional weak hits (31):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.01 out of 27.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.39 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.54 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.09 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.22 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.39 out of 32.74

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.29 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.36 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.12 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.19 out of 27.78

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.40 out of 29.51

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.10 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.99 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.85 out of 36.54

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.14 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.63 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.34 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.91 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.54 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.40 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.38 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.76 out of 24.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.18 out of 33.14

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.46 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 24, location 2392342 - 2536319:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Arg - X) + (Thr) + (Gln - Gln - Val) + (Val - D-Val - D-X - D-Val - Val) + (Orn - D-Thr - Lys - D-Leu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 25, location 2392342 - 2433992:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Arg - X) + (Thr) + (Gln - Gln - Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 26, location 2399243 - 2536319:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Arg - X) + (Thr) + (Gln - Gln - Val) + (Val - D-Val - D-X - D-Val - Val) + (Orn - D-Thr - Lys - D-Leu)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MUY14_RS10380: X

AMP-binding (7..385): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LALAFDASVQQRDLFVGGELNLYGPTESTVDATA
Nearest Stachelhaus code(s):: Ile DAQDLGVVDK (74% 8Å match); OH-Orn DAQEGGLVDK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

MUY14_RS10410: Arg - X

Search NORINE for peptide: strict or relaxed

AMP-binding (6..401): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAIAVDVAVEQTNVVSGSDLNAYGPTETVITATV
Nearest Stachelhaus code(s):: Arg DVENVGAITK (65% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1018..1394): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TDQSWDAFGLEGQLFTGGEVNGYGPVESMGFTTC
Nearest Stachelhaus code(s):: Ile DALWWGGVFK (62% 8Å match); Val or aIle DALWWGGVFK (59% 8Å match); Val DALWLGGVFK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

MUY14_RS10415: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (430..822): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSGHFDWTVWEGCQMLGGECNLYGITETTVHVTT
Nearest Stachelhaus code(s):: Ser DMWNTGLVHK (74% 8Å match); Thr DLWQLGLVHK (38% 8Å match)
Stachelhaus code match:: 70% (weak)

MUY14_RS10445: Gln - Gln - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (999..1373): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: HWMTFDVSVLERYVFCGGEINLYGPTEVAVDATA
Nearest Stachelhaus code(s):: Arg DALFFGLVDK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2000..2371): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWMTFDVSVWEWHFFCGGESNFYGPTEFAVEASH
Nearest Stachelhaus code(s):: Gln DAWHFGSVEK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (3019..3403): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWYAFDAAVFEPFLVAGGDVNGYGPTECSVMATG
Nearest Stachelhaus code(s):: Val DAMFVGGVFK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

MUY14_RS10515: X

AMP-binding (7..408): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: YHVFFDLSVFDTFALFCGEENLYGPTELTISCAE
Nearest Stachelhaus code(s):: Gly DLFFLCLLSK (85% 8Å match); foGly DLFFLCLIAK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

MUY14_RS10550: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (12..403): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAILFDYGLYQLPATNTGAQLMFGLTECKRATIM
Nearest Stachelhaus code(s):: Asp DYYPTTMRAK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

MUY14_RS46845: Val - Val - X - Val - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (16..406): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDATTYEVWLWTGGDVDGYGPTETTTFATS
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1036..1425): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPSFDASTYEVWLWTGGDVDGYGPTETTTFATS
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2456..2844): X

nrpys: Leu, Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDAATYEVFLWTGGDADVYGPTETTTFATV
Nearest Stachelhaus code(s):: Leu DAYFWGVTFK (85% 8Å match); Val DAYFWGVTFK (85% 8Å match); Ile DAYFWGVTFK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3870..4255): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRAFDASTYEVFFWAGGDVDGYGPTETTTFATS
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (88% 8Å match); Cys DAYWWGGTFK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (5300..5682): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDESFDATTYEVWLWTGGDVDGYGPTETTTFATA
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

MUY14_RS10660: Orn - Thr - Lys - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (485..852): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDHAFDTSWEGLDVMVGGEHNYYGPTESTVDATR
Nearest Stachelhaus code(s):: Orn DTEDMGYVDK (82% 8Å match); Lys DTEDMGYVDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1480..1855): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQVFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match); Val DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2948..3318): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAHAFDTSWEGADLMVGGELNYYGPTEVTVDAVH
Nearest Stachelhaus code(s):: Lys DTEDMGYVDK (82% 8Å match); Orn DTEDMGYVDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3945..4314): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAESFDASILELLILVGGDINAYGPTEATVVTSW
Nearest Stachelhaus code(s):: Leu DALLLGAVVK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_CP095376.1 - Region 16 - butyrolactone

Download region SVG

Location: 2,733,273 - 2,744,109 nt. (total: 10,837 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

MUY14_RS11650: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

MUY14_RS11680: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000706.3	0.36	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001480.3	0.32	other (other)	tundrenone	Methylobacter tundripaludum 21/22
BGC0000019.5	0.31	PKS	angolamycin	Streptomyces eurythermus
BGC0001749.3	0.30	PKS	epipyriculol	Pyricularia oryzae 70-15
BGC0000713.5	0.29	saccharide	ribostamycin	Streptomyces ribosidificus
BGC0002697.3	0.29	NRPS, PKS	clipibicyclene, azabicyclene B, azabicyclene C, azabicyclene D	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000088.4	0.29	PKS	lovastatin	Aspergillus terreus
BGC0001553.5	0.27	NRPS, PKS	clifednamide A	Streptomyces sp. JV178
BGC0000157.5	0.27	PKS	tautomycetin	Streptomyces sp. CK4412
BGC0001622.5	0.27	PKS	isatropolone A, isotropolone B, isotropolone C	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000706.3	0.36	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001480.3	0.32	other (other)	tundrenone	Methylobacter tundripaludum 21/22
BGC0000019.5	0.31	PKS	angolamycin	Streptomyces eurythermus
BGC0001749.3	0.30	PKS	epipyriculol	Pyricularia oryzae 70-15
BGC0000713.5	0.29	saccharide	ribostamycin	Streptomyces ribosidificus
BGC0002697.3	0.29	NRPS, PKS	clipibicyclene, azabicyclene B, azabicyclene C, azabicyclene D	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000088.4	0.29	PKS	lovastatin	Aspergillus terreus
BGC0001553.5	0.27	NRPS, PKS	clifednamide A	Streptomyces sp. JV178
BGC0000157.5	0.27	PKS	tautomycetin	Streptomyces sp. CK4412
BGC0001622.5	0.27	PKS	isatropolone A, isotropolone B, isotropolone C	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.76 out of 23.79

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.45 out of 26.33

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.52 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.62 out of 30.11

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.64 out of 23.79

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 26.66 out of 30.11

Confidence: medium

Additional weak hits (4):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.48 out of 26.85

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.44 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism

NZ_CP095376.1 - Region 17 - NRPS,NRPS-like,T1PKS

Download region SVG

Location: 2,792,002 - 2,852,574 nt. (total: 60,573 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

MUY14_RS12035: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Transferases: acylase

MUY14_RS12010: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: back translocase dehalogenase hydrolase

MUY14_RS11945: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

MUY14_RS11975: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

MUY14_RS12060: isochorismatase

smcogs: SMCOG1027: isochorismatase

MUY14_RS12090: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

MUY14_RS12095: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase synthase

MUY14_RS12000: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS12005: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MUY14_RS12015: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MUY14_RS12020: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	1.28	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	1.27	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	1.23	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	1.23	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.18	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	1.15	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	1.15	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	1.13	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	1.11	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	1.10	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 25.43 out of 27.04

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.75 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.93 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

Additional weak hits (12):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.87 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.55 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.48 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.15 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.02 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.40 out of 27.04

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.06 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.25 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 28, location 2792001 - 2852574:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (ccmal) + (Trp) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 29, location 2792001 - 2835433:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (ccmal) + (Trp) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 30, location 2795490 - 2852574:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (ccmal) + (Trp) + (Ser)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MUY14_RS12000: X

AMP-binding (12..390): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VNQAFDAAIPDPHSLLGGEVNGYGATEVTFAAQY
Nearest Stachelhaus code(s):: Glu DAMHVGGTAK (56% 8Å match); Leu or Val DAIALGGCAK (41% 8Å match)
Stachelhaus code match:: 70% (weak)

MUY14_RS12005: X

AMP-binding (27..405): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FGFSFDAFTMDVFIACGGEFHVYGPTETTVVVVT
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

MUY14_RS12010: mal

PKS_AT (531..810): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 181.2
inactive: 116.0
Methylmalonyl-CoA: 67.7
Methoxymalonyl-CoA: 66.0
Isobutyryl-CoA: 52.2
Propionyl-CoA: 42.8
2-Methylbutyryl-CoA: 38.4
Ethylmalonyl-CoA: 38.3
Acetyl-CoA: 30.1
Benzoyl-CoA: 27.7
CHC-CoA: 27.5
fatty_acid: 16.7
trans-1,2-CPDA: 14.8
3-Methylbutyryl-CoA: 9.7

MUY14_RS12015: Trp

Search NORINE for peptide: strict or relaxed

AMP-binding (450..806): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATFDLTVTTGKAVLGGETNEYGPTEATVGCIA
Nearest Stachelhaus code(s):: Trp DLTKVGEVGK (82% 8Å match); Asn DLTKVGEVGK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

