GCF_019303495.1 - 28 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JAEVFI010000011.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	T2PKS,PKS-like,RiPP-like,betalactone,NRPS-like,terpene	79,465	166,460	Low	trioxacarcin A	PKS

NZ_JAEVFI010000012.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	NRPS-like	44,541	88,404	Low	indigoidine	saccharide

NZ_JAEVFI010000014.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	ectoine	10,214	20,612	High	ectoine	other:ectoine

NZ_JAEVFI010000018.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	lassopeptide	55,611	71,808

NZ_JAEVFI010000019.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	lanthipeptide-class-iii	29,746	52,469	Medium	SapB	ribosomal:RiPP:Lanthipeptide

NZ_JAEVFI010000001.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	NRPS	68,914	113,590	Medium	sibiromycin	NRPS:Type I
Region 11.2	RiPP-like	147,150	158,604	Medium	streptamidine	ribosomal:unmodified
Region 11.3	NRPS,NRPS-like	216,475	300,269	Medium	netropsin	NRPS:Type I
Region 11.4	terpene	315,341	339,205
Region 11.5	NI-siderophore	392,400	425,103	Low	kinamycin	PKS

NZ_JAEVFI010000025.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	NRPS	27,423	63,012	Low	neoantimycin	NRPS:Type I

NZ_JAEVFI010000027.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	NRPS-like	43,885	87,163	Low	guanipiperazine A/guanipiperazine B	NRPS:Type I

NZ_JAEVFI010000002.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 22.1	lanthipeptide-class-i	135,626	160,820

NZ_JAEVFI010000032.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 25.1	terpene	119,810	142,247

NZ_JAEVFI010000039.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 32.1	NRPS	11,942	47,663

NZ_JAEVFI010000043.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 37.1	lanthipeptide-class-i	2,256	17,030

NZ_JAEVFI010000044.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 38.1	NI-siderophore	1	17,169	Low	coelichelin	NRPS:Type I

NZ_JAEVFI010000046.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 40.1	lassopeptide	6,122	19,429	High	lagmysin	ribosomal:RiPP

NZ_JAEVFI010000048.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 42.1	NI-siderophore	1	13,338

NZ_JAEVFI010000004.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 44.1	T3PKS	1	38,986	High	naringenin	PKS:Type III

NZ_JAEVFI010000053.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 48.1	lassopeptide	1	5,650

NZ_JAEVFI010000056.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 51.1	NRPS	1	2,199

NZ_JAEVFI010000005.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 55.1	NRPS-like	24,575	67,985
Region 55.2	RiPP-like	195,251	205,703

NZ_JAEVFI010000007.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 59.1	CDPS	120,207	140,917

NZ_JAEVFI010000008.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 60.1	terpene	17,640	42,115	Low	hopene	terpene
Region 60.2	terpene	72,697	99,498	High	isorenieratene	terpene

NZ_JAEVFI010000009.1 (Streptomyces sp. JJ66)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 61.1	lassopeptide	47,925	70,257

No secondary metabolite regions were found in these records:: NZ_JAEVFI010000010.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000013.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000015.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000016.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000017.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000020.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000021.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000022.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000023.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000024.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000026.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000028.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000029.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000030.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000031.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000033.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000034.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000035.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000036.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000037.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000038.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000003.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000040.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000041.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000042.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000045.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000047.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000049.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000050.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000051.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000052.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000054.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000055.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000057.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000058.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000059.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000062.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000063.1 (Streptomyces sp. JJ66); NZ_JAEVFI010000006.1 (Streptomyces sp. JJ66)

Compact view

NZ_JAEVFI010000011.1 - Region 1 - NRPS-like,PKS-like,RiPP-like,T2PKS,betalactone,terpene

Download region GenBank file

Download region SVG

Location: 79,465 - 166,460 nt. (total: 86,996 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
PKS-like: (t2pks2 or ksIII)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))
betalactone: (HMGL-like and AMP-binding)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

