GCF_022376295.1 - 17 region(s)

Download region SVG

Location: 419,485 - 447,820 nt. (total: 28,336 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BDGGKGIB_RS01935: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BDGGKGIB_RS01960: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: dehalogenase hydrolase

BDGGKGIB_RS01910: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

BDGGKGIB_RS01975: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.53	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000575.5	0.52	ribosomal	lariatin	Rhodococcus jostii
BGC0001634.3	0.51	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000571.3	0.50	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001551.4	0.49	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001889.2	0.49	ribosomal	fusilassin	Thermobifida fusca YX
BGC0002322.3	0.49	ribosomal	citrocin	Citrobacter pasteurii
BGC0000675.5	0.47	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.53	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000575.5	0.52	ribosomal	lariatin	Rhodococcus jostii
BGC0001634.3	0.51	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000571.3	0.50	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001551.4	0.49	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001889.2	0.49	ribosomal	fusilassin	Thermobifida fusca YX
BGC0002322.3	0.49	ribosomal	citrocin	Citrobacter pasteurii
BGC0000675.5	0.47	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.09 out of 29.72

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 25.94 out of 32.38

Confidence: medium

Additional weak hits (4):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.43 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.77 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.91 out of 32.93

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.95 out of 32.74

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 9 - 92; Score: 79.6

TFBS definitions

Regulator	Description
CsoR	Copper-responsive repressor
NtrC	Nitrogen regulatory protein C

NZ_CP060140.1 - Region 2 - NRP-metallophore,NRPS,T1PKS

Download region SVG

Location: 897,117 - 991,845 nt. (total: 94,729 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase carbamoyltransferase methyltransferase

BDGGKGIB_RS03940: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

BDGGKGIB_RS04015: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

BDGGKGIB_RS04020: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: esterase

BDGGKGIB_RS04105: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

BDGGKGIB_RS04025: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: mutase racemase

BDGGKGIB_RS03920: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

BDGGKGIB_RS03965: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

BDGGKGIB_RS03995: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BDGGKGIB_RS04030: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BDGGKGIB_RS04035: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BDGGKGIB_RS04040: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BDGGKGIB_RS04045: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BDGGKGIB_RS04050: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BDGGKGIB_RS04055: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BDGGKGIB_RS04060: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BDGGKGIB_RS04065: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	1.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	1.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	1.56	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	1.52	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	1.48	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	1.48	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	1.48	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	1.47	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	1.46	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.76	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	0.72	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.70	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 22.87 out of 26.33

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.06 out of 26.06

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.06 out of 30.25

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 25.31

Confidence: medium

Additional weak hits (8):

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.61 out of 30.11

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.37 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.62 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.71 out of 23.43

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.55 out of 32.74

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 21.73 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 21.23 out of 30.11

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 897116 - 991845:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (Gly - D-Val) + (Gly) + (ohmal) + (Ala - Cys) + (Gly - D-Ala) + (Ser) + (X) + (ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 897116 - 941835:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - D-Ala) + (Ser) + (X) + (ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 901913 - 991845:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (Gly - D-Val) + (Gly) + (ohmal) + (Ala - Cys) + (Gly - D-Ala) + (Ser) + (X) + (ohmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BDGGKGIB_RS03995: mal

PKS_AT (561..848): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 145.1
inactive: 95.5
Methoxymalonyl-CoA: 59.7
Methylmalonyl-CoA: 46.7
Propionyl-CoA: 34.4
CHC-CoA: 26.2
Ethylmalonyl-CoA: 24.4
2-Methylbutyryl-CoA: 23.9
Isobutyryl-CoA: 18.9
Benzoyl-CoA: 13.7
Acetyl-CoA: 8.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

BDGGKGIB_RS04030: X

AMP-binding (539..948): X

nrpys: 3-ohTyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LHKFFDASIPEMTILVGGEINAYGPTEVTVNASM
Nearest Stachelhaus code(s):: 3-ohTyr DAPTLGAVNK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

BDGGKGIB_RS04035: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (465..882): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAIDVTY
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

BDGGKGIB_RS04040: Gly - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (480..897): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDIAALELQALCGGEWNLYGPTETTIWSAA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1610..2034): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDLSVFEVNTNLAGEYNLYGPSEDTTYSTF
Nearest Stachelhaus code(s):: Ala DLFNNALTYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

BDGGKGIB_RS04045: Ala - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (502..899): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDLSVFEVNTNLAGEFNLYGPSEDTTYSTY
Nearest Stachelhaus code(s):: Ala DLFNNALTYK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1559..1994): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNSLLSGDISLGGATEASIWSIF
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