MUY14_RS12020: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (495..889): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVCSGEHNLYGPTEAAIDVTA
Nearest Stachelhaus code(s):: Ser DVWHVSLIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP095376.1 - Region 18 - NRP-metallophore,NRPS

Download region SVG

Location: 2,876,154 - 2,939,628 nt. (total: 63,475 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

MUY14_RS12345: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

MUY14_RS12420: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

MUY14_RS12455: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: formyltransferase methyltransferase

MUY14_RS12340: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

MUY14_RS12370: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

MUY14_RS12435: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: hydratase

MUY14_RS12300: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Translocases: transporter

MUY14_RS12330: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.72	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000423.5	0.69	NRPS	scabichelin	Streptomyces scabiei 87.22
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.69	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000423.5	0.68	NRPS	scabichelin	Streptomyces scabiei 87.22
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.53 out of 27.04

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 25.31

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.81 out of 20.97

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.71 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.57 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.74 out of 36.53

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.93 out of 29.65

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.74 out of 24.78

Confidence: medium

Additional weak hits (16):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.18 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.08 out of 31.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.11 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.12 out of 27.04

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.33 out of 24.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.79 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.56 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.73 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.40 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.40 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.24 out of 36.53

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.88 out of 31.73

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 31, location 2876153 - 2939628:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Fo-OH-Orn - NMe-Ser - NMe-Fo-OH-Orn - X - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MUY14_RS12370: Fo-OH-Orn - Ser - Fo-OH-Orn - X - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (222..611): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTQAFDVAFWDLILLAGTEFNAYGPTEATTNSTL
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWILGATNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1645..2035): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFLCSGEHNLYGPTEASVDVTA
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3027..3419): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTQAFDVAFWDLILLAGTEFNAYGPTEATTNSTL
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWILGATNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4458..4833): X

nrpys: me-bAla, bAla

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWGSFIDGSTEGTVITSGEVNLYGCSEVAGDSLA
Nearest Stachelhaus code(s):: me-bAla LDTTVSLGDK (74% 8Å match); bAla VDTVISLGDK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (5478..5870): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHWFDASWQPWELGVGGEYNLYGPTEATVDALV
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP095376.1 - Region 19 - T1PKS,hglE-KS

Download region SVG

Location: 3,221,385 - 3,272,405 nt. (total: 51,021 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase glycosyltransferase

MUY14_RS13930: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

MUY14_RS13960: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase

MUY14_RS13895: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

MUY14_RS13905: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

MUY14_RS13965: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

MUY14_RS13885: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

MUY14_RS13975: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS13980: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS13985: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Translocases: permease

MUY14_RS14000: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.58	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.58	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.55	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.53	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.50	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.49	PKS	ACT-Toxin II	Alternaria alternata
BGC0000016.4	0.44	other (other)	amphotericin B	Streptomyces nodosus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0000016.4	0.55	other (other)	amphotericin B	Streptomyces nodosus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 30.15 out of 35.63

Confidence: medium

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 29.25 out of 35.63

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (13):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.72 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.53 out of 30.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.34 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.32 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.56 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.78 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.17 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.19 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.00 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.96 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.47 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.98 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.42 out of 29.38

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 32, location 3221384 - 3272405:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (mal)
Non-colinear ordering:: MUY14_RS13980 + MUY14_RS13975 + MUY14_RS13970

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 33, location 3221384 - 3265686:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (mal)
Non-colinear ordering:: MUY14_RS13980 + MUY14_RS13975 + MUY14_RS13970

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 34, location 3225691 - 3272405:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (mal)
Non-colinear ordering:: MUY14_RS13980 + MUY14_RS13975 + MUY14_RS13970

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MUY14_RS13975: mal

PKS_AT (594..806): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 4.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0
Methylmalonyl-CoA: -1.5
inactive: -2.4

MUY14_RS13980: mal

PKS_AT (1180..1468): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 74.9
Methoxymalonyl-CoA: 21.5
Methylmalonyl-CoA: 17.9
inactive: 10.8
Ethylmalonyl-CoA: 5.4
Propionyl-CoA: 2.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0
CHC-CoA: -0.7

TFBS definitions

Regulator	Description
NrtR	NAD synthesis repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP095376.1 - Region 20 - RRE-containing

Download region SVG

Location: 3,344,078 - 3,364,326 nt. (total: 20,249 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

MUY14_RS14435: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

MUY14_RS14460: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000189.4	0.42	PKS	3-(2'-hydroxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-hydroxy-3'-oxo-4'-methylhexyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylhexyl)-indole	Xenorhabdus bovienii SS-2004
BGC0002584.2	0.37	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002246.3	0.35	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0001735.5	0.34	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0001610.5	0.33	other (other)	gougerotin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001480.3	0.30	other (other)	tundrenone	Methylobacter tundripaludum 21/22
BGC0001588.3	0.28	saccharide	exopolysaccharides	Burkholderia pseudomallei 1026b
BGC0002359.3	0.28	NRPS	dudomycin A	Streptomyces albus subsp. chlorinus
BGC0000150.4	0.27	NRPS, PKS	sporolide A, sporolide B	Salinispora tropica CNB-440
BGC0000971.5	0.27	NRPS, PKS	cinnabaramide A	Streptomyces cinnabarigriseus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000189.4	0.42	PKS	3-(2'-hydroxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-hydroxy-3'-oxo-4'-methylhexyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylhexyl)-indole	Xenorhabdus bovienii SS-2004
BGC0002584.2	0.37	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002246.3	0.35	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0001735.5	0.34	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0001610.5	0.33	other (other)	gougerotin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001480.3	0.30	other (other)	tundrenone	Methylobacter tundripaludum 21/22
BGC0001588.3	0.28	saccharide	exopolysaccharides	Burkholderia pseudomallei 1026b
BGC0002359.3	0.28	NRPS	dudomycin A	Streptomyces albus subsp. chlorinus
BGC0000150.4	0.27	NRPS, PKS	sporolide A, sporolide B	Salinispora tropica CNB-440
BGC0000971.5	0.27	NRPS, PKS	cinnabaramide A	Streptomyces cinnabarigriseus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.58 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.20 out of 26.85

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.38 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.68 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.21 out of 20.01

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Mycofactocin_RRE; Location: 11 - 78; Score: 29.7

TFBS definitions

Regulator	Description

NZ_CP095376.1 - Region 21 - T1PKS

Download region SVG

Location: 3,454,047 - 3,498,771 nt. (total: 44,725 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

MUY14_RS14850: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

MUY14_RS14860: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MUY14_RS14920: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MUY14_RS14930: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MUY14_RS14980: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acyltransferase aminotransferase glycosyltransferase

MUY14_RS14925: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

MUY14_RS15005: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

MUY14_RS15010: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: esterase hydrolase

MUY14_RS14855: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

MUY14_RS14935: putative esterase

smcogs: SMCOG1104: putative esterase

Ligases: ligase synthase

MUY14_RS14945: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS14950: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.70	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.69	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002276.2	0.62	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001162.3	0.58	PKS	1-heptadecene	Moorea producens JHB
BGC0001163.3	0.57	PKS	1-heptadecene	Moorea producens 3L
BGC0002171.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002405.2	0.48	saccharide	mid-chain acyl sugars	Solanum lycopersicum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.70	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.69	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002276.2	0.62	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001162.3	0.58	PKS	1-heptadecene	Moorea producens JHB
BGC0001163.3	0.57	PKS	1-heptadecene	Moorea producens 3L
BGC0002171.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002405.2	0.48	saccharide	mid-chain acyl sugars	Solanum lycopersicum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 25.31

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.91 out of 20.97

Confidence: medium

Additional weak hits (7):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.41 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.55 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.18 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.21 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.72 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.99 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 36, location 3454046 - 3498771:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MUY14_RS14945: NH2

CAL_domain (152..483): NH2

minowa: NH2

Prediction, score:

NH2: 94.3
fatty_acid: 32.4
AHBA: 16.8
shikimic_acid: 0.0
Acetyl-CoA: -4.1

MUY14_RS14950: mmal

PKS_AT (797..1086): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 66.7%; Ethylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 95.4
Malonyl-CoA: 93.5
Methoxymalonyl-CoA: 92.9
Ethylmalonyl-CoA: 85.5
Isobutyryl-CoA: 64.4
trans-1,2-CPDA: 52.8
Propionyl-CoA: 52.5
fatty_acid: 50.4
Acetyl-CoA: 43.0
3-Methylbutyryl-CoA: 41.4
inactive: 40.0
2-Methylbutyryl-CoA: 38.5
Benzoyl-CoA: 27.2
CHC-CoA: 27.0

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A

NZ_CP095376.1 - Region 22 - RiPP-like

Download region SVG

Location: 3,613,769 - 3,626,075 nt. (total: 12,307 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: dehydratase