JJV70_RS10190: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

JJV70_RS10195: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

JJV70_RS10205: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JJV70_RS10210: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

JJV70_RS10290: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

JJV70_RS10320: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JJV70_RS10325: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

JJV70_RS10385: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

JJV70_RS10390: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

JJV70_RS23215: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase acylase

JJV70_RS10235: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

JJV70_RS10280: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

JJV70_RS10285: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: deaminase

JJV70_RS10365: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: cyclase dehydratase

JJV70_RS10135: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

JJV70_RS10305: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

JJV70_RS10340: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase synthase

JJV70_RS10245: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

JJV70_RS10250: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

JJV70_RS10295: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JJV70_RS10310: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

JJV70_RS10315: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

JJV70_RS10355: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

JJV70_RS10360: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	1.76	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001164.3	1.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	1.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000234.5	1.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001135.5	1.37	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001723.5	1.34	PKS	oviedomycin	Streptomyces antibioticus
BGC0001261.3	1.34	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	1.30	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.29	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.28	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.70	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

JJV70_RS10135: T1TS

Domain 1 (19 - 328): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.71 out of 23.79

Confidence: medium

Additional weak hits (25):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.36 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.91 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.43 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 20.59 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.49 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.28 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.54 out of 26.12

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.79 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.28 out of 39.62

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.55 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.92 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.75 out of 30.22

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.04 out of 26.85

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.50 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.16 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.28 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.38 out of 27.18

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.89 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

Type II PKS

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 79464 - 166460:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 79464 - 151989:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 111236 - 152283:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 123252 - 164290:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 124354 - 166460:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JJV70_RS10235: mal

PKS_AT (12..294): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 64.7
Methylmalonyl-CoA: 50.0
Methoxymalonyl-CoA: 47.7
Propionyl-CoA: 41.5
Ethylmalonyl-CoA: 29.3
trans-1,2-CPDA: 20.6
fatty_acid: 15.5
inactive: 14.7
CHC-CoA: 11.9
2-Methylbutyryl-CoA: 11.8
Benzoyl-CoA: 10.3
Isobutyryl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

JJV70_RS10285: mal

PKS_AT (99..379): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 99.0
Methylmalonyl-CoA: 72.1
Methoxymalonyl-CoA: 62.8
inactive: 60.4
Propionyl-CoA: 51.4
Ethylmalonyl-CoA: 40.2
Isobutyryl-CoA: 30.5
2-Methylbutyryl-CoA: 27.1
trans-1,2-CPDA: 19.4
CHC-CoA: 10.4
fatty_acid: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

JJV70_RS10295: NH2

CAL_domain (37..467): NH2

minowa: NH2

Prediction, score:

NH2: 125.7
fatty_acid: 27.2
AHBA: 16.4
shikimic_acid: 6.1
Acetyl-CoA: -1.2

JJV70_RS10360: Hpr

Search NORINE for peptide: strict or relaxed

AMP-binding (94..504): Hpr

nrpys: Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: N/A
Single AA prediction:: pip (Hpr)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHTFDFCVQEAYALQGGEVNVYGPAETHAATAH
Nearest Stachelhaus code(s):: Hpr DFQFLGVAVK (82% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 11 - 112; Score: 68.9; RRE type: NHLP_CD_RRE; Location: 11 - 93; Score: 56.9; RRE type: Cyanobactin_D_RRE; Location: 13 - 87; Score: 46.5

Type II PKS gene cluster prediction details

Cluster section:: 79464 to 151989
Starter unit(s):: 2-methylbutyryl-CoA (Score: 807.0; E-value: 6.15e-180)
propionyl-CoA (Score: 128.0; E-value: 1.01e-36)
Malonyl elongations:: 8|9 (Score: 678.4; E-value: 6.6e-207)
Product molecular weight(s):: 2-methylbutyryl-CoA_8: 393 Da
2-methylbutyryl-CoA_9: 435 Da
propionyl-CoA_8: 365 Da
propionyl-CoA_9: 407 Da