BDGGKGIB_RS04050: mal

PKS_AT (529..812): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 147.8
inactive: 108.8
Methylmalonyl-CoA: 55.1
Methoxymalonyl-CoA: 53.5
Propionyl-CoA: 32.9
Ethylmalonyl-CoA: 28.8
2-Methylbutyryl-CoA: 28.3
Benzoyl-CoA: 22.6
CHC-CoA: 19.9
Isobutyryl-CoA: 18.8
Acetyl-CoA: 15.6
fatty_acid: 15.0
trans-1,2-CPDA: 10.1
3-Methylbutyryl-CoA: 0.0

BDGGKGIB_RS04055: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (475..871): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: IDLTFDIAALELQALCGGEWNLYGPTETTIWSAA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

BDGGKGIB_RS04060: Gly - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (463..848): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LALTFDIAALELQALCGGEWNLYGPTETTIWSAA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1524..1935): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDCAFDASTFEGWLIAGGDINGYGPTENTTFTCC
Nearest Stachelhaus code(s):: Val DAFWIGGTFK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

BDGGKGIB_RS04065: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (523..989): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDATITSTKLIIGGEINEYGPTETVVGCCV
Nearest Stachelhaus code(s):: Asn DATKIGEVGK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor
ColR	Phenol-responsive regulator
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_CP060140.1 - Region 3 - NRPS-like,T1PKS

Download region SVG

Location: 993,724 - 1,052,381 nt. (total: 58,658 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

BDGGKGIB_RS04135: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase synthase

BDGGKGIB_RS04165: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BDGGKGIB_RS04170: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BDGGKGIB_RS04175: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.87	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.87	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001163.3	0.66	PKS	1-heptadecene	Moorea producens 3L
BGC0000041.3	0.60	PKS	oronofacic acid	Pseudomonas syringae
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0001254.3	0.59	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.75	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.75	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001163.3	0.67	PKS	1-heptadecene	Moorea producens 3L
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 25.59 out of 27.78

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.16 out of 26.33

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.83 out of 29.72

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.89 out of 29.72

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.21 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.10 out of 26.06

Confidence: medium

Additional weak hits (11):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.14 out of 25.88

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.84 out of 32.74

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.68 out of 29.25

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.76 out of 29.51

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.72 out of 26.06

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 20.62 out of 29.51

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.30 out of 32.74

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.39 out of 35.63

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.98 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.78 out of 26.85

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.73 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 993723 - 1052381:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (NH2) + (Me-redmal) + (Me-redmal)
Non-colinear ordering:: BDGGKGIB_RS04165 + BDGGKGIB_RS04170 + BDGGKGIB_RS04175

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 993723 - 1037359:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (NH2) + (Me-redmal) + (Me-redmal)
Non-colinear ordering:: BDGGKGIB_RS04165 + BDGGKGIB_RS04170 + BDGGKGIB_RS04175

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 997416 - 1052381:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (NH2) + (Me-redmal) + (Me-redmal)
Non-colinear ordering:: BDGGKGIB_RS04165 + BDGGKGIB_RS04170 + BDGGKGIB_RS04175

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BDGGKGIB_RS04165: NH2

CAL_domain (47..467): NH2

minowa: NH2

Prediction, score:

NH2: 26.9
fatty_acid: 21.9
AHBA: 16.0
shikimic_acid: 8.8
Acetyl-CoA: -1.9

BDGGKGIB_RS04170: mal

PKS_AT (558..854): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 95.8%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 180.9
inactive: 169.1
Methoxymalonyl-CoA: 55.4
Methylmalonyl-CoA: 37.0
Propionyl-CoA: 27.1
Isobutyryl-CoA: 20.1
Benzoyl-CoA: 18.3
2-Methylbutyryl-CoA: 14.4
Acetyl-CoA: 9.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BDGGKGIB_RS04175: mal

PKS_AT (556..853): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.3
inactive: 159.5
Methoxymalonyl-CoA: 53.9
Methylmalonyl-CoA: 43.6
Propionyl-CoA: 31.6
Isobutyryl-CoA: 22.1
Benzoyl-CoA: 19.9
Ethylmalonyl-CoA: 16.9
2-Methylbutyryl-CoA: 15.2
Acetyl-CoA: 9.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes
NtrC	Nitrogen regulatory protein C

NZ_CP060140.1 - Region 4 - lanthipeptide-class-ii

Download region SVG

Location: 1,378,691 - 1,400,634 nt. (total: 21,944 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase

BDGGKGIB_RS05530: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Lyases: cyclase