MUY14_RS15505: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: synthase

MUY14_RS15510: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002051.2	0.31	NRPS	antipain	Streptomyces sp.
BGC0001570.5	0.29	NRPS	deimino-antipain	Streptomyces albulus
BGC0000283.4	0.27	other (cyclitol)	cetoniacytone A	Actinomyces sp. Lu 9419
BGC0000716.5	0.27	saccharide	spectinomycin	Streptomyces netropsis
BGC0000395.5	0.26	NRPS	nocardicin A	Nocardia uniformis subsp. tsuyamanensis
BGC0000157.5	0.25	PKS	tautomycetin	Streptomyces sp. CK4412
BGC0002440.3	0.25	NRPS	longicatenamide B, longicatenamide C, longicatenamide A, longicatenamide D	Streptomyces sp.
BGC0000158.5	0.24	PKS	tautomycetin	Streptomyces griseochromogenes
BGC0002637.3	0.23	NRPS	rimomycin A, rimomycin B, rimomycin C	Streptomyces sp. WAC 06783
BGC0001095.5	0.23	NRPS	fengycin	Bacillus velezensis FZB42

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002051.2	0.31	NRPS	antipain	Streptomyces sp.
BGC0001570.5	0.29	NRPS	deimino-antipain	Streptomyces albulus
BGC0000283.4	0.27	other (cyclitol)	cetoniacytone A	Actinomyces sp. Lu 9419
BGC0000716.5	0.27	saccharide	spectinomycin	Streptomyces netropsis
BGC0000395.5	0.26	NRPS	nocardicin A	Nocardia uniformis subsp. tsuyamanensis
BGC0000157.5	0.25	PKS	tautomycetin	Streptomyces sp. CK4412
BGC0002440.3	0.25	NRPS	longicatenamide B, longicatenamide C, longicatenamide A, longicatenamide D	Streptomyces sp.
BGC0000158.5	0.24	PKS	tautomycetin	Streptomyces griseochromogenes
BGC0002637.3	0.23	NRPS	rimomycin A, rimomycin B, rimomycin C	Streptomyces sp. WAC 06783
BGC0001095.5	0.23	NRPS	fengycin	Bacillus velezensis FZB42

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (7):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.88 out of 33.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 20.92 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.23 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.73 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.50 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.98 out of 36.54

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP095376.1 - Region 23 - NRPS,lanthipeptide-class-ii

Download region SVG

Location: 3,639,583 - 3,703,605 nt. (total: 64,023 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

MUY14_RS15655: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

MUY14_RS15660: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MUY14_RS15790: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase lyase

MUY14_RS15675: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

MUY14_RS15685: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

MUY14_RS15745: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: ligase synthase

MUY14_RS15690: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

MUY14_RS15700: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS15705: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

MUY14_RS15630: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.46	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.46	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.45	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.45	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.45	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.44	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.44	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	0.43	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001249.5	0.42	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002075.3	0.42	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	0.74	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Similar known clusters from MIBiG 4.0

Similar subclusters

Lanthipeptide predictions

Lanthipeptide(s) for MUY14_RS15745

MUY14_RS15710

Leader:

MSNPFEDENGTFLVLVNAENQHSLWPSTVDVPAG

Core:

WRTVHGEDTRAACLEYVEKNWTDLRPASLVAAMR

Core with dehydrations:

WRDhbVHGEDDhbRAACysLEYVEKNWDhbDLRPADhaLVAAMR

antiSMASH-DB 4.0 matches for MUY14_RS15710

100.0%

NZ_CP095376.1and 1 other:

NZ_RSEC01000061.1 Lanthipeptides: EIY87_RS41160_lanthipeptide

Lanthipeptides: MUY14_RS15710_lanthipeptide

1

WRTVHGEDTRAACLEYVEKNWTDLRPASLVAAMR

34

WRTVHGEDTRAACLEYVEKNWTDLRPASLVAAMR

1

WRTVHGEDTRAACLEYVEKNWTDLRPASLVAAMR

34

91.2%

NZ_CP095481.1:

Lanthipeptides: MUY22_RS37100_lanthipeptide

1

WRTVHGEDTRAACLEYVEKNWTDLRPASLVAAMR

34

WRTVHGEDTRAACLEYVE +WTDLRPASLVA+MR

1

WRTVHGEDTRAACLEYVETHWTDLRPASLVASMR

34

47.1%

NZ_CP029194.1:

Lanthipeptides: DEJ46_RS03780_lanthipeptide

9

TRAACLEYVEKNWTDLRPASLVA

31

+R ACL+YV+ +WTD+RPASLVA

2

SRQACLDYVDTHWTDMRPASLVA

24

with 5 more sequence matches

44.1%

NZ_CP059991.1:

Lanthipeptides: H4W23_RS36135_lanthipeptide

9

TRAACLEYVEKNWTDLRPASLVA

31

+R ACL+YV+ WTD+RPASL+A

2

SRQACLDYVDTYWTDMRPASLIA

24

38.5%

NZ_CP116936.1:

Lanthipeptides: PCA76_RS13075_lanthipeptide

1

WRTVHGEDTRAACLEYVEKNWTDLRPASLVAAMR

34

WR E TR CL ++++ WTD+RP SL M+

1

WRAEGTEGTRDECLAHIDEIWTDMRPLSLRQRMQ

34

23.5%

NZ_BNBY01000037.1:

Lanthipeptides: IE332_RS36065_lanthipeptide

1

WRTVHGEDTRAACLEYVEKNWTDLRPASLVAAM

33

W E + CL++++ WTD+RP SL M

12

WHREGTEGPKQDCLDHIDTVWTDMRPLSLRVRM

44

23.5%

NZ_LN850107.1:

Lanthipeptides: BN1701_RS10695_lanthipeptide

1

WRTVHGEDTRAACLEYVEKNWTDLRPASLVAAM

33

W E + CL+++ WTD+RP SL M

12

WHAEGTEGPKQHCLDHIGLVWTDMRPRSLRERM

44

17.6%

NZ_CP029194.1:

Lanthipeptides: allorf_0968609_0968749_lanthipeptide

1

WRTVHGE

7

WRTV+GE

6

WRTVNGE

12

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.76 out of 21.84

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.67 out of 20.97

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

Additional weak hits (11):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.55 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.75 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.56 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.57 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.19 out of 29.65

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 19.92 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

MUY14_RS15710 - Class II

Cleavage pHMM score: -5.60

RODEO score: 0

Monoisotopic mass: 3872.0 Da

Molecular weight: 3874.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3892.4 Da N = 1; 3910.4 Da N = 2; 3928.4 Da N = 3

Predicted core structure(s)

For candidate cluster 38, location 3639582 - 3703605:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - Val - Gly - X - X - X - Leu) + (Asn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MUY14_RS15700: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (495..888): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWCSFDLTVTGLKLVVGGEANEYGHTETSVANVI
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

MUY14_RS15705: Ser - Val - Gly - X - X - X - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (38..427): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWTTFDVSVWEWHFLCSGEHNLYGPTEASVDVTY
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1068..1437): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGQAWDAFAFEGFAHTGGETNGYGPVENMIFVSS
Nearest Stachelhaus code(s):: Val DAFFVGGTFK (44% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2069..2437): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FDMTFDIAGLEAQALVGGETNMYGPTETTIWSTT
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3071..3440): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TQGAWDGFALQGHAMTGGEINGYGPAESMGYTTF
Nearest Stachelhaus code(s):: Ile DALFMGGVYK (41% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (4082..4470): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGQAWDAFGTQGDVMTGGEVNGYGPAETMGFSTF
Nearest Stachelhaus code(s):: Val DAMFMGGTFK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (5099..5497): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWHTFDDAAVEWQFITSGEHNQWGATEVSIDSTM
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (59% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (6121..6486): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNTVFDASILEALIVVGGDLNMYGPTEATVVSTV
Nearest Stachelhaus code(s):: Leu DALLVGAVVK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
MexT	Global virulence regulator

NZ_CP095376.1 - Region 24 - RRE-containing

Download region SVG

Location: 4,075,558 - 4,096,652 nt. (total: 21,095 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase reductase

MUY14_RS17720: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

MUY14_RS17730: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Hydrolases: esterase

MUY14_RS17800: putative esterase

smcogs: SMCOG1104: putative esterase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000585.5	0.47	ribosomal	microcin C7	Escherichia coli
BGC0002317.2	0.44	ribosomal	herbicolin O, mcceh252, pantocin A	Pantoea agglomerans
BGC0001810.3	0.39	PKS	trehangelin	Polymorphospora rubra
BGC0001782.3	0.37	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0001521.3	0.36	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0000903.3	0.36	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002294.3	0.36	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002210.3	0.36	NRPS, PKS	pyranoviolin A	Aspergillus violaceofuscus
BGC0001366.5	0.35	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000720.3	0.35	saccharide	tobramycin	Streptoalloteichus tenebrarius

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000585.5	0.47	ribosomal	microcin C7	Escherichia coli
BGC0002317.2	0.44	ribosomal	herbicolin O, mcceh252, pantocin A	Pantoea agglomerans
BGC0001810.3	0.39	PKS	trehangelin	Polymorphospora rubra
BGC0001782.3	0.37	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0001521.3	0.36	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0000903.3	0.36	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002294.3	0.36	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002210.3	0.36	NRPS, PKS	pyranoviolin A	Aspergillus violaceofuscus
BGC0001366.5	0.35	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000720.3	0.35	saccharide	tobramycin	Streptoalloteichus tenebrarius