JJV70_RS10205: KR C9 (Score: 450.0; E-value: 5.6e-138)
JJV70_RS10215: CYC C5-C14 (Score: 457.4; E-value: 4.4e-140)
JJV70_RS10235: AT (Score: 418.1; E-value: 5.8e-128); AT ADB23379.1_TLN-05220/TLN-05223_2-methylbutyryl-CoA (Score: 314.0; E-value: 8.96e-106)
JJV70_RS10240: ACP (Score: 115.0; E-value: 2.8e-36)
JJV70_RS10245: CLF 8|9 (Score: 678.4; E-value: 6.6e-207)
JJV70_RS10250: KS (Score: 760.0; E-value: 1.4e-231)
JJV70_RS10285: AT (Score: 182.3; E-value: 2.9e-56); AT ABC00730.1_Cosmomycin_propionyl-CoA (Score: 128.0; E-value: 1.01e-36)
JJV70_RS10305: CYC C7-C12 (Score: 431.2; E-value: 4e-132)
JJV70_RS10310: KSIII (Score: 494.8; E-value: 2.9e-151); KSIII AKT74268.1_Trioxacarcin_2-methylbutyryl-CoA (Score: 493.0; E-value: 6.15e-180)
JJV70_RS10320: KR (Score: 182.6; E-value: 2.5e-56)

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism

NZ_JAEVFI010000012.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 44,541 - 88,404 nt. (total: 43,864 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

JJV70_RS11310: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

JJV70_RS11345: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Ligases: ligase

JJV70_RS11395: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JJV70_RS11410: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.70	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002274.2	0.62	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	0.61	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.70	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002274.2	0.62	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	0.61	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.25 out of 18.46

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

Additional weak hits (6):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.96 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.30 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.83 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.34 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.04 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 20.55 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 44540 - 88404:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JJV70_RS11330: Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (21..431): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: QWLTFDAAQWEAQGFSGGEVNLYGPTETTINATS
Nearest Stachelhaus code(s):: Gln DAWQFGLINK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

JJV70_RS11395: X

AMP-binding (70..526): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ENALFGRMVA-GLA------------EATTAATA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JAEVFI010000014.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 10,214 - 20,612 nt. (total: 10,399 nt) Show pHMM detection rules used

Region on contig edge.

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

JJV70_RS12150: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

JJV70_RS12165: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000856.3	0.55	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.51	other (other)	ectoine	Methylophaga alcalica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000856.3	0.55	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.51	other (other)	ectoine	Methylophaga alcalica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (8):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.31 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.33 out of 20.01

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.10 out of 18.57

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.79 out of 30.97

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.58 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_JAEVFI010000018.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 55,611 - 71,808 nt. (total: 16,198 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001655.3	0.51	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0002064.2	0.48	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0002490.2	0.47	other (other)	yersinopine	Yersinia pestis CO92
BGC0002575.2	0.45	ribosomal	cochonodin I	Streptococcus suis
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001660.3	0.40	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001655.3	0.51	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0002064.2	0.48	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0002490.2	0.47	other (other)	yersinopine	Yersinia pestis CO92
BGC0002575.2	0.45	ribosomal	cochonodin I	Streptococcus suis
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001660.3	0.40	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.88 out of 29.72

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 5 - 83; Score: 37.5

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
NtrC	Nitrogen regulatory protein C

NZ_JAEVFI010000019.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 29,746 - 52,469 nt. (total: 22,724 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JJV70_RS15380: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: glycosyltransferase methyltransferase

JJV70_RS15440: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

JJV70_RS15445: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.68	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.59	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.56	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002698.2	0.52	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000546.3	0.51	ribosomal	SAL-2242	Streptomyces albidoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.68	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.59	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.56	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002698.2	0.52	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000546.3	0.51	ribosomal	SAL-2242	Streptomyces albidoflavus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for JJV70_RS15415