BDGGKGIB_RS05555: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.4	0.57	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001210.5	0.57	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000525.5	0.52	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000527.5	0.52	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001579.4	0.50	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000590.5	0.50	ribosomal	microcin N	Escherichia coli
BGC0001576.3	0.49	ribosomal	divamide A	Prochloron didemni
BGC0002703.2	0.49	ribosomal	archalan α	Halorussus salinus
BGC0000504.5	0.48	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000558.5	0.48	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.4	0.57	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001210.5	0.57	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000525.5	0.52	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000527.5	0.52	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001579.4	0.50	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000590.5	0.50	ribosomal	microcin N	Escherichia coli
BGC0001576.3	0.49	ribosomal	divamide A	Prochloron didemni
BGC0002703.2	0.49	ribosomal	archalan α	Halorussus salinus
BGC0000504.5	0.48	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000558.5	0.48	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for BDGGKGIB_RS05555

BDGGKGIB_RS05565

Leader:

MSNIDIIRAWKDEEYRQSLSAEQQEKLPANPAGLVELNDEDMSSISGG

Core:

CTTCGDPFHTWSVGCKPIGAEELSF

Core with dehydrations:

CysDhbDhbCysGDPFHDhbWDhaVGCysKPIGAEELDhaF

antiSMASH-DB 4.0 matches for BDGGKGIB_RS05565

100.0%

NZ_CP060140.1:

Lanthipeptides: BDGGKGIB_RS05565_lanthipeptide

1

CTTCGDPFHTWSVGCKPIGAEELSF

25

CTTCGDPFHTWSVGCKPIGAEELSF

1

CTTCGDPFHTWSVGCKPIGAEELSF

25

92.0%

NZ_VIKW01000003.1:

Lanthipeptides: FJR04_RS03310_lanthipeptide

1

CTTCGDPFHTWSVGCKPIGAEELSF

25

CTTCGDPFHT VGCKPIGAEELSF

1

CTTCGDPFHTLWVGCKPIGAEELSF

25

51.9%

NZ_CP034058.1:

Lanthipeptides: EH233_RS23850_lanthipeptide

1

CTTCGDPFHTWSVGCKPI-GAEE

22

CTTCG+P HT + CKP+ GA E

1

CTTCGNPLHTPIIKCKPVFGALE

23

with 7 more sequence matches

40.7%

NC_019684.1:

Lanthipeptides: NOS7524_RS02390_lanthipeptide

1

CTTCGDPFHTWSVGCKPIGAE

21

CTTCG+P HT + CK + E

1

CTTCGNPLHTPIIKCKAVFGE

21

38.5%

NZ_CP051206.1:

Lanthipeptides: HGD76_RS14160_lanthipeptide

1

CTTCGDPFHTWSVGCKPIGA

20

CTTCG+P HT CK + +

1

CTTCGNPLHTLFWTCKAVSS

20

30.0%

NZ_JQKG01000002.1and 1 other:

NZ_JQKG01000002.1 Lanthipeptides: Q371_RS26760_lanthipeptide

Lanthipeptides: Q371_RS26765_lanthipeptide

1

CTTCG-DPFHTWSVGC

15

C T G D + TWS GC

7

CNTIGTDEWSTWSEGC

22

30.0%

NZ_JQKG01000002.1:

Lanthipeptides: Q371_RS26755_lanthipeptide

1

CTTCG-DPFHTWSVGC

15

C T G D + TWS GC

7

CNTVGTDEWSTWSEGC

22

28.0%

NC_019738.1:

Lanthipeptides: MIC7113_RS14485_lanthipeptide

1

CTTCGDPFHT

10

CT CG+P HT

1

CTPCGNPLHT

10

24.0%

NZ_CP058259.1and 1 other:

NZ_MSQE01000005.1 Lanthipeptides: allorf_114261_114458_lanthipeptide

Lanthipeptides: allorf_2945427_2945657_lanthipeptide

4

CGDPFHTWSVGCK

16

C + TWS GC+

9

CNVSWSTWSAGCR

21

16.7%

NZ_FNGC01000009.1:

Lanthipeptides: allorf_108834_108992_lanthipeptide

1

CTTCGDPFHTWSVG

14

T CG+ WSVG

12

ATVCGEQAGVWSVG

25

allorf_1399303_1399437

Leader:

MLYQFSSELGMEERA

Core:

SLPSTTRFIILKFLLYLFAKCCISYLYFK

Core with dehydrations:

DhaLPDhaDhbDhbRFIILKFLLYLFAKCysCysIDhaYLYFK

antiSMASH-DB 4.0 matches for allorf_1399303_1399437

100.0%

NZ_CP060140.1:

Lanthipeptides: allorf_1399303_1399437_lanthipeptide

1

SLPSTTRFIILKFLLYLFAKCCISYLYFK

29

SLPSTTRFIILKFLLYLFAKCCISYLYFK

1

SLPSTTRFIILKFLLYLFAKCCISYLYFK

29

21.1%

NZ_KQ040792.1and 1 other:

NZ_KQ040792.1 Lanthipeptides: allorf_500346_500489_lanthipeptide

Lanthipeptides: allorf_500346_500489_lanthipeptide

2

LPSTTRFIILKFLLYLFAK

20

+PS R + F YLFA

5

IPSENRKLKALFRRYLFAD

23

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.48 out of 27.55

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.18 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.30 out of 27.78

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.71 out of 26.85

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.87 out of 18.16

Confidence: strong

Additional weak hits (4):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.19 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 25.13 out of 31.73

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.95 out of 25.88

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.11 out of 25.88

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

BDGGKGIB_RS05565 - Class II

Cleavage pHMM score: -3.80

RODEO score: 0

Monoisotopic mass: 2594.2 Da

Molecular weight: 2595.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2613.9 Da N = 1; 2631.9 Da N = 2

allorf_1399303_1399437 - Class II

Cleavage pHMM score: -6.10

RODEO score: 0

Monoisotopic mass: 3400.9 Da

Molecular weight: 3403.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3421.2 Da N = 1; 3439.2 Da N = 2; 3457.2 Da N = 3

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
GnfM	Regulator of nitrogen-fixation genes
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP060140.1 - Region 5 - lanthipeptide-class-v

Download region SVG

Location: 1,415,681 - 1,458,036 nt. (total: 42,356 nt) Show pHMM detection rules used

lanthipeptide-class-v: (APH and HopA1)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

BDGGKGIB_RS05695: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

BDGGKGIB_RS05700: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Hydrolases: hydrolase

BDGGKGIB_RS05825: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Isomerases: isomerase racemase

BDGGKGIB_RS05760: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

BDGGKGIB_RS05770: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

BDGGKGIB_RS05755: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000913.3	0.41	other (other)	MK-8	Enterobacter cloacae
BGC0000842.5	0.40	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000649.3	0.39	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002571.2	0.39	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0002439.3	0.38	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0002473.3	0.38	NRPS	propanochelin, butanochelin, pentanochelin	Acinetobacter bouvetii DSM 14964 = CIP 107468
BGC0002047.2	0.38	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0002000.4	0.38	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0001380.3	0.38	saccharide	salecan	Agrobacterium sp. ZX09
BGC0000871.4	0.38	other (nucleoside)	VEPE, AEPE, TG-1	Myxococcus xanthus DK 1622

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000913.3	0.41	other (other)	MK-8	Enterobacter cloacae
BGC0000842.5	0.40	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000649.3	0.39	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002571.2	0.39	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0002439.3	0.38	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0002473.3	0.38	NRPS	propanochelin, butanochelin, pentanochelin	Acinetobacter bouvetii DSM 14964 = CIP 107468
BGC0002047.2	0.38	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0002000.4	0.38	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0001380.3	0.38	saccharide	salecan	Agrobacterium sp. ZX09
BGC0000871.4	0.38	other (nucleoside)	VEPE, AEPE, TG-1	Myxococcus xanthus DK 1622

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.93 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.35 out of 26.06

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.77 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.57 out of 27.78

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.85 out of 23.79

Confidence: medium

Additional weak hits (4):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.42 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.74 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.93 out of 32.74

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.06 out of 29.25

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
MogR	Repressor of flagellar motility genes

NZ_CP060140.1 - Region 6 - terpene

Download region SVG

Location: 1,568,782 - 1,589,714 nt. (total: 20,933 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BDGGKGIB_RS06355: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

BDGGKGIB_RS06390: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: methyltransferase

BDGGKGIB_RS06365: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000656.5	0.46	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000645.3	0.45	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000646.5	0.42	terpene	β-carotein	uncultured bacterium
BGC0000664.5	0.40	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000640.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000642.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000643.3	0.40	terpene	carotenoid	Brevundimonas vesicularis
BGC0000639.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000634.3	0.39	terpene	carotenoid	Brevundimonas sp. SD212

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000656.5	0.46	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000645.3	0.45	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000646.5	0.42	terpene	β-carotein	uncultured bacterium
BGC0000664.5	0.40	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000640.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000642.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000643.3	0.40	terpene	carotenoid	Brevundimonas vesicularis
BGC0000639.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000634.3	0.39	terpene	carotenoid	Brevundimonas sp. SD212

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		PSPP	C30	acyclic	PP
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

