GCF_019641495.1 - 14 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JAIFIS010000001.1 (Paenibacillus lautus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	ectoine	319,922	330,314	Medium	ectoine	other:ectoine
Region 2.2	NRP-metallophore,NRPS	1,490,210	1,542,211	High	bacillibactin	NRPS:Type I
Region 2.3	NRPS	2,905,938	2,948,097
Region 2.4	terpene	3,089,335	3,110,156
Region 2.5	T3PKS	3,600,672	3,641,829
Region 2.6	terpene-precursor,NRPS-like	3,682,736	3,737,323
Region 2.7	NI-siderophore	3,804,202	3,839,914
Region 2.8	terpene-precursor	4,356,459	4,377,334
Region 2.9	cyclic-lactone-autoinducer	4,598,993	4,619,659
Region 2.10	proteusin	5,117,420	5,137,659
Region 2.11	lanthipeptide-class-i	5,714,143	5,741,123	High	paenilan	ribosomal:RiPP
Region 2.12	RRE-containing	6,437,117	6,457,407	Low	paeninodin	ribosomal:unmodified
Region 2.13	NRPS	6,472,429	6,540,852

NZ_JAIFIS010000006.1 (Paenibacillus lautus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	cyclic-lactone-autoinducer	1,791	15,108

No secondary metabolite regions were found in these records:: NZ_JAIFIS010000061.1 (Paenibacillus lautus); NZ_JAIFIS010000015.1 (Paenibacillus lautus); NZ_JAIFIS010000017.1 (Paenibacillus lautus); NZ_JAIFIS010000018.1 (Paenibacillus lautus); NZ_JAIFIS010000019.1 (Paenibacillus lautus); NZ_JAIFIS010000020.1 (Paenibacillus lautus); NZ_JAIFIS010000021.1 (Paenibacillus lautus); NZ_JAIFIS010000022.1 (Paenibacillus lautus); NZ_JAIFIS010000023.1 (Paenibacillus lautus); NZ_JAIFIS010000024.1 (Paenibacillus lautus); NZ_JAIFIS010000026.1 (Paenibacillus lautus); NZ_JAIFIS010000027.1 (Paenibacillus lautus); NZ_JAIFIS010000028.1 (Paenibacillus lautus); NZ_JAIFIS010000029.1 (Paenibacillus lautus); NZ_JAIFIS010000030.1 (Paenibacillus lautus); NZ_JAIFIS010000031.1 (Paenibacillus lautus); NZ_JAIFIS010000005.1 (Paenibacillus lautus); NZ_JAIFIS010000053.1 (Paenibacillus lautus); NZ_JAIFIS010000060.1 (Paenibacillus lautus)

Compact view

NZ_JAIFIS010000001.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 319,922 - 330,314 nt. (total: 10,393 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

K1X09_RS01580: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.79	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.73	other (other)	ectoine	Streptomyces anulatus
BGC0000858.3	0.73	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.72	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.72	other (other)	ectoine	Methylophaga thalassica
BGC0000852.5	0.71	other (other)	ectoine	Sporosarcina pasteurii
BGC0000857.3	0.64	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.64	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.63	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.79	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.73	other (other)	ectoine	Streptomyces anulatus
BGC0000858.3	0.73	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.72	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.72	other (other)	ectoine	Methylophaga thalassica
BGC0000852.5	0.71	other (other)	ectoine	Sporosarcina pasteurii
BGC0000857.3	0.64	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.64	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.63	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.22 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

Additional weak hits (3):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.73 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.64 out of 26.06

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.21 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_JAIFIS010000001.1 - Region 2 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 1,490,210 - 1,542,211 nt. (total: 52,002 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

K1X09_RS07175: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase

K1X09_RS07220: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase

K1X09_RS07155: hydrolase

smcogs: SMCOG1179: hydrolase

K1X09_RS07190: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: cyclase

K1X09_RS07215: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Isomerases: isomerase

K1X09_RS07180: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

K1X09_RS07095: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

K1X09_RS07150: Pseudouridine synthase

smcogs: SMCOG1154: Pseudouridine synthase

K1X09_RS07185: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

K1X09_RS07195: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000401.5	1.06	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001185.5	1.02	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	1.01	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0000343.5	0.86	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000401.5	0.80	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001185.5	0.79	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	0.79	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0000343.5	0.74	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.66 out of 23.79