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.90 out of 23.79

Confidence: medium

Additional weak hits (1):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.02 out of 29.65

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 0 - 90; Score: 67.4

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_CP095376.1 - Region 25 - redox-cofactor

Download region SVG

Location: 4,191,105 - 4,216,616 nt. (total: 25,512 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MUY14_RS18345: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Translocases: permease

MUY14_RS18300: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

MUY14_RS18385: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002493.3	0.42	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000881.3	0.40	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001808.5	0.40	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000706.3	0.39	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000277.5	0.39	PKS	urdamycin	Streptomyces fradiae
BGC0001778.5	0.38	other (other)	showdomycin	Streptomyces showdoensis
BGC0000906.3	0.38	other (other)	heme D1	Heliophilum fasciatum
BGC0002007.2	0.37	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000880.4	0.36	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002493.3	0.42	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000881.3	0.40	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001808.5	0.40	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000706.3	0.39	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000277.5	0.39	PKS	urdamycin	Streptomyces fradiae
BGC0001778.5	0.38	other (other)	showdomycin	Streptomyces showdoensis
BGC0000906.3	0.38	other (other)	heme D1	Heliophilum fasciatum
BGC0002007.2	0.37	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000880.4	0.36	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.79 out of 23.79

Confidence: medium

Additional weak hits (11):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.10 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.41 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.01 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.10 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.99 out of 31.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.46 out of 39.62

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.38 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.23 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.03 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.30 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Mycofactocin_RRE; Location: 8 - 88; Score: 97.3

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_CP095376.1 - Region 26 - T1PKS

Download region SVG

Location: 4,242,758 - 4,289,762 nt. (total: 47,005 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

MUY14_RS18555: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MUY14_RS18570: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MUY14_RS18575: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MUY14_RS18585: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

MUY14_RS18610: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MUY14_RS18615: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MUY14_RS18685: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: acetyltransferase transferase

MUY14_RS18580: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

MUY14_RS18645: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: esterase

MUY14_RS18640: putative esterase

smcogs: SMCOG1104: putative esterase

Lyases: hydratase

MUY14_RS18560: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

MUY14_RS18605: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

MUY14_RS18565: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS18650: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS18655: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS18690: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

MUY14_RS18665: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002274.2	0.66	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0002277.2	0.65	NRPS	atromentin	Suillus grevillei
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002274.2	0.66	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0002277.2	0.65	NRPS	atromentin	Suillus grevillei
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (17):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.89 out of 33.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.10 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.96 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.33 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.45 out of 20.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.47 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.40 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.12 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.41 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.19 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.72 out of 24.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.15 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 42, location 4242757 - 4289762:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MUY14_RS18565: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (11..416): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: VAWNHSFGYAGVPGVTGAALTAYGLTEAVVVTMC
Nearest Stachelhaus code(s):: Trp DVASVGAVVK (32% 8Å match)
Stachelhaus code match:: 70% (weak)

MUY14_RS18650: mmal

PKS_AT (595..867): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; Methylmalonyl-CoA: 62.5%; Propionyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 95.3
Methoxymalonyl-CoA: 87.9
Malonyl-CoA: 85.8
Ethylmalonyl-CoA: 77.8
fatty_acid: 70.0
trans-1,2-CPDA: 60.2
2-Methylbutyryl-CoA: 58.8
Propionyl-CoA: 57.4
Isobutyryl-CoA: 52.6
CHC-CoA: 41.6
inactive: 41.2
Benzoyl-CoA: 34.9
Acetyl-CoA: 31.8
3-Methylbutyryl-CoA: 20.2

MUY14_RS18655: NH2

CAL_domain (54..486): NH2

minowa: NH2

Prediction, score:

NH2: 93.5
fatty_acid: 29.0
Acetyl-CoA: 25.5
AHBA: 21.6
shikimic_acid: 18.1

MUY14_RS18690: X

AMP-binding (49..434): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ITFPFTFGLGGVFTVSAGEIDGIGSTELLHVFIS
Nearest Stachelhaus code(s):: Abu or Ival DMGFIAGVVK (32% 8Å match); Ala DVGFVAGVLK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production

NZ_CP095376.1 - Region 27 - betalactone

Download region SVG

Location: 4,353,385 - 4,389,688 nt. (total: 36,304 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

MUY14_RS19015: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

MUY14_RS19040: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: methyltransferase

MUY14_RS19075: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

MUY14_RS19060: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: dehydratase hydratase

MUY14_RS19030: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

MUY14_RS19095: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

MUY14_RS19100: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

MUY14_RS19105: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

MUY14_RS19025: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS19035: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MUY14_RS19090: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

MUY14_RS19110: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.52	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001262.3	0.46	PKS	AK-toxin I	Alternaria alternata
BGC0001197.5	0.45	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002405.2	0.45	saccharide	mid-chain acyl sugars	Solanum lycopersicum
BGC0002706.2	0.44	NRPS	saframycin Mx1	Myxococcus xanthus
BGC0000597.4	0.44	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0002711.2	0.44	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0001050.5	0.43	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0000595.3	0.43	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.52	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001262.3	0.46	PKS	AK-toxin I	Alternaria alternata
BGC0001197.5	0.45	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002405.2	0.45	saccharide	mid-chain acyl sugars	Solanum lycopersicum
BGC0002706.2	0.44	NRPS	saframycin Mx1	Myxococcus xanthus
BGC0000597.4	0.44	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0002711.2	0.44	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0001050.5	0.43	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0000595.3	0.43	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.04 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (16):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.30 out of 20.01

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.52 out of 39.62

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.14 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.61 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.18 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.22 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.32 out of 32.74

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.09 out of 36.54

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.76 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.29 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.34 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.87 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.50 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.03 out of 23.43

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism

NZ_CP095376.1 - Region 28 - hydrogen-cyanide,terpene

Download region SVG

Location: 4,391,563 - 4,442,310 nt. (total: 50,748 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase reductase

MUY14_RS19275: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

MUY14_RS19290: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

MUY14_RS19300: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

MUY14_RS19355: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

MUY14_RS19390: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase glycosyltransferase methyltransferase

MUY14_RS19215: methyltransferase

smcogs: SMCOG1089: methyltransferase

MUY14_RS19255: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

MUY14_RS19260: methyltransferase

smcogs: SMCOG1248: methyltransferase

MUY14_RS19270: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

MUY14_RS19315: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

MUY14_RS19375: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase dehydratase

MUY14_RS19220: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

MUY14_RS19235: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

MUY14_RS19350: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.49	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000664.5	0.33	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.29	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.28	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.28	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000652.5	0.28	terpene	napyradiomycin	Streptomyces sp. CNQ525
BGC0000658.3	0.28	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.27	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.27	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000197.5	0.27	PKS, saccharide	aranciamycin	Streptomyces echinatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.78	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000664.5	0.67	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.63	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.62	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.61	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.61	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000636.3	0.57	terpene	carotenoid	Brevibacterium linens
BGC0000648.3	0.57	terpene	carotenoid	Myxococcus xanthus

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Terpene cluster 1 (4,391,562 - 4,412,669):

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

MUY14_RS19220: T1TS

Domain 1 (16 - 366): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Terpene cluster 2 (4,418,139 - 4,442,310):

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

MUY14_RS19350: PT_FPPS_like

Domain 1 (58 - 357): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

MUY14_RS19360: PT_phytoene_like

Domain 1 (16 - 310): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

MUY14_RS19365: Lycopene_cycl

Domain 1 (5 - 93): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

MUY14_RS19370: Lycopene_cycl

Domain 1 (5 - 95): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.52 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.52 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.52 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.52 out of 30.11

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

Additional weak hits (22):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.94 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.83 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.45 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.44 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 26.85

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.71 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.97 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.28 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.79 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.98 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.59 out of 30.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.09 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.72 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.26 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.47 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.55 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.12 out of 36.53

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CelR	Cellobiose uptake repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP095376.1 - Region 29 - T1PKS

Download region SVG

Location: 4,720,456 - 4,909,572 nt. (total: 189,117 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

MUY14_RS20720: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

MUY14_RS20885: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: aminotransferase glycosyltransferase kinase

MUY14_RS20820: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

MUY14_RS20870: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

MUY14_RS20905: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: dehalogenase phosphatase

MUY14_RS20710: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

MUY14_RS20735: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

MUY14_RS20940: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Lyases: dehydratase

MUY14_RS20865: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

MUY14_RS20780: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS20800: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS20805: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS20810: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS20815: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS20855: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS20860: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS46950: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.75	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001012.3	0.63	NRPS, PKS	meridamycin	Streptomyces violaceusniger
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.75	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001012.3	0.63	NRPS, PKS	meridamycin	Streptomyces violaceusniger
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.74 out of 20.97

Confidence: medium

Additional weak hits (19):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.74 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.03 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.03 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.23 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.17 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.84 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.29 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.69 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.80 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.01 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.82 out of 32.93

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.58 out of 25.31

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 48, location 4720455 - 4909572:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - ccmal - ccmal - ccmal - ccmal) + (ccmal - ohmal - Me-ohmal - ohmal - mal - ohmal) + (ccmal - redmal - ohmal - ccmal - ccmal) + (Me-mal - ccmal) + (mal - ohmal) + (ccmal - ccmal - ccmal - Me-ohmal) + (ccmal - ohmal - ccmal - ccmal) + (Me-ccmal)
Non-colinear ordering:: MUY14_RS20780 + MUY14_RS20860 + MUY14_RS20855 + MUY14_RS46950 + MUY14_RS20815 + MUY14_RS20810 + MUY14_RS20805 + MUY14_RS20800