BDGGKGIB_RS06350: PT_phytoene_like

Domain 1 (18 - 308): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.93 out of 27.78

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.83 out of 29.72

Confidence: medium

Additional weak hits (5):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.08 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.91 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.54 out of 21.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.70 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 25.97 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
NtrC	Nitrogen regulatory protein C
ToxT	Regulator of MSHA biosynthesis

NZ_CP060140.1 - Region 7 - T1PKS,hglE-KS

Download region SVG

Location: 1,786,730 - 1,838,794 nt. (total: 52,065 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BDGGKGIB_RS07190: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

BDGGKGIB_RS07220: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

BDGGKGIB_RS07250: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acylase glycosyltransferase

BDGGKGIB_RS07245: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

BDGGKGIB_RS07260: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BDGGKGIB_RS07330: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Lyases: dehydratase

BDGGKGIB_RS07305: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

BDGGKGIB_RS07265: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BDGGKGIB_RS07275: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000869.5	1.18	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	0.55	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002648.2	0.54	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000861.5	0.54	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000863.3	0.53	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001257.3	0.52	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.52	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000869.5	0.83	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'
BGC0001276.3	0.62	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002648.2	0.61	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000861.5	0.60	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000863.3	0.60	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.59	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.83 out of 26.06

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.48 out of 20.97

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.32 out of 24.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.57 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.63 out of 28.19

Confidence: medium

Additional weak hits (5):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.06 out of 29.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.09 out of 32.74

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.91 out of 23.43

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.72 out of 19.52

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 11, location 1786729 - 1838794:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BDGGKGIB_RS07265: pk

PKS_AT (1114..1350): pk

ATSignature: (unknown)

No matches above 50%

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BDGGKGIB_RS07275: mal

PKS_AT (626..924): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 94.4
Methoxymalonyl-CoA: 40.9
inactive: 34.5
Methylmalonyl-CoA: 29.0
fatty_acid: 17.4
Propionyl-CoA: 15.2
CHC-CoA: 15.2
Isobutyryl-CoA: 12.3
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor

NZ_CP060140.1 - Region 8 - PBDE

Download region SVG

Location: 1,872,282 - 1,898,966 nt. (total: 26,685 nt) Show pHMM detection rules used

PBDE: (FMO-like and p450 and DUF98)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase reductase

BDGGKGIB_RS07540: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

BDGGKGIB_RS07545: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

BDGGKGIB_RS07595: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001490.3	0.59	other (pbde)	3,5-dibromo-2-(2,4-dibromophenoxy)phenol, 2,4-dibromo-6-(2,4-dibromophenoxy)phenol	Hormoscilla spongeliae SP4
BGC0002643.2	0.51	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0000584.5	0.46	ribosomal	colicin V	Escherichia coli
BGC0000891.4	0.42	other (aminocoumarin)	pentabromopseudilin	Pseudoalteromonas luteoviolacea 2ta16
BGC0000890.5	0.42	other (aminocoumarin)	pentabromopseudilin	Pseudoalteromonas phenolica O-BC30
BGC0001465.5	0.42	other (other)	bromophene, bistribromopyrrole, pentabromopseudilin	Marinomonas mediterranea MMB-1
BGC0000563.4	0.41	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002298.2	0.41	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0000575.5	0.40	ribosomal	lariatin	Rhodococcus jostii
BGC0002390.2	0.40	terpene	zealexin A1	Zea mays

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001490.3	0.59	other (pbde)	3,5-dibromo-2-(2,4-dibromophenoxy)phenol, 2,4-dibromo-6-(2,4-dibromophenoxy)phenol	Hormoscilla spongeliae SP4
BGC0002643.2	0.51	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0000584.5	0.46	ribosomal	colicin V	Escherichia coli
BGC0000891.4	0.42	other (aminocoumarin)	pentabromopseudilin	Pseudoalteromonas luteoviolacea 2ta16
BGC0000890.5	0.42	other (aminocoumarin)	pentabromopseudilin	Pseudoalteromonas phenolica O-BC30
BGC0001465.5	0.42	other (other)	bromophene, bistribromopyrrole, pentabromopseudilin	Marinomonas mediterranea MMB-1
BGC0000563.4	0.41	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002298.2	0.41	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0000575.5	0.40	ribosomal	lariatin	Rhodococcus jostii
BGC0002390.2	0.40	terpene	zealexin A1	Zea mays

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.42 out of 19.52

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.75 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.33 out of 18.16

Confidence: strong

Additional weak hits (2):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.99 out of 32.74

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.11 out of 26.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_CP060140.1 - Region 9 - lanthipeptide-class-ii