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 27.57 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.04 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.64 out of 28.19

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 23.72 out of 24.78

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.49 out of 29.38

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 28.19

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.61 out of 24.78

Confidence: medium

Additional weak hits (16):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.40 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.58 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.73 out of 30.97

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 30.02 out of 39.62

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.44 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.61 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.35 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.10 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.12 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.01 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 19.90 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.01 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 25.00 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.37 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 1490209 - 1542211:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

K1X09_RS07185: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..444): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SMSLFPLSSPGGAVQVGGAQQVYGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVVNK (94% 8Å match); diOH-Bz or Sal PLPAQGVVNK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

K1X09_RS07195: Ala - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (464..867): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDMTFDISVMELQAITGGENNQYGPTETTIYSTA
Nearest Stachelhaus code(s):: Ala DILQIGQIYK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1528..1945): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQVFGGEINMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
FuR variant 1	Ferric Uptake Regulator
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
MexT	Global virulence regulator
ZuR variant 1	Zinc-responsive repressor

NZ_JAIFIS010000001.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 2,905,938 - 2,948,097 nt. (total: 42,160 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

K1X09_RS13690: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

K1X09_RS13695: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: acetyltransferase glycosyltransferase

K1X09_RS13730: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

K1X09_RS13825: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: dehalogenase

K1X09_RS13715: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase

K1X09_RS13750: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

K1X09_RS13685: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

K1X09_RS13775: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

K1X09_RS13800: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.06 out of 20.01

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.53 out of 20.97

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 24.96 out of 29.72

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.41 out of 28.19

Confidence: medium

Additional weak hits (11):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.57 out of 33.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.72 out of 32.74

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.59 out of 30.97

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.32 out of 20.47

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.27 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.96 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.21 out of 36.54

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.25 out of 30.97

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.95 out of 32.93

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.50 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.61 out of 28.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

K1X09_RS13750: Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (228..620): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTGFDTSTFEGFLLIGGEINMYGPTENTTFSTY
Nearest Stachelhaus code(s):: Leu or Ile DAFFLGMTFK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
CcpA	Catabolite control protein A
NtrC	Nitrogen regulatory protein C
ZuR variant 1	Zinc-responsive repressor

NZ_JAIFIS010000001.1 - Region 4 - terpene

Download region GenBank file

Download region SVG

Location: 3,089,335 - 3,110,156 nt. (total: 20,822 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Translocases: transporter

K1X09_RS14480: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	0.42	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000486.4	0.41	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000600.3	0.40	ribosomal	thurincin H	Bacillus thuringiensis
BGC0002111.3	0.40	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000521.3	0.39	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis
BGC0000539.5	0.39	ribosomal	nukacin ISK-1	Staphylococcus warneri
BGC0000528.5	0.39	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000522.3	0.39	ribosomal	lacticin Z	Lactococcus lactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	0.42	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000486.4	0.41	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000600.3	0.40	ribosomal	thurincin H	Bacillus thuringiensis
BGC0002111.3	0.40	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000521.3	0.39	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis
BGC0000539.5	0.39	ribosomal	nukacin ISK-1	Staphylococcus warneri
BGC0000528.5	0.39	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000522.3	0.39	ribosomal	lacticin Z	Lactococcus lactis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
triterpene		squalene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

K1X09_RS14505: PT_phytoene_like

Domain 1 (16 - 216): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → PSPP; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.68 out of 27.55

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.01 out of 23.79

Confidence: medium

Additional weak hits (4):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.72 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.17 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.88 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 25.06 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis

NZ_JAIFIS010000001.1 - Region 5 - T3PKS

Download region GenBank file

Download region SVG

Location: 3,600,672 - 3,641,829 nt. (total: 41,158 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

K1X09_RS16615: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

K1X09_RS16620: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

K1X09_RS16675: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

K1X09_RS16695: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

K1X09_RS16715: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Ligases: synthase

K1X09_RS16705: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Translocases: transporter