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MUY14_RS20780: mal - mal - mal - mal - mal - mal

PKS_AT (511..796): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 202.3
inactive: 83.8
Methoxymalonyl-CoA: 71.1
Methylmalonyl-CoA: 62.9
Ethylmalonyl-CoA: 30.7
Propionyl-CoA: 29.2
Isobutyryl-CoA: 25.7
Benzoyl-CoA: 18.6
fatty_acid: 18.2
Acetyl-CoA: 17.1
CHC-CoA: 15.2
trans-1,2-CPDA: 9.6
2-Methylbutyryl-CoA: 4.2
3-Methylbutyryl-CoA: 0.0

PKS_AT (1448..1723): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 66.7%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 186.0
inactive: 81.2
Methoxymalonyl-CoA: 73.6
Methylmalonyl-CoA: 59.8
Propionyl-CoA: 30.6
Isobutyryl-CoA: 26.9
Acetyl-CoA: 22.5
Ethylmalonyl-CoA: 15.9
CHC-CoA: 14.0
Benzoyl-CoA: 9.8
fatty_acid: 6.7
trans-1,2-CPDA: 5.6
2-Methylbutyryl-CoA: 4.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (3056..3318): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 194.2
inactive: 80.3
Methoxymalonyl-CoA: 60.3
Methylmalonyl-CoA: 52.9
Benzoyl-CoA: 27.4
Isobutyryl-CoA: 22.7
Propionyl-CoA: 17.0
CHC-CoA: 16.9
Ethylmalonyl-CoA: 16.0
Acetyl-CoA: 15.5
fatty_acid: 13.9
trans-1,2-CPDA: 5.8
2-Methylbutyryl-CoA: 5.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (4646..4912): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 66.7%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 194.2
inactive: 94.6
Methoxymalonyl-CoA: 76.8
Methylmalonyl-CoA: 72.9
Isobutyryl-CoA: 50.4
Propionyl-CoA: 37.3
Ethylmalonyl-CoA: 32.7
Acetyl-CoA: 19.1
Benzoyl-CoA: 18.5
CHC-CoA: 16.9
trans-1,2-CPDA: 15.4
2-Methylbutyryl-CoA: 13.2
fatty_acid: 10.1
3-Methylbutyryl-CoA: 0.0

PKS_AT (6436..6695): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.7
inactive: 88.0
Methoxymalonyl-CoA: 63.9
Methylmalonyl-CoA: 49.9
Propionyl-CoA: 31.9
Acetyl-CoA: 24.1
Ethylmalonyl-CoA: 20.7
Benzoyl-CoA: 20.2
Isobutyryl-CoA: 19.4
trans-1,2-CPDA: 16.8
CHC-CoA: 16.6
fatty_acid: 15.2
2-Methylbutyryl-CoA: 14.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (8029..8282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Methylbutyryl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 183.3
inactive: 83.8
Methoxymalonyl-CoA: 64.4
Methylmalonyl-CoA: 53.0
Propionyl-CoA: 21.7
Benzoyl-CoA: 21.5
fatty_acid: 20.7
Isobutyryl-CoA: 20.5
Acetyl-CoA: 18.3
Ethylmalonyl-CoA: 18.1
CHC-CoA: 17.0
trans-1,2-CPDA: 10.4
2-Methylbutyryl-CoA: 10.0
3-Methylbutyryl-CoA: 0.0

MUY14_RS20800: mmal

PKS_AT (557..846): mmal

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 185.8
Ethylmalonyl-CoA: 179.7
Methoxymalonyl-CoA: 166.4
2-Methylbutyryl-CoA: 123.0
trans-1,2-CPDA: 113.0
Propionyl-CoA: 102.9
Malonyl-CoA: 99.1
CHC-CoA: 86.2
Benzoyl-CoA: 63.8
Isobutyryl-CoA: 61.6
3-Methylbutyryl-CoA: 41.5
Acetyl-CoA: 40.7
inactive: 32.0
fatty_acid: 28.1

MUY14_RS20805: mal - mal - mal - mal

PKS_AT (550..814): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 182.6
inactive: 86.0
Methoxymalonyl-CoA: 59.3
Methylmalonyl-CoA: 55.0
Propionyl-CoA: 30.5
Benzoyl-CoA: 28.0
Ethylmalonyl-CoA: 26.5
2-Methylbutyryl-CoA: 23.7
Isobutyryl-CoA: 23.5
Acetyl-CoA: 19.0
fatty_acid: 14.7
trans-1,2-CPDA: 9.6
CHC-CoA: 9.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (2220..2480): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.6
inactive: 86.0
Methoxymalonyl-CoA: 57.2
Methylmalonyl-CoA: 48.4
Isobutyryl-CoA: 21.5
Benzoyl-CoA: 17.2
Acetyl-CoA: 15.3
Ethylmalonyl-CoA: 12.0
CHC-CoA: 8.4
Propionyl-CoA: 8.0
2-Methylbutyryl-CoA: 0.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3653..3937): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 183.7
inactive: 82.2
Methoxymalonyl-CoA: 70.6
Methylmalonyl-CoA: 63.2
Ethylmalonyl-CoA: 25.6
Isobutyryl-CoA: 24.3
Propionyl-CoA: 20.2
fatty_acid: 18.1
trans-1,2-CPDA: 12.7
Acetyl-CoA: 12.1
Benzoyl-CoA: 9.2
2-Methylbutyryl-CoA: 7.5
CHC-CoA: 5.8
3-Methylbutyryl-CoA: 5.4

PKS_AT (5307..5601): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.2
inactive: 81.6
Methoxymalonyl-CoA: 65.5
Methylmalonyl-CoA: 59.1
Isobutyryl-CoA: 40.7
Acetyl-CoA: 27.6
Ethylmalonyl-CoA: 24.4
Benzoyl-CoA: 22.0
Propionyl-CoA: 21.5
fatty_acid: 14.1
2-Methylbutyryl-CoA: 13.2
CHC-CoA: 11.5
3-Methylbutyryl-CoA: 9.8
trans-1,2-CPDA: 7.4

MUY14_RS20810: mal - mal - mal - mmal

PKS_AT (564..837): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 203.8
inactive: 110.6
Methoxymalonyl-CoA: 50.7
Methylmalonyl-CoA: 38.6
Acetyl-CoA: 21.6
Benzoyl-CoA: 18.5
Isobutyryl-CoA: 14.3
Propionyl-CoA: 13.7
Ethylmalonyl-CoA: 10.4
2-Methylbutyryl-CoA: 9.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2222..2507): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 206.6
inactive: 88.6
Methoxymalonyl-CoA: 67.2
Methylmalonyl-CoA: 64.1
Propionyl-CoA: 42.9
Isobutyryl-CoA: 31.8
2-Methylbutyryl-CoA: 25.4
Ethylmalonyl-CoA: 25.0
Acetyl-CoA: 23.3
Benzoyl-CoA: 22.9
fatty_acid: 17.1
CHC-CoA: 16.9
trans-1,2-CPDA: 10.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (3921..4198): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Propionyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 199.4
inactive: 104.2
Methoxymalonyl-CoA: 65.3
Methylmalonyl-CoA: 57.5
Isobutyryl-CoA: 35.2
Ethylmalonyl-CoA: 26.9
Acetyl-CoA: 26.6
Propionyl-CoA: 20.6
Benzoyl-CoA: 15.7
2-Methylbutyryl-CoA: 13.5
fatty_acid: 10.9
CHC-CoA: 7.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: -2.0

PKS_AT (5601..5884): mmal

ATSignature: Methoxymalonyl-CoA, Methylmalonyl-CoA, Ethylmalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 83.3%; Methylmalonyl-CoA: 83.3%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 178.3
Ethylmalonyl-CoA: 176.0
Methoxymalonyl-CoA: 161.0
2-Methylbutyryl-CoA: 122.1
Propionyl-CoA: 106.0
Malonyl-CoA: 103.0
trans-1,2-CPDA: 101.8
CHC-CoA: 81.5
Benzoyl-CoA: 62.6
Isobutyryl-CoA: 61.5
Acetyl-CoA: 42.7
inactive: 30.2
fatty_acid: 30.1
3-Methylbutyryl-CoA: 17.8

MUY14_RS20815: mal - mal

PKS_AT (560..817): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 181.9
inactive: 70.9
Methoxymalonyl-CoA: 68.9
Methylmalonyl-CoA: 55.8
Ethylmalonyl-CoA: 26.0
Isobutyryl-CoA: 25.0
Acetyl-CoA: 21.5
Propionyl-CoA: 21.2
fatty_acid: 20.7
Benzoyl-CoA: 18.6
trans-1,2-CPDA: 14.6
CHC-CoA: 13.6
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (1745..2016): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 192.5
inactive: 96.3
Methoxymalonyl-CoA: 54.6
Methylmalonyl-CoA: 53.2
Isobutyryl-CoA: 29.5
fatty_acid: 20.1
Acetyl-CoA: 16.9
Benzoyl-CoA: 16.3
Propionyl-CoA: 12.8
CHC-CoA: 10.2
2-Methylbutyryl-CoA: 2.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -3.1