Download region SVG

Location: 1,927,861 - 1,951,178 nt. (total: 23,318 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

BDGGKGIB_RS07745: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.4	0.58	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001210.5	0.54	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001555.4	0.51	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.50	ribosomal	microcin N	Escherichia coli
BGC0000527.5	0.50	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001579.4	0.50	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002703.2	0.49	ribosomal	archalan α	Halorussus salinus
BGC0000503.5	0.46	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002699.2	0.45	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000525.5	0.45	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.4	0.58	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001210.5	0.54	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001555.4	0.51	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.50	ribosomal	microcin N	Escherichia coli
BGC0000527.5	0.50	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001579.4	0.50	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002703.2	0.49	ribosomal	archalan α	Halorussus salinus
BGC0000503.5	0.46	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002699.2	0.45	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000525.5	0.45	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for BDGGKGIB_RS07745

allorf_1944727_1944837

Leader:

MIRKNYFFLNHRDTETQRNTKITNSSSGA

Core:

TLRLCVN

Core with dehydrations:

DhbLRLCysVN

antiSMASH-DB 4.0 matches for allorf_1944727_1944837

100.0%

NZ_CP060140.1:

Lanthipeptides: allorf_1944727_1944837_lanthipeptide

1

TLRLCVN

7

TLRLCVN

1

TLRLCVN

7

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.12 out of 20.97

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.16 out of 26.33

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 23.45 out of 27.55

Confidence: medium

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.25 out of 30.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.59 out of 33.14

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_1944727_1944837 - Class II: Cleavage pHMM score: -5.00; RODEO score: 0; Monoisotopic mass: 799.4 Da; Molecular weight: 800.0 Da; Number of bridges: 1

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CcpA	Catabolite control protein A
GnfM	Regulator of nitrogen-fixation genes
ToxT	Regulator of MSHA biosynthesis

NZ_CP060140.1 - Region 10 - lanthipeptide-class-v

Download region SVG

Location: 2,381,644 - 2,424,119 nt. (total: 42,476 nt) Show pHMM detection rules used

lanthipeptide-class-v: (APH and HopA1)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000590.5	0.52	ribosomal	microcin N	Escherichia coli
BGC0001555.4	0.52	ribosomal	colicin V	Escherichia coli chi7122
BGC0000588.5	0.49	ribosomal	microcin L	Escherichia coli
BGC0000623.3	0.49	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0002674.2	0.46	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0000589.5	0.45	ribosomal	microcin M	Escherichia coli Nissle 1917
BGC0000587.5	0.45	ribosomal	microcin H47	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002698.2	0.45	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000617.5	0.45	ribosomal	coagulin	Bacillus coagulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000590.5	0.52	ribosomal	microcin N	Escherichia coli
BGC0001555.4	0.52	ribosomal	colicin V	Escherichia coli chi7122
BGC0000588.5	0.49	ribosomal	microcin L	Escherichia coli
BGC0000623.3	0.49	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0002674.2	0.46	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0000589.5	0.45	ribosomal	microcin M	Escherichia coli Nissle 1917
BGC0000587.5	0.45	ribosomal	microcin H47	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002698.2	0.45	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000617.5	0.45	ribosomal	coagulin	Bacillus coagulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.86 out of 26.06

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.86 out of 21.84

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.57 out of 27.55

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.22 out of 18.16

Confidence: strong

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 25.35 out of 30.25

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.10 out of 26.85

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.85 out of 28.19

Confidence: medium

Additional weak hits (9):

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 21.22 out of 30.11

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.81 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.25 out of 30.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.76 out of 27.04

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.71 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.24 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.80 out of 32.74

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
ColR	Phenol-responsive regulator
GnfM	Regulator of nitrogen-fixation genes
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes
RutR	Regulator of the pyrimidine and purine metabolism
ZuR variant 1	Zinc-responsive repressor

NZ_CP060140.1 - Region 11 - NRPS-like,T1PKS

Download region SVG

Location: 3,220,196 - 3,270,530 nt. (total: 50,335 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BDGGKGIB_RS13490: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

BDGGKGIB_RS13495: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: methyltransferase

BDGGKGIB_RS13415: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: ligase

BDGGKGIB_RS13430: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0002154.2	0.58	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.58	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001258.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001254.3	0.55	PKS	ACT-Toxin II	Alternaria alternata
BGC0000307.4	0.53	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.53	NRPS	enniatin	Fusarium equiseti
BGC0000037.4	0.51	PKS	cichorine	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001258.3	0.62	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0000037.4	0.59	PKS	cichorine	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.63 out of 27.55