K1X09_RS16730: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001948.3	0.48	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001336.5	0.46	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0002332.2	0.45	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001782.3	0.44	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001366.5	0.40	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0001075.5	0.39	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0000652.5	0.39	terpene	napyradiomycin	Streptomyces sp. CNQ525
BGC0000207.5	0.39	PKS	chartreusin	Streptomyces chartreusis
BGC0001810.3	0.39	PKS	trehangelin	Polymorphospora rubra

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001948.3	0.48	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001336.5	0.46	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0002332.2	0.45	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001782.3	0.44	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001366.5	0.40	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0001075.5	0.39	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0000652.5	0.39	terpene	napyradiomycin	Streptomyces sp. CNQ525
BGC0000207.5	0.39	PKS	chartreusin	Streptomyces chartreusis
BGC0001810.3	0.39	PKS	trehangelin	Polymorphospora rubra

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.08 out of 27.78

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.30 out of 26.85

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.07 out of 23.79

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.31 out of 28.19

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (6):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.63 out of 26.12

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.61 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.70 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.31 out of 30.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.51 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.50 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
ZuR variant 1	Zinc-responsive repressor

NZ_JAIFIS010000001.1 - Region 6 - NRPS-like,terpene-precursor

Download region GenBank file

Download region SVG

Location: 3,682,736 - 3,737,323 nt. (total: 54,588 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

K1X09_RS17115: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deacetylase

K1X09_RS17140: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Ligases: ligase synthetase

K1X09_RS17020: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

K1X09_RS17095: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.27	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.26	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.26	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.26	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.26	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.26	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001250.4	0.26	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.26	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.26	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001758.4	0.25	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

K1X09_RS17020: PT_FPPS_like

Domain 1 (536 - 759): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.74 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.15 out of 26.06

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.01 out of 30.25

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.13 out of 24.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.07 out of 24.78

Confidence: medium

Additional weak hits (11):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.22 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.71 out of 32.74

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.90 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.36 out of 20.01

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.32 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.67 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.83 out of 26.12

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.28 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.76 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 3682735 - 3737323:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 3693594 - 3737323:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

K1X09_RS17095: X

AMP-binding (246..652): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LANSFDASVYDGILVVGGEVNLYGPTETTVVATG
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (65% 8Å match); Val DALFVGLVAK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_JAIFIS010000001.1 - Region 7 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 3,804,202 - 3,839,914 nt. (total: 35,713 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

K1X09_RS17525: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: aminotransferase

K1X09_RS17560: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Translocases: transporter

K1X09_RS17610: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002471.3	0.57	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0002073.3	0.54	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0000295.5	0.54	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001499.5	0.50	other (other)	aerobactin	Pantoea ananatis
BGC0002682.2	0.50	other (other)	aerobactin	Vibrio mimicus
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000943.5	0.50	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0001713.5	0.50	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae
BGC0001870.3	0.50	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002471.3	0.57	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0002073.3	0.54	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0000295.5	0.54	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001499.5	0.50	other (other)	aerobactin	Pantoea ananatis
BGC0002682.2	0.50	other (other)	aerobactin	Vibrio mimicus
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000943.5	0.50	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0001713.5	0.50	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae
BGC0001870.3	0.50	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.82 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.79 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.49 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.22 out of 27.78

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.16 out of 29.38

Confidence: medium

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 26.48 out of 32.74

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

Additional weak hits (18):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.93 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.44 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.87 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.89 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.31 out of 32.74

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.13 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.77 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.53 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.61 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 19.90 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.44 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.36 out of 21.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.96 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.29 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.30 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.81 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
FuR variant 2	Ferric Uptake Regulator
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_JAIFIS010000001.1 - Region 8 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 4,356,459 - 4,377,334 nt. (total: 20,876 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase

K1X09_RS20375: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

K1X09_RS20330: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

K1X09_RS20335: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000668.5	0.37	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001594.3	0.37	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000666.5	0.36	terpene	xiamycin A	Streptomyces sp. SCSIO 02999

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000668.5	0.37	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001594.3	0.37	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000666.5	0.36	terpene	xiamycin A	Streptomyces sp. SCSIO 02999

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

K1X09_RS20335: PT_FPPS_like

Domain 1 (26 - 291): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

Binding sites found:

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.25 out of 24.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.39 out of 32.93

Confidence: medium

Additional weak hits (3):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.54 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.49 out of 39.62

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.51 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
LexA variant 2	Repressor of DNA damage response
LexA variant 3	Repressor of DNA damage response

NZ_JAIFIS010000001.1 - Region 9 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 4,598,993 - 4,619,659 nt. (total: 20,667 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

K1X09_RS21410: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Transferases: acetyltransferase

K1X09_RS21490: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000602.5	0.39	ribosomal	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000568.5	0.39	ribosomal	microcin B17	Escherichia coli
BGC0001684.3	0.38	other (other)	N-acyloxyacyl glutamine	Klebsiella variicola
BGC0000497.3	0.37	ribosomal	BHT-Aα, BHT-Aβ	Streptococcus ratti
BGC0000552.3	0.37	ribosomal	SmbA, SmbB	Streptococcus mutans
BGC0000791.3	0.37	saccharide	O-antigen	Cronobacter sakazakii
BGC0000541.5	0.36	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001226.4	0.36	ribosomal	streptocollin	Streptomyces collinus Tu 365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000602.5	0.39	ribosomal	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000568.5	0.39	ribosomal	microcin B17	Escherichia coli
BGC0001684.3	0.38	other (other)	N-acyloxyacyl glutamine	Klebsiella variicola
BGC0000497.3	0.37	ribosomal	BHT-Aα, BHT-Aβ	Streptococcus ratti
BGC0000552.3	0.37	ribosomal	SmbA, SmbB	Streptococcus mutans
BGC0000791.3	0.37	saccharide	O-antigen	Cronobacter sakazakii
BGC0000541.5	0.36	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001226.4	0.36	ribosomal	streptocollin	Streptomyces collinus Tu 365

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.13 out of 20.97

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.87 out of 24.78

Confidence: medium

Additional weak hits (3):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.92 out of 20.01

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 22.38 out of 30.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
LexA variant 2	Repressor of DNA damage response
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis

NZ_JAIFIS010000001.1 - Region 10 - proteusin

Download region GenBank file

Download region SVG

Location: 5,117,420 - 5,137,659 nt. (total: 20,240 nt) Show pHMM detection rules used

proteusin: (PoyD or TIGR03793)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001217.5	0.52	other (other)	PreQ0 Base	Streptomyces qinglanensis
BGC0000802.5	0.49	saccharide	succinoglycan	Sinorhizobium meliloti
BGC0000881.3	0.41	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001808.5	0.41	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0002354.4	0.40	other (other)	huimycin	Kutzneria albida DSM 43870
BGC0000879.5	0.40	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0000313.4	0.35	NRPS	beauvericin	Beauveria bassiana
BGC0001603.3	0.31	saccharide	gentamicin	Micromonospora echinospora
BGC0002713.2	0.29	NRPS	mevalagmapeptide A, mevalagmapeptide B, mevalagmapeptide C, mevalagmapeptide D	Photorhabdus laumondii subsp. laumondii
BGC0000696.5	0.29	saccharide	gentamicin	Micromonospora echinospora

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001217.5	0.52	other (other)	PreQ0 Base	Streptomyces qinglanensis
BGC0000802.5	0.49	saccharide	succinoglycan	Sinorhizobium meliloti
BGC0000881.3	0.41	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001808.5	0.41	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0002354.4	0.40	other (other)	huimycin	Kutzneria albida DSM 43870
BGC0000879.5	0.40	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0000313.4	0.35	NRPS	beauvericin	Beauveria bassiana
BGC0001603.3	0.31	saccharide	gentamicin	Micromonospora echinospora
BGC0002713.2	0.29	NRPS	mevalagmapeptide A, mevalagmapeptide B, mevalagmapeptide C, mevalagmapeptide D	Photorhabdus laumondii subsp. laumondii
BGC0000696.5	0.29	saccharide	gentamicin	Micromonospora echinospora

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 20.33 out of 20.97

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.16 out of 20.97

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.35 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.40 out of 20.97

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.74 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.19 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.30 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.29 out of 31.73