MUY14_RS46950: mmal - mal

PKS_AT (543..837): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 215.1
Ethylmalonyl-CoA: 203.7
Methoxymalonyl-CoA: 175.0
2-Methylbutyryl-CoA: 142.9
trans-1,2-CPDA: 120.9
Propionyl-CoA: 108.6
Malonyl-CoA: 100.5
CHC-CoA: 98.3
Isobutyryl-CoA: 78.3
Benzoyl-CoA: 60.4
Acetyl-CoA: 49.0
3-Methylbutyryl-CoA: 40.4
fatty_acid: 31.7
inactive: 19.8

PKS_AT (1950..2226): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 189.4
inactive: 82.9
Methoxymalonyl-CoA: 59.5
Methylmalonyl-CoA: 52.2
Isobutyryl-CoA: 31.8
Ethylmalonyl-CoA: 24.2
Acetyl-CoA: 22.8
Propionyl-CoA: 19.9
Benzoyl-CoA: 19.4
fatty_acid: 13.4
CHC-CoA: 11.2
2-Methylbutyryl-CoA: 9.8
trans-1,2-CPDA: 8.8
3-Methylbutyryl-CoA: 0.0

MUY14_RS20855: mal - mal - mal - mal - mal

PKS_AT (554..814): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.6
inactive: 90.9
Methoxymalonyl-CoA: 68.5
Methylmalonyl-CoA: 60.5
Isobutyryl-CoA: 36.5
Propionyl-CoA: 26.4
Benzoyl-CoA: 26.3
Ethylmalonyl-CoA: 17.0
CHC-CoA: 17.0
Acetyl-CoA: 15.1
fatty_acid: 10.8
2-Methylbutyryl-CoA: 9.7
trans-1,2-CPDA: 9.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (2116..2373): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 197.2
inactive: 90.9
Methoxymalonyl-CoA: 57.0
Methylmalonyl-CoA: 49.9
Isobutyryl-CoA: 24.1
Propionyl-CoA: 21.8
Ethylmalonyl-CoA: 19.3
Acetyl-CoA: 18.8
Benzoyl-CoA: 16.5
fatty_acid: 12.5
2-Methylbutyryl-CoA: 8.6
trans-1,2-CPDA: 8.5
CHC-CoA: 8.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (4118..4377): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 199.4
inactive: 94.0
Methoxymalonyl-CoA: 62.0
Methylmalonyl-CoA: 50.6
Benzoyl-CoA: 23.3
Isobutyryl-CoA: 22.1
Ethylmalonyl-CoA: 21.5
Propionyl-CoA: 19.4
Acetyl-CoA: 17.5
fatty_acid: 10.3
2-Methylbutyryl-CoA: 7.4
trans-1,2-CPDA: 6.6
CHC-CoA: 5.1
3-Methylbutyryl-CoA: 0.0

PKS_AT (5526..5787): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 208.3
inactive: 97.2
Methoxymalonyl-CoA: 68.3
Methylmalonyl-CoA: 57.3
Isobutyryl-CoA: 31.6
Propionyl-CoA: 29.4
Benzoyl-CoA: 25.2
Ethylmalonyl-CoA: 20.2
Acetyl-CoA: 18.5
fatty_acid: 12.7
trans-1,2-CPDA: 10.7
2-Methylbutyryl-CoA: 10.7
CHC-CoA: 9.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (7188..7448): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 181.3
inactive: 76.1
Methoxymalonyl-CoA: 60.5
Methylmalonyl-CoA: 47.5
Benzoyl-CoA: 20.7
fatty_acid: 17.6
Propionyl-CoA: 17.2
Acetyl-CoA: 15.7
Isobutyryl-CoA: 13.3
CHC-CoA: 10.9
Ethylmalonyl-CoA: 8.8
2-Methylbutyryl-CoA: 6.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

MUY14_RS20860: mal - mal - mmal - mal - mal - mal

PKS_AT (543..801): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 176.2
inactive: 83.2
Methoxymalonyl-CoA: 54.7
Methylmalonyl-CoA: 42.5
Isobutyryl-CoA: 17.8
fatty_acid: 17.4
Benzoyl-CoA: 13.2
Acetyl-CoA: 11.4
Ethylmalonyl-CoA: 7.3
Propionyl-CoA: 5.5
CHC-CoA: 5.3
trans-1,2-CPDA: 3.3
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -3.6

PKS_AT (2162..2416): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.2
inactive: 82.0
Methoxymalonyl-CoA: 71.3
Methylmalonyl-CoA: 54.9
Propionyl-CoA: 23.9
Ethylmalonyl-CoA: 22.4
CHC-CoA: 18.0
Isobutyryl-CoA: 17.9
Acetyl-CoA: 15.7
Benzoyl-CoA: 14.4
fatty_acid: 10.4
2-Methylbutyryl-CoA: 9.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3635..3930): mmal

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 183.8
Ethylmalonyl-CoA: 183.2
Methoxymalonyl-CoA: 165.6
2-Methylbutyryl-CoA: 121.1
trans-1,2-CPDA: 108.5
Propionyl-CoA: 105.1
Malonyl-CoA: 100.9
CHC-CoA: 86.7
Isobutyryl-CoA: 65.8
Acetyl-CoA: 48.0
Benzoyl-CoA: 45.3
fatty_acid: 33.2
3-Methylbutyryl-CoA: 30.4
inactive: 29.6

PKS_AT (5129..5395): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.0
inactive: 107.4
Methoxymalonyl-CoA: 78.8
Methylmalonyl-CoA: 77.4
Ethylmalonyl-CoA: 49.6
Isobutyryl-CoA: 46.5
Propionyl-CoA: 43.1
Acetyl-CoA: 29.1
Benzoyl-CoA: 25.3
trans-1,2-CPDA: 21.1
fatty_acid: 20.5
2-Methylbutyryl-CoA: 17.9
CHC-CoA: 17.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (6539..6796): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 194.6
inactive: 83.8
Methoxymalonyl-CoA: 60.9
Methylmalonyl-CoA: 47.5
Isobutyryl-CoA: 39.3
Acetyl-CoA: 22.8
Benzoyl-CoA: 19.2
Propionyl-CoA: 17.7
Ethylmalonyl-CoA: 16.1
CHC-CoA: 5.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (7878..8166): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 181.7
inactive: 89.2
Methoxymalonyl-CoA: 65.8
Methylmalonyl-CoA: 54.1
Isobutyryl-CoA: 43.5
Ethylmalonyl-CoA: 20.9
Acetyl-CoA: 19.4
Benzoyl-CoA: 18.6
Propionyl-CoA: 8.2
2-Methylbutyryl-CoA: 6.9
CHC-CoA: 6.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_CP095376.1 - Region 30 - T2PKS

Download region SVG

Location: 5,230,931 - 5,303,467 nt. (total: 72,537 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

MUY14_RS22490: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

MUY14_RS22510: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MUY14_RS22550: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MUY14_RS22575: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

MUY14_RS47140: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acetyltransferase aminotransferase carbamoyltransferase carboxylase formyltransferase glycosyltransferase methyltransferase transferase

MUY14_RS22420: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

MUY14_RS22475: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

MUY14_RS22480: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

MUY14_RS22495: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

MUY14_RS22500: methyltransferase

smcogs: SMCOG1089: methyltransferase

MUY14_RS22525: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

MUY14_RS22625: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

MUY14_RS22655: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

MUY14_RS22695: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase peptidase

MUY14_RS22405: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

MUY14_RS22425: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

MUY14_RS22680: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: cyclase dehydratase

MUY14_RS22485: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

MUY14_RS22545: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

MUY14_RS22570: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Ligases: synthase

MUY14_RS22560: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MUY14_RS22565: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS22640: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

MUY14_RS22705: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000203.3	0.98	PKS	BE-7585A	Amycolatopsis orientalis subsp. vinearia
BGC0000231.5	0.82	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.79	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.77	PKS	oviedomycin	Streptomyces antibioticus
BGC0002672.2	0.61	PKS	saccharothrixin D, saccharothrixin E, saccharothrixin F, saccharothrixin G, saccharothrixin H, saccharothrixin I, saccharothrixin J, saccharothrixin K, saccharothrixin L, saccharothrixin M	Saccharothrix sp.
BGC0002070.3	0.60	PKS	SEK90, pentangumycin	Saccharothrix espanaensis DSM 44229
BGC0002047.2	0.60	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0000201.5	0.59	PKS, saccharide	auricin	Streptomyces aureofaciens
BGC0002712.2	0.58	PKS	WS-5995 D, WS-5995 B, WS-5995 C, SEK 43	Streptomyces yanglinensis
BGC0002000.4	0.58	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000203.3	0.98	PKS	BE-7585A	Amycolatopsis orientalis subsp. vinearia
BGC0000231.5	0.82	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.79	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.77	PKS	oviedomycin	Streptomyces antibioticus
BGC0002672.2	0.61	PKS	saccharothrixin D, saccharothrixin E, saccharothrixin F, saccharothrixin G, saccharothrixin H, saccharothrixin I, saccharothrixin J, saccharothrixin K, saccharothrixin L, saccharothrixin M	Saccharothrix sp.
BGC0002070.3	0.60	PKS	SEK90, pentangumycin	Saccharothrix espanaensis DSM 44229
BGC0002047.2	0.60	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0000201.5	0.59	PKS, saccharide	auricin	Streptomyces aureofaciens
BGC0002712.2	0.58	PKS	WS-5995 D, WS-5995 B, WS-5995 C, SEK 43	Streptomyces yanglinensis
BGC0002000.4	0.58	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.06 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.21 out of 23.79