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.22 out of 18.16

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.13 out of 27.78

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.40 out of 27.55

Confidence: medium

Additional weak hits (6):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 20.62 out of 29.51

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.93 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.65 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.25 out of 29.65

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.42 out of 29.25

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.36 out of 30.11

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 15, location 3220195 - 3270530:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-His - redmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BDGGKGIB_RS13430: His - mal

Search NORINE for peptide: strict or relaxed

AMP-binding (10..422): His

nrpys: His

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SARSFDSSVAGWLCIVAGEYNEYGPTEATVWSTV
Nearest Stachelhaus code(s):: His DSALIAEVWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

PKS_AT (1555..1856): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 194.1
inactive: 168.2
Methoxymalonyl-CoA: 56.3
Methylmalonyl-CoA: 50.2
Propionyl-CoA: 33.3
Benzoyl-CoA: 21.8
Isobutyryl-CoA: 18.8
Acetyl-CoA: 17.7
Ethylmalonyl-CoA: 11.1
2-Methylbutyryl-CoA: 7.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes

NZ_CP060140.1 - Region 12 - hglE-KS

Download region SVG

Location: 3,469,276 - 3,516,469 nt. (total: 47,194 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BDGGKGIB_RS14450: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: acylase

BDGGKGIB_RS14420: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: protease

BDGGKGIB_RS14360: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: ligase synthase

BDGGKGIB_RS14410: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BDGGKGIB_RS14415: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BDGGKGIB_RS14425: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.59	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.59	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0000869.5	0.59	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'
BGC0001258.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.59	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.59	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0000869.5	0.59	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'
BGC0001258.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.00 out of 27.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.22 out of 18.16

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.19 out of 27.78

Confidence: medium

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 27.37 out of 30.98

Confidence: medium

Additional weak hits (4):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.43 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.78 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 16, location 3469275 - 3516469:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BDGGKGIB_RS14410: mal

PKS_AT (625..923): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 102.0
inactive: 48.1
Methoxymalonyl-CoA: 33.6
Methylmalonyl-CoA: 22.6
CHC-CoA: 19.3
Isobutyryl-CoA: 12.0
Propionyl-CoA: 11.0
fatty_acid: 9.4
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BDGGKGIB_RS14415: pk

PKS_AT (628..866): pk

ATSignature: (unknown)

No matches above 50%

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
NuR	Nickel-responsive regulator

NZ_CP060140.1 - Region 13 - NRPS,T1PKS

Download region SVG

Location: 3,637,239 - 3,689,421 nt. (total: 52,183 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

BDGGKGIB_RS14980: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

BDGGKGIB_RS15030: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

BDGGKGIB_RS15035: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

Ligases: synthase

BDGGKGIB_RS15075: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001268.4	0.55	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000979.3	0.43	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E9
BGC0000980.3	0.43	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 22D11
BGC0002171.2	0.40	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001268.4	0.61	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000979.3	0.54	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E9
BGC0000980.3	0.54	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 22D11
BGC0002171.2	0.52	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.69 out of 27.55

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.22 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.23 out of 26.06

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

Additional weak hits (4):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.62 out of 29.25

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 19.80 out of 29.51

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.57 out of 36.53

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.83 out of 31.73

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 17, location 3637238 - 3689421:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - ohmal - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BDGGKGIB_RS15075: Gly - mal - X

Search NORINE for peptide: strict or relaxed

AMP-binding (598..999): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FTMTFDIAVLELQALCGGEWNMYGPTEATVWATT
Nearest Stachelhaus code(s):: Gly DILQLGMVWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

PKS_AT (1753..2048): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 164.3
inactive: 125.0
Methoxymalonyl-CoA: 62.3
Methylmalonyl-CoA: 48.0
Propionyl-CoA: 30.1
Isobutyryl-CoA: 20.0
2-Methylbutyryl-CoA: 16.8
CHC-CoA: 15.5
Acetyl-CoA: 15.3
Benzoyl-CoA: 14.2
Ethylmalonyl-CoA: 10.5
fatty_acid: 9.4
3-Methylbutyryl-CoA: 7.0
trans-1,2-CPDA: 0.0

AMP-binding (3205..3610): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWQTFDVVLRDLHTFSAGEVNLYGPTETTLAKCY
Nearest Stachelhaus code(s):: Asp DVRHFALMAK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
MogR	Repressor of flagellar motility genes

NZ_CP060140.1 - Region 14 - RRE-containing

Download region SVG

Location: 4,000,964 - 4,021,413 nt. (total: 20,450 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BDGGKGIB_RS16470: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: dehydratase