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis

NZ_JAIFIS010000001.1 - Region 11 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 5,714,143 - 5,741,123 nt. (total: 26,981 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: formyltransferase

K1X09_RS26335: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: hydrolase

K1X09_RS26345: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: cyclase dehydratase

K1X09_RS26300: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

K1X09_RS26310: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

K1X09_RS26320: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Translocases: transporter

K1X09_RS26265: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001727.3	0.80	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000542.3	0.58	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.57	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001289.5	0.56	ribosomal	penisin	Paenibacillus ehimensis
BGC0001210.5	0.55	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000556.5	0.54	ribosomal	streptin	Streptococcus pyogenes
BGC0002635.2	0.52	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000560.5	0.52	ribosomal	subtilomycin	Bacillus subtilis
BGC0002668.2	0.51	ribosomal	cesin A	Clostridium estertheticum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001727.3	0.80	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000542.3	0.58	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.57	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001289.5	0.56	ribosomal	penisin	Paenibacillus ehimensis
BGC0001210.5	0.55	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000556.5	0.54	ribosomal	streptin	Streptococcus pyogenes
BGC0002635.2	0.52	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000560.5	0.52	ribosomal	subtilomycin	Bacillus subtilis
BGC0002668.2	0.51	ribosomal	cesin A	Clostridium estertheticum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for K1X09_RS26300

K1X09_RS26315

Leader:

MNNQFDLDLQVAQNEVAPNEVQPA

Core:

SGLICTPSCLTGTLNCKISLSFCRTC

Core with dehydrations:

DhaGLICysDhbPDhaCysLDhbGDhbLNCysKIDhaLDhaFCysRDhbCys

antiSMASH-DB 4.0 matches for K1X09_RS26315

100.0%

NZ_JAIFIS010000001.1:

Lanthipeptides: K1X09_RS26315_lanthipeptide

1

SGLICTPSCLTGTLNCKISLSFCRTC

26

SGLICTPSCLTGTLNCKISLSFCRTC

1

SGLICTPSCLTGTLNCKISLSFCRTC

26

96.2%

NZ_WTWY01000020.1:

Lanthipeptides: GQY55_RS27090_lanthipeptide

1

SGLICTPSCLTGTLNCKISLSFCRTC

26

SG ICTPSCLTGTLNCKISLSFCRTC

1

SGFICTPSCLTGTLNCKISLSFCRTC

26

84.6%

NC_014483.2and 17 others:

NC_014622.2 Lanthipeptides: PPSC2_RS36205_lanthipeptideNC_017542.1 Lanthipeptides: PPM_RS07465_lanthipeptideNZ_CP006872.1 Lanthipeptides: PPSQR21_RS07740_lanthipeptideNZ_CP023711.1 Lanthipeptides: CPY53_RS22235_lanthipeptideNZ_CP025957.1 Lanthipeptides: C1A50_RS07530_lanthipeptideNZ_CP029370.1 Lanthipeptides: DI243_RS07495_lanthipeptideNZ_CP040829.1 Lanthipeptides: FGY93_RS00500_lanthipeptideNZ_CP049598.1 Lanthipeptides: G7L40_RS00115_lanthipeptideNZ_CP073682.1 Lanthipeptides: KAI36_RS07745_lanthipeptideNZ_CP084033.1 Lanthipeptides: LAZ93_RS07550_lanthipeptideNZ_CP085682.1 Lanthipeptides: LJR53_RS07370_lanthipeptideNZ_CP086373.1 Lanthipeptides: LMH85_RS07780_lanthipeptideNZ_CP092779.1 Lanthipeptides: MJ749_RS07440_lanthipeptideNZ_CP097766.1 Lanthipeptides: MF620_RS07485_lanthipeptideNZ_CP102865.1 Lanthipeptides: NWS42_RS21195_lanthipeptideNZ_JWJJ01000002.1 Lanthipeptides: U707_RS10390_lanthipeptideNZ_POVT01000009.1 Lanthipeptides: C1T20_RS05900_lanthipeptide

Lanthipeptides: PPE_RS07020_lanthipeptide

1

SGLICTPSCLTGTLNCKISLSFCRTC

26

SGLICTPSC TGTLNC++SLSFC+TC

1

SGLICTPSCATGTLNCQVSLSFCKTC

26

with 54 more sequence matches

Only the first 10 are displayed here.