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.52 out of 27.04

Confidence: medium

Additional weak hits (13):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.35 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 20.06 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.48 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.36 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.01 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.24 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.71 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.19 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.72 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.72 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.28 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 36.53

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 5230930 to 5303467
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 8|9 (Score: 683.9; E-value: 1.4e-208)
Product class(es):: angucycline
Product molecular weight(s):: acetyl-CoA_8: 561 Da
acetyl-CoA_9: 603 Da

MUY14_RS22495: GT (Score: 426.9; E-value: 2.2e-130)
MUY14_RS22510: OXY (Score: 20.7; E-value: 4.3e-07)
MUY14_RS22545: CYC C7-C12 (Score: 476.0; E-value: 9.6e-146)
MUY14_RS22550: KR C9 (Score: 473.2; E-value: 4.6e-145)
MUY14_RS22555: ACP (Score: 111.1; E-value: 4.5e-35)
MUY14_RS22560: CLF 8|9 (Score: 683.9; E-value: 1.4e-208)
MUY14_RS22565: KS (Score: 778.8; E-value: 2.6e-237)
MUY14_RS22570: CYC C4-C17/C2-C19 (Score: 194.4; E-value: 4.3e-60)
MUY14_RS22575: OXY (Score: 601.9; E-value: 2e-183)
MUY14_RS47140: OXY (Score: 570.0; E-value: 9.7e-174)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism

NZ_CP095376.1 - Region 31 - NI-siderophore

Download region SVG

Location: 5,325,093 - 5,354,823 nt. (total: 29,731 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

MUY14_RS22860: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MUY14_RS22900: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

MUY14_RS22920: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

MUY14_RS22945: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

MUY14_RS22970: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: aminotransferase

MUY14_RS22960: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: decarboxylase

MUY14_RS22925: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.67	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0001478.5	0.64	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000244.4	0.63	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0000941.3	0.62	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001453.5	0.59	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002305.2	0.58	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.58	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002620.2	0.58	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002073.3	0.55	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.67	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0001478.5	0.64	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000244.4	0.63	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0000941.3	0.62	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001453.5	0.59	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002305.2	0.58	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.58	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002620.2	0.58	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002073.3	0.55	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 24.63 out of 24.78

Confidence: strong

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.15 out of 29.65

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

Additional weak hits (11):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.96 out of 25.75

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.60 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.63 out of 23.43

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.60 out of 30.22

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.72 out of 30.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.97 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.53 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.70 out of 36.53

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.18 out of 27.55

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP095376.1 - Region 32 - RiPP-like

Download region SVG

Location: 5,372,865 - 5,383,665 nt. (total: 10,801 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: dehydratase

MUY14_RS23140: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.51	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0001521.3	0.30	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002294.3	0.29	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002805.2	0.25	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0000157.5	0.25	PKS	tautomycetin	Streptomyces sp. CK4412
BGC0002788.2	0.24	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001706.3	0.23	terpene	nodulisporic acid F	Hypoxylon pulicicidum
BGC0000992.4	0.23	NRPS, PKS	fusaridione A, (3R,5S)-5-(4-hydroxybenzyl)-3-methyl-3-((2E,4E,6E,8E,10E)-4,8,10-trimethyldodeca-2,4,6,8,10-pentaenoyl)pyrrolidine-2,4-dione	Fusarium heterosporum
BGC0001156.5	0.22	terpene	platencin	Streptomyces platensis
BGC0002025.4	0.22	NRPS, PKS	thaxteramide C	Jahnella sp. MSr9139

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.51	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0001521.3	0.30	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002294.3	0.29	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002805.2	0.25	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0000157.5	0.25	PKS	tautomycetin	Streptomyces sp. CK4412
BGC0002788.2	0.24	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001706.3	0.23	terpene	nodulisporic acid F	Hypoxylon pulicicidum
BGC0000992.4	0.23	NRPS, PKS	fusaridione A, (3R,5S)-5-(4-hydroxybenzyl)-3-methyl-3-((2E,4E,6E,8E,10E)-4,8,10-trimethyldodeca-2,4,6,8,10-pentaenoyl)pyrrolidine-2,4-dione	Fusarium heterosporum
BGC0001156.5	0.22	terpene	platencin	Streptomyces platensis
BGC0002025.4	0.22	NRPS, PKS	thaxteramide C	Jahnella sp. MSr9139

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CP095376.1 - Region 33 - terpene

Download region SVG

Location: 5,745,266 - 5,768,733 nt. (total: 23,468 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

MUY14_RS24830: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

MUY14_RS24845: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Ligases: synthetase

MUY14_RS24825: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.57	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.56	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.53	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.53	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.52	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.48	terpene	carotenoid	Myxococcus xanthus
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.44	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.57	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.56	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.53	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.53	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.52	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.48	terpene	carotenoid	Myxococcus xanthus
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.44	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

MUY14_RS24825: PT_FPPS_like

Domain 1 (46 - 344): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

MUY14_RS24835: PT_phytoene_like

Domain 1 (14 - 299): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.88 out of 23.79

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 28.40 out of 29.65

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.19 out of 24.78

Confidence: medium

Additional weak hits (9):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.17 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.34 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.88 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.20 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.42 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.83 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.93 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response

NZ_CP095376.1 - Region 34 - terpene-precursor

Download region SVG

Location: 6,612,189 - 6,633,199 nt. (total: 21,011 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

MUY14_RS28975: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002610.3	0.42	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.42	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000554.4	0.40	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000516.4	0.39	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0002703.2	0.39	ribosomal	archalan α	Halorussus salinus
BGC0000528.5	0.39	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002610.3	0.42	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.42	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000554.4	0.40	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000516.4	0.39	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0002703.2	0.39	ribosomal	archalan α	Halorussus salinus
BGC0000528.5	0.39	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

MUY14_RS28975: PT_FPPS_like

Domain 1 (57 - 335): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 26.96 out of 32.93

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.20 out of 19.26

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 32.38 out of 32.38

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 23.43

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (4):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.73 out of 31.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.67 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
CsoR	Copper-responsive repressor
RicR	Copper-responsive regulator

NZ_CP095376.1 - Region 35 - terpene

Download region SVG

Location: 6,824,462 - 6,846,624 nt. (total: 22,163 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

MUY14_RS29970: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MUY14_RS29975: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

MUY14_RS29985: methyltransferase

smcogs: SMCOG1248: methyltransferase

Lyases: cyclase

MUY14_RS30005: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001201.3	0.57	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0002043.3	0.53	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002127.3	0.48	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000844.5	0.46	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000285.5	0.39	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001841.2	0.38	NRPS, PKS	detoxin P1, detoxin P2, detoxin P3	Amycolatopsis jejuensis
BGC0002582.3	0.37	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0000470.6	0.37	ribosomal	bottromycin D	Streptomyces sp. WMMB272

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001201.3	0.57	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0002043.3	0.53	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002127.3	0.48	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000844.5	0.46	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000285.5	0.39	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001841.2	0.38	NRPS, PKS	detoxin P1, detoxin P2, detoxin P3	Amycolatopsis jejuensis
BGC0002582.3	0.37	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0000470.6	0.37	ribosomal	bottromycin D	Streptomyces sp. WMMB272

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

MUY14_RS30005: T1TS + T1TS

Domain 1 (2 - 330): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (342 - 688): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.34 out of 20.97

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.36 out of 23.79

Confidence: medium

Additional weak hits (8):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.43 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.76 out of 24.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.73 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.25 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.07 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.75 out of 23.43

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP095376.1 - Region 36 - lanthipeptide-class-iii

BGC0002120.3 (NQE92413.1):

Download region SVG

Location: 7,794,786 - 7,817,341 nt. (total: 22,556 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase

MUY14_RS34815: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000513.3	0.76	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.62	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000518.3	0.53	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000553.3	0.50	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002111.3	0.49	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000546.3	0.45	ribosomal	SAL-2242	Streptomyces albidoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000513.3	0.76	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.62	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000518.3	0.53	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000553.3	0.50	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002111.3	0.49	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000546.3	0.45	ribosomal	SAL-2242	Streptomyces albidoflavus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for MUY14_RS34845

MUY14_RS34840

Leader:

MELVLELQAMETPEVLDGGHG

Core:

GHGGGTSNLSLLAACAHSTLSLLTCC

Core with dehydrations:

GHGGGDhbDhaNLDhaLLAACysAHDhaDhbLDhaLLDhbCysCys

antiSMASH-DB 4.0 matches for MUY14_RS34840

100.0%

NZ_CP095376.1:

Lanthipeptides: MUY14_RS34840_lanthipeptide

1

GHGGGTSNLSLLAACAHSTLSLLTCC

26

GHGGGTSNLSLLAACAHSTLSLLTCC

1

GHGGGTSNLSLLAACAHSTLSLLTCC

26

84.6%

NZ_KB913037.1:

Lanthipeptides: A3CE_RS56710_lanthipeptide

1

GHGGGTSNLSLLAACAHSTLSLLTC

25

G G GTSNLSLLA CAHSTLSLLTC

1

GGGCGTSNLSLLAGCAHSTLSLLTC

25

76.9%

NZ_BNAY01000004.1and 1 other:

NZ_MUXN01000005.1 Lanthipeptides: B0293_RS43005_lanthipeptide

Lanthipeptides: IE302_RS20620_lanthipeptide

1

GHGGGTSNLSLLAACAHSTLSLLTC

25

G GGTSNLSLLA+CA ST+SLLTC

1

GSHGGTSNLSLLASCADSTISLLTC

25

with 69 more sequence matches

Only the first 10 are displayed here.