BDGGKGIB_RS16510: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000757.3	0.52	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000756.3	0.51	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000790.3	0.50	saccharide	O-antigen	Escherichia coli
BGC0000737.3	0.48	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000741.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000739.3	0.47	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000740.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000746.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000757.3	0.52	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000756.3	0.51	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000790.3	0.50	saccharide	O-antigen	Escherichia coli
BGC0000737.3	0.48	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000741.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000739.3	0.47	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000740.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000746.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.57 out of 23.43

Confidence: medium

Additional weak hits (3):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.63 out of 29.51

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.16 out of 35.63

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.88 out of 20.01

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 9 - 90; Score: 58.0

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator

NZ_CP060140.1 - Region 15 - mycosporine

Download region SVG

Location: 4,600,577 - 4,645,349 nt. (total: 44,773 nt) Show pHMM detection rules used

mycosporine: (DHQ_synthase and Methyltransf_3 and ATP-grasp_3)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase

BDGGKGIB_RS19105: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

BDGGKGIB_RS19115: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

BDGGKGIB_RS19135: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

BDGGKGIB_RS19145: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase

BDGGKGIB_RS19140: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Ligases: synthase

BDGGKGIB_RS19205: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000427.5	0.59	NRPS	shinorine, 4-deoxygadusol, mycosporine glycine	Trichormus variabilis ATCC 29413
BGC0001615.3	0.52	NRPS	hexose-palythine-serine, hexose-shinorine	Heteroscytonema crispum UCFS10
BGC0000820.5	0.50	other (other)	physostigmine	Streptomyces griseofuscus
BGC0000701.5	0.47	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0000868.5	0.45	other (other)	teichuronic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000789.3	0.45	saccharide	O-antigen	Escherichia coli
BGC0000733.3	0.45	saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0000732.3	0.45	saccharide	capsular polysaccharide	Raoultella planticola
BGC0001395.5	0.44	other (other)	teichomycin A1	Actinoplanes teichomyceticus
BGC0001880.3	0.44	ribosomal	scytodecamide	Scytonema sp. UIC 10036

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000427.5	0.59	NRPS	shinorine, 4-deoxygadusol, mycosporine glycine	Trichormus variabilis ATCC 29413
BGC0001615.3	0.52	NRPS	hexose-palythine-serine, hexose-shinorine	Heteroscytonema crispum UCFS10
BGC0000820.5	0.50	other (other)	physostigmine	Streptomyces griseofuscus
BGC0000701.5	0.47	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0000868.5	0.45	other (other)	teichuronic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000789.3	0.45	saccharide	O-antigen	Escherichia coli
BGC0000733.3	0.45	saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0000732.3	0.45	saccharide	capsular polysaccharide	Raoultella planticola
BGC0001395.5	0.44	other (other)	teichomycin A1	Actinoplanes teichomyceticus
BGC0001880.3	0.44	ribosomal	scytodecamide	Scytonema sp. UIC 10036

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.89 out of 30.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.11 out of 26.06

Confidence: medium

Additional weak hits (5):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.98 out of 29.65

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 29.34 out of 39.62

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.38 out of 32.74

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.65 out of 30.98

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ColR	Phenol-responsive regulator
MogR	Repressor of flagellar motility genes

NZ_CP060140.1 - Region 16 - NRPS

Download region SVG

Location: 4,775,662 - 4,837,300 nt. (total: 61,639 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BDGGKGIB_RS19890: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

BDGGKGIB_RS19960: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BDGGKGIB_RS19970: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase

BDGGKGIB_RS19885: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

BDGGKGIB_RS20045: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

BDGGKGIB_RS20050: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: phosphatase

BDGGKGIB_RS20015: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Ligases: ligase

BDGGKGIB_RS19965: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.85 out of 26.85

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.09 out of 25.88

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.13 out of 27.78

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 23.16 out of 27.55

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.24 out of 27.78

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.51 out of 27.55

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.14 out of 28.19

Confidence: medium

Additional weak hits (3):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.05 out of 25.88

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.70 out of 36.53

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.75 out of 36.54

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 20, location 4775661 - 4837300:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ile) + (Pro)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

BDGGKGIB_RS19965: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (478..898): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LHHAFDVSYHEAFLIACGEYNLYGPTEADLVTSY
Nearest Stachelhaus code(s):: cohOhi DVHIIAFLVK (82% 8Å match)
Stachelhaus code match:: 70% (weak)

BDGGKGIB_RS20015: Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (1812..2216): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTSFDAATFEGFVLFGGELHVYGPTENTTFSSW
Nearest Stachelhaus code(s):: Ile DAFFLGVTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
PsrA	Oleic acid responsive regulator
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_CP060140.1 - Region 17 - terpene-precursor