80.8%

NZ_CP061172.1and 5 others:

NZ_CP109848.1 Lanthipeptides: OF859_RS22650_lanthipeptideNZ_CP113973.1 Lanthipeptides: OYT09_RS07785_lanthipeptideNZ_JAAMNR010000001.1 Lanthipeptides: G9G54_RS03500_lanthipeptideNZ_PNXQ01000013.1 Lanthipeptides: C1I60_RS14430_lanthipeptideNZ_POVS01000009.1 Lanthipeptides: C1T21_RS10630_lanthipeptide

Lanthipeptides: IAQ67_RS07480_lanthipeptide

1

SGLICTPSCLTGTLNCKISLSFCRTC

26

SGLICTPSC TGTLNC++SL+FC+TC

1

SGLICTPSCATGTLNCQVSLTFCKTC

26

80.8%

NZ_JAKVDC010000001.1:

Lanthipeptides: MKN04_RS02755_lanthipeptide

1

SGLICTPSCLTGTLNCKISLSFCRTC

26

SG+ICTPSC TGTLNC++SLSFC+TC

1

SGIICTPSCATGTLNCQVSLSFCKTC

26

80.8%

NZ_NIST01000001.1:

Lanthipeptides: CD001_RS09870_lanthipeptide

1

SGLICTPSCLTGTLNCKISLSFCRTC

26

+G ICTPSCLTGTLNC++SL+FCRTC

1

TGGICTPSCLTGTLNCRVSLTFCRTC

26

76.9%

NC_023037.2and 5 others:

NZ_CP017967.2 Lanthipeptides: PPYC1_RS07755_lanthipeptideNZ_CP017968.3 Lanthipeptides: PPYC2_RS08330_lanthipeptideNZ_CP073683.1 Lanthipeptides: KAI37_RS07495_lanthipeptideNZ_FOYG01000001.1 Lanthipeptides: BM358_RS03525_lanthipeptideNZ_PTJM01000020.1 Lanthipeptides: C5G87_RS02825_lanthipeptide

Lanthipeptides: X809_RS07820_lanthipeptide

1

SGLICTPSCLTGTLNCKISLSFCRTC

26

SG+ICTPSC TGTLNC++SL+FC+TC

1

SGIICTPSCATGTLNCQVSLTFCKTC

26

61.5%

NZ_CP029370.1:

Lanthipeptides: DI243_RS07485_lanthipeptide

1

SGLICTPSCLTGTLNCKISLSFCRTC

26

SG+ICTP+CLT LNC S+S C C

1

SGIICTPTCLTSILNCYTSISHCGPC

26

38.5%

NZ_NBBB01000022.1and 1 other:

NZ_NUOG01000083.1 Lanthipeptides: COE07_RS24905_lanthipeptide

Lanthipeptides: B6F67_RS25205_lanthipeptide

1

SGLICTPSCLTGTLNCKISLSFC

23

SG+ICTP T C+I+ ++C

1

SGIICTPG--TCQTLCRITENWC

21

37.5%

NC_014479.1and 9 others:

NZ_CP026362.1 Lanthipeptides: BV11031_RS00400_lanthipeptideNZ_CP033052.1 Lanthipeptides: D9779_RS17315_lanthipeptideNZ_CP051464.1 Lanthipeptides: HC660_RS17030_lanthipeptideNZ_JALAKK010000002.1 Lanthipeptides: MOB09_RS02800_lanthipeptideNZ_JALAKO010000014.1 Lanthipeptides: MOB26_RS08535_lanthipeptideNZ_JALAOG010000003.1 Lanthipeptides: MOC96_RS02500_lanthipeptideNZ_JALAPG010000043.1 Lanthipeptides: MOC70_RS16815_lanthipeptideNZ_JALAQI010000009.1 Lanthipeptides: MOD13_RS06065_lanthipeptideNZ_NXEM01000027.1 Lanthipeptides: CPT06_RS15285_lanthipeptide