76.9%

NZ_CP061007.1:

Lanthipeptides: IAG28_RS39520_lanthipeptide

4

GGTSNLSLLAACAHSTLSLLTC

25

GG+SNLSLLAACAHST+SLLTC

2

GGSSNLSLLAACAHSTVSLLTC

23

76.9%

NZ_FMZZ01000019.1:

Lanthipeptides: BLS56_RS27445_lanthipeptide

1

GHGGGTSNLSLLAACAHSTLSLLTC

25

GHGG SNLSLLA+CA+ST+SLLTC

1

GHGGA-SNLSLLASCANSTVSLLTC

24

75.9%

NZ_CP080519.1:

Lanthipeptides: K1T34_RS20225_lanthipeptide

1

GHG-GGTSNLSLLAACAHSTLSLLTC

25

GHG G SNLSLLA+CAHSTLSLLTC

3

GHGHGAPSNLSLLASCAHSTLSLLTC

28

73.1%

NC_021252.1and 9 others:

NZ_CP008953.1 Lanthipeptides: AJAP_RS43890_lanthipeptideNZ_CP024972.1 Lanthipeptides: CVV72_RS27155_lanthipeptideNZ_CP092497.1 Lanthipeptides: MJQ72_RS39855_lanthipeptideNZ_CP102415.1 Lanthipeptides: NQK81_RS21060_lanthipeptideNZ_CP120210.1 Lanthipeptides: P3102_RS01815_lanthipeptideNZ_JPLW01000001.1 Lanthipeptides: ED92_RS42365_lanthipeptideNZ_LIWC01000002.1 Lanthipeptides: AMK34_RS42700_lanthipeptideNZ_LQMT02000022.1 Lanthipeptides: AVR91_RS42870_lanthipeptideNZ_LT629789.1 Lanthipeptides: BLU53_RS44680_lanthipeptide

Lanthipeptides: AORI_RS83200_lanthipeptide

1

GHGGGTSNLSLLAACAHSTLSLLTC

25

G GG SNLSLLA+CA+ST+SLLTC

1

GSHGGASNLSLLASCANSTVSLLTC

25

73.1%

NZ_CP031142.1:

Lanthipeptides: DL519_RS00755_lanthipeptide

4

GGTSNLSLLAACAHSTLSLLTC

25

GG SNLSLLAACA ST+SLLTC

2

GGASNLSLLAACAQSTISLLTC

23

73.1%

NZ_CP040605.1:

Lanthipeptides: FDZ84_RS37170_lanthipeptide

4

GGTSNLSLLAACAHSTLSLLTC

25

GG SNLSLLAACA ST+SLLTC

2

GGASNLSLLAACAQSTVSLLTC

23

73.1%

NZ_CP054839.1:

Lanthipeptides: HUO13_RS17795_lanthipeptide

2

HGGGTSNLSLLAACAHSTLSLLTC

25

+GGG SNLSLLA+CA+ST+SLLTC

1

YGGGASNLSLLASCANSTVSLLTC

24

73.1%

NZ_FOEF01000044.1:

Lanthipeptides: BMY97_RS44620_lanthipeptide

1

GHGGGTSNLSLLAACAHSTLSLLTC

25

G GG SNLSLLA+C +STLSLLTC

1

GGGGAPSNLSLLASCTNSTLSLLTC

25

71.4%

NZ_FNON01000002.1:

Lanthipeptides: BLV57_RS10465_lanthipeptide

1

GHGGG-TSNLSLLAACAHSTLSLLTC

25

GHGGG SNLSLLA+C +ST+SLLTC

2

GHGGGEPSNLSLLASCTNSTISLLTC

27

69.2%

NZ_BMRB01000005.1and 1 other:

NZ_CP031087.1 Lanthipeptides: Actkin_RS09240_lanthipeptide

Lanthipeptides: IEY98_RS25135_lanthipeptide

3

GGGTSNLSLLAACAHSTLSLLTC

25

GGG SNLSL+A+CA+ST+SLLTC

1

GGGASNLSLIASCANSTISLLTC

23

MIBiG 4.0 matches for MUY14_RS34840

19.6%

Lanthipeptide: nocathioamide A

10

SLLAACAHSTLSLLTCC

26

S AA A TLS L CC

33

SRPAAPACHTLSSLPCC

49

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (8):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.62 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.68 out of 20.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.64 out of 28.14

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.79 out of 30.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.88 out of 28.19

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

MUY14_RS34840 - Class III

Cleavage pHMM score: 10.80

RODEO score: 0

Monoisotopic mass: 2360.2 Da

Molecular weight: 2361.7 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2379.7 Da N = 1; 2397.7 Da N = 2; 2415.8 Da N = 3; 2433.8 Da N = 4

TFBS definitions

Regulator	Description

NZ_CP095376.1 - Region 37 - ectoine

Download region SVG

Location: 8,979,349 - 8,989,741 nt. (total: 10,393 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

MUY14_RS40725: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.81	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.79	other (other)	ectoine	Sporosarcina pasteurii
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000856.3	0.65	other (other)	ectoine	Methylophaga thalassica
BGC0000854.3	0.64	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000857.3	0.64	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.81	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.79	other (other)	ectoine	Sporosarcina pasteurii
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000856.3	0.65	other (other)	ectoine	Methylophaga thalassica
BGC0000854.3	0.64	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000857.3	0.64	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.29 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.76 out of 32.74

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.87 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.63 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CP095376.1 - Region 38 - redox-cofactor

Download region SVG

Location: 9,839,585 - 9,861,592 nt. (total: 22,008 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

MUY14_RS44960: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

MUY14_RS45015: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

MUY14_RS45020: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

MUY14_RS45035: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: amidase

MUY14_RS44965: amidase

smcogs: SMCOG1105: amidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000671.3	0.42	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002181.3	0.40	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000904.5	0.39	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0001882.3	0.39	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0000937.5	0.39	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001940.3	0.39	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0000207.5	0.38	PKS	chartreusin	Streptomyces chartreusis
BGC0000845.5	0.38	other (non-nrp beta-lactam)	clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0001739.3	0.38	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000671.3	0.42	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002181.3	0.40	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000904.5	0.39	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0001882.3	0.39	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0000937.5	0.39	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001940.3	0.39	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0000207.5	0.38	PKS	chartreusin	Streptomyces chartreusis
BGC0000845.5	0.38	other (non-nrp beta-lactam)	clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0001739.3	0.38	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (3):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.01 out of 20.97

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.26 out of 29.51

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 1 - 85; Score: 84.6

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP095376.1 - Region 39 - hglE-KS

Download region SVG

Location: 10,043,578 - 10,093,182 nt. (total: 49,605 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase synthase

MUY14_RS46070: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

MUY14_RS46155: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

MUY14_RS46160: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase methyltransferase

MUY14_RS46185: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

MUY14_RS46275: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: amidase hydrolase synthase

MUY14_RS46070: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

MUY14_RS46085: amidase

smcogs: SMCOG1105: amidase

MUY14_RS46180: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

MUY14_RS46165: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MUY14_RS46170: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MUY14_RS46260: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0000863.3	0.52	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0000863.3	0.52	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.33 out of 30.25

Confidence: medium

Additional weak hits (18):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.11 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.93 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.78 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.42 out of 39.62

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.55 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.99 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.62 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.26 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.71 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.34 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.66 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.49 out of 20.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.52 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.84 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.09 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 58, location 10043577 - 10093182:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (pk)
Non-colinear ordering:: MUY14_RS46170 + MUY14_RS46175

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

MUY14_RS46165: mal

PKS_AT (987..1270): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 101.7
Methylmalonyl-CoA: 43.4
Propionyl-CoA: 40.4
Methoxymalonyl-CoA: 39.8
inactive: 30.5
Ethylmalonyl-CoA: 21.9
Benzoyl-CoA: 14.8
CHC-CoA: 14.3
trans-1,2-CPDA: 13.2
fatty_acid: 9.4
2-Methylbutyryl-CoA: 6.0
Isobutyryl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

MUY14_RS46170: pk

PKS_AT (593..800): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 11.1
Methoxymalonyl-CoA: 10.2
Malonyl-CoA: 6.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MUY14_RS46260: X

AMP-binding (20..345): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NQAS--LSLSDG--ASTTDRVCYRVPEATALVAC
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)