Lanthipeptides: BSUW23_RS16845_lanthipeptide

4

ICTPSCLTGTL----------NCKIS

19

+CTP C+TG L NCKIS

6

LCTPGCVTGALQTCFLQTLTCNCKIS

31

37.5%

NC_016047.1and 2 others:

NZ_KZ848487.1 Lanthipeptides: DSL71_RS15965_lanthipeptideNZ_MUXL01000003.1 Lanthipeptides: B0W20_RS12275_lanthipeptide

Lanthipeptides: GYO_RS39160_lanthipeptide

4

ICTPSCLTGTL----------NCKIS

19

+CTP C+TG L NCKIS

6

VCTPGCVTGLLQTCFLQTITCNCKIS

31

37.5%

NZ_CP021903.1and 20 others:

NZ_CP023409.1 Lanthipeptides: Bateq7PJ16_RS18530_lanthipeptideNZ_CP026036.1 Lanthipeptides: C2H93_RS15000_lanthipeptideNZ_CP028218.1 Lanthipeptides: C7M30_RS14555_lanthipeptideNZ_CP035167.1 Lanthipeptides: EQJ08_RS17140_lanthipeptideNZ_CP035226.1 Lanthipeptides: EQW70_RS18175_lanthipeptideNZ_CP045006.1 Lanthipeptides: F9B13_RS03875_lanthipeptideNZ_CP076083.1 Lanthipeptides: KFF76_RS16710_lanthipeptideNZ_CP079759.1 Lanthipeptides: KXZ66_RS17780_lanthipeptideNZ_CP080508.1 Lanthipeptides: K0V03_RS06525_lanthipeptideNZ_CP089148.1 Lanthipeptides: LRO88_RS19055_lanthipeptideNZ_JALAUA010000003.1 Lanthipeptides: MOD32_RS04985_lanthipeptideNZ_JALAVX010000009.1 Lanthipeptides: MOE40_RS09385_lanthipeptideNZ_JAMYDW010000007.1 Lanthipeptides: NHM07_RS16180_lanthipeptideNZ_JAQOXM010000001.1 Lanthipeptides: PO770_RS03875_lanthipeptideNZ_NJRD01000003.1 Lanthipeptides: CE053_RS07200_lanthipeptideNZ_NJRE01000008.1 Lanthipeptides: CE047_RS18435_lanthipeptideNZ_SORJ01000001.1 Lanthipeptides: BJ795_RS01490_lanthipeptideNZ_VFNF01000001.1 Lanthipeptides: FB592_RS01525_lanthipeptideNZ_VIOH01000001.1 Lanthipeptides: FLN47_RS03850_lanthipeptideNZ_VLJL01000012.1 Lanthipeptides: L604_RS09425_lanthipeptide

Lanthipeptides: CD007_RS17065_lanthipeptide

4

ICTPSCLTGTL----------NCKIS

19

+CTP C+TG L NCKIS

6

LCTPGCVTGVLQTCFLQTITCNCKIS

31

34.6%

NZ_CP090942.1:

Lanthipeptides: LZT96_RS12010_lanthipeptide

1

SGLICTPSCL-TGTLN

15

S ICTP C TG+ N

3

SKFICTPGCAKTGSFN

18

MIBiG 4.0 matches for K1X09_RS26315

26.5%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

4

ICTPSCLTGTL-NCKISLSFCR

24

+CTP C TG L C + + C

6

LCTPGCKTGALMGCNMKTATCH

27

18.9%

BGC0001229.4 (SBI_06989):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

1

SGLICTPSCLTGTLNCKISLSFCRT

25

+GLI + + +S +FC T

6

TGLILGIVAIQAGVAVGVSAAFCPT

30

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.72 out of 20.97

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

Additional weak hits (1):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.78 out of 21.55

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

K1X09_RS26315 - Class I

Cleavage pHMM score: 6.00

RODEO score: 23

Monoisotopic mass: 2576.3 Da

Molecular weight: 2578.1 Da

Number of bridges: 5

Alternative weights: (assuming N unmodified Ser/Thr residues); 2596.1 Da N = 1; 2614.1 Da N = 2; 2632.2 Da N = 3

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 184 - 279; Score: 51.6

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CcpA	Catabolite control protein A
MexT	Global virulence regulator

NZ_JAIFIS010000001.1 - Region 12 - RRE-containing

Download region GenBank file

Download region SVG

Location: 6,437,117 - 6,457,407 nt. (total: 20,291 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

K1X09_RS29460: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

Transferases: glycosyltransferase

K1X09_RS29480: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Lyases: dehydratase

K1X09_RS29445: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001356.4	0.54	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0001639.3	0.46	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000868.5	0.46	other (other)	teichuronic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000777.3	0.45	saccharide	lipopolysaccharide	Escherichia coli
BGC0001634.3	0.45	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0002312.2	0.45	ribosomal	ubonodin	Burkholderia ubonensis
BGC0000898.5	0.44	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000761.5	0.44	saccharide	exopolysaccharide	Methylobacillus sp. 12S
BGC0001645.3	0.43	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0000623.3	0.43	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001356.4	0.54	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0001639.3	0.46	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000868.5	0.46	other (other)	teichuronic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000777.3	0.45	saccharide	lipopolysaccharide	Escherichia coli
BGC0001634.3	0.45	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0002312.2	0.45	ribosomal	ubonodin	Burkholderia ubonensis
BGC0000898.5	0.44	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000761.5	0.44	saccharide	exopolysaccharide	Methylobacillus sp. 12S
BGC0001645.3	0.43	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0000623.3	0.43	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.06 out of 18.46

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 26.19 out of 30.25

Confidence: medium

Additional weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.98 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.26 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.22 out of 28.14

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 11 - 94; Score: 94.8

TFBS definitions

Regulator	Description
ColR	Phenol-responsive regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAIFIS010000001.1 - Region 13 - NRPS

Download region GenBank file

Download region SVG

Location: 6,472,429 - 6,540,852 nt. (total: 68,424 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: esterase hydrolase

K1X09_RS29585: isochorismatase

smcogs: SMCOG1027: isochorismatase

K1X09_RS29625: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

K1X09_RS29645: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

K1X09_RS29650: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

K1X09_RS29705: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.69	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.69	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.92 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.68 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.55 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.11 out of 27.78

Confidence: medium

Additional weak hits (9):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.93 out of 30.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.48 out of 26.06

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.22 out of 20.47

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 25.71 out of 32.74

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.77 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.13 out of 29.65

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 15, location 6472428 - 6540852:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - D-Cys - Ser - Cys - Ala - X) + (Asn - D-Asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

K1X09_RS29645: X - Asn - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (299..683): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MTYAFDQAVGDPSLESGGELNTYGPTESTVNATS
Nearest Stachelhaus code(s):: 4-ohGln or Gln DQGITGTVTK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1320..1708): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YYATFDLSVTSLKLIVGGEHNEYGPTETTVGCCD
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2346..2734): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YYATFDLSVTSLKLIVGGEHNEYGPTETTVGCCD
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

K1X09_RS29650: fatty_acid - Cys - Ser - Cys - Ala

Search NORINE for peptide: strict or relaxed

CAL_domain (167..466): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 68.8
Acetyl-CoA: 27.4
NH2: 23.5
shikimic_acid: 0.0
AHBA: 0.0

AMP-binding (1132..1514): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNSMLSGDIGLGGATEGSIWSIY
Nearest Stachelhaus code(s):: Cys DLYNMSLIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2622..3021): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: QWTTFDVFAWEWQFINIGELNLYGPAETTVNSSG
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (3940..4324): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNSMLSGDIGLGGATEGSIWSIY
Nearest Stachelhaus code(s):: Cys DLYNMSLIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4967..5360): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LNDHFDVSVWEGCQIFAGEVNMYGPTETTVYATY
Nearest Stachelhaus code(s):: Ser DVWSIAMVHK (82% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ToxT	Regulator of MSHA biosynthesis

NZ_JAIFIS010000006.1 - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 1,791 - 15,108 nt. (total: 13,318 nt) Show pHMM detection rules used

Region on contig edge.

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

No matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.44 out of 30.25

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 24.10 out of 24.78

Confidence: strong

TFBS Finder

TFBS definitions

Regulator	Description
ColR	Phenol-responsive regulator
LexA variant 2	Repressor of DNA damage response