JJV70_RS15420

Leader:

MALLDLQKMETPDNGYGDVGS

Core:

NVSLLICDKHSGASTILCL

Core with dehydrations:

NVDhaLLICysDKHDhaGADhaDhbILCysL

antiSMASH-DB 4.0 matches for JJV70_RS15420

100.0%

NZ_JAEVFI010000019.1:

Lanthipeptides: JJV70_RS15420_lanthipeptide

1

NVSLLICDKHSGASTILCL

19

NVSLLICDKHSGASTILCL

1

NVSLLICDKHSGASTILCL

19

78.9%

NZ_FNVO01000002.1and 2 others:

NZ_FNVO01000002.1 Lanthipeptides: C4U03_RS04695_lanthipeptideNZ_FNVO01000002.1 Lanthipeptides: C4U03_RS04695_lanthipeptide

Lanthipeptides: C4U03_RS04695_lanthipeptide

1

NVSLLICDKHSGASTILCL

19

+VSLL+CDKHS STILCL

1

SVSLLLCDKHSSHSTILCL

19

68.4%

NZ_CP032402.1and 1 other:

NZ_CP032402.1 Lanthipeptides: D3U04_RS17070_lanthipeptide

Lanthipeptides: D3U04_RS17070_lanthipeptide

1

NVSLLICDKHSGASTILCL

19

+ SLL+CDKHS ST+LCL

1

SASLLLCDKHSSQSTVLCL

19

with 55 more sequence matches

Only the first 10 are displayed here.

65.0%

NZ_BBQG01000022.1and 5 others:

NZ_CP048875.1 Lanthipeptides: G3260_RS30690_lanthipeptideNZ_CP050693.1 Lanthipeptides: HC362_RS03880_lanthipeptideNZ_CP103060.1 Lanthipeptides: NR995_RS03375_lanthipeptideNZ_KE150472.1 Lanthipeptides: HMPREF1486_RS35560_lanthipeptideNZ_VJOK01000001.1 Lanthipeptides: FM076_RS28910_lanthipeptide

Lanthipeptides: TU22_RS34220_lanthipeptide

1

NVSLLICDKHSGASTILCL

19

+ SLL+CDKHS ST+LCL

2

SASLLLCDKHSSHSTLLCL

20

63.2%

NC_013510.1and 2 others:

NC_013510.1 Lanthipeptides: TCUR_RS26055_lanthipeptideNC_013510.1 Lanthipeptides: TCUR_RS26055_lanthipeptide

Lanthipeptides: TCUR_RS26055_lanthipeptide

1

NVSLLICDKHSGASTILCL

19

+ SLL+CDK S ST+LCL

1

SASLLLCDKFSAFSTLLCL

19

60.0%

NZ_AUBE01000003.1:

Lanthipeptides: G412_RS38950_lanthipeptide

1

NVSLLICDKHSGASTILCL

19

++SLL CDKHS S +LCL

2

SLSLLACDKHSSNSFLLCL

20

57.9%

NZ_MTBP01000002.1:

Lanthipeptides: BTM25_RS21150_lanthipeptide

2

VSLLICDKHSGASTILCL

19

VSLL+C S AS +LCL

4

VSLLLC--FSYASVLLCL

19

57.1%

NZ_CP021744.1and 3 others:

NZ_CP097123.1 Lanthipeptides: M1P56_RS05765_lanthipeptideNZ_JACHJF010000016.1 Lanthipeptides: FHS36_RS22695_lanthipeptideNZ_JAJQQQ010000006.1 Lanthipeptides: LUZ28_RS13020_lanthipeptide

Lanthipeptides: SMD11_RS23510_lanthipeptide

1

NVSLLICDKHSGASTILCL

19

NVSLL+C S AS LCL

5

NVSLLLC--WSTASVALCL

21

57.1%

NZ_FMHI01000010.1:

Lanthipeptides: H180DRAFT_RS29175_lanthipeptide

1

NVSLLICDKHSGASTILCL

19

+ SLL+CDK S ST+LCL

3

SASLLLCDKFSSHSTLLCL

21

56.5%

NC_016582.1and 1 other:

NZ_FOLM01000007.1 Lanthipeptides: BM242_RS14445_lanthipeptide

Lanthipeptides: SBI_RS53340_lanthipeptide

1

NVSLLICDKHSGASTILCL

19

+VSLL+CDKHS S +LCL

5

SVSLLLCDKHSSHSNLLCL

23

56.5%

NZ_CP021121.1and 1 other:

NZ_CP084541.1 Lanthipeptides: LC193_RS06630_lanthipeptide

Lanthipeptides: CAG99_RS21195_lanthipeptide

1

NVSLLICDKHSGASTILCL

19

++SLLICD HS S ILCL

5

SLSLLICDTHSSNSVILCL

23

55.0%

NZ_BNBU01000005.1:

Lanthipeptides: IE303_RS19905_lanthipeptide

1

NVSLLICDKHSGASTILCL

19

+SLL+CD S AS LCL

4

QLSLLLCD--SVASVALCL

20

55.0%

NZ_FOGO01000006.1and 1 other:

NZ_LJGV01000022.1 Lanthipeptides: AN217_RS28695_lanthipeptide

Lanthipeptides: BMX65_RS32100_lanthipeptide

1

NVSLLICDKHSGASTILCL

19

+ SLL+CDK S S +LCL

2

SASLLLCDKLSSHSALLCL

20

MIBiG 4.0 matches for JJV70_RS15420

40.9%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

1

NVSLLICDKHSGASTILC

18

VSLL+C+ +S S +LC

4

QVSLLVCE-YSSLSVVLC

20

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 17.94 out of 23.05

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.70 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.98 out of 28.14

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

JJV70_RS15420 - Class III

Cleavage pHMM score: 12.50

RODEO score: 0

Monoisotopic mass: 1914.0 Da

Molecular weight: 1915.3 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1933.3 Da N = 1; 1951.3 Da N = 2

TFBS definitions

Regulator	Description

NZ_JAEVFI010000001.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 68,914 - 113,590 nt. (total: 44,677 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

JJV70_RS00510: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase glycosyltransferase methyltransferase transferase

JJV70_RS00355: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

JJV70_RS00370: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

JJV70_RS00380: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

JJV70_RS00395: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

JJV70_RS00400: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase peptidase

JJV70_RS00345: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

JJV70_RS00385: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: dehydratase

JJV70_RS00435: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

JJV70_RS00415: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JJV70_RS00420: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000428.5	0.66	NRPS	sibiromycin	Streptosporangium sibiricum
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.63	NRPS	peramine	Epichloe festucae
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001250.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000428.5	0.66	NRPS	sibiromycin	Streptosporangium sibiricum
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.63	NRPS	peramine	Epichloe festucae
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001250.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

Additional weak hits (10):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.49 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.76 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.82 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.22 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.46 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.52 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.30 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.36 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 68913 - 113590:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JJV70_RS00415: X

AMP-binding (19..409): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VYSAFAASTTELNLIVSGDYNAYGCTENSALTAV
Nearest Stachelhaus code(s):: mxAnt AATHLSATLK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

JJV70_RS00420: X

AMP-binding (555..960): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LRQMFDVSFEEGFLYTTGELNVYGPSEAHLCTAY
Nearest Stachelhaus code(s):: Trp or Tyr DVMFYTALVK (79% 8Å match); proPro DVLYYTALCK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MexT	Global virulence regulator

NZ_JAEVFI010000001.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 147,150 - 158,604 nt. (total: 11,455 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.79	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.43	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.42	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002531.3	0.41	NRPS	cepaciachelin	Burkholderia ambifaria AMMD
BGC0002005.2	0.41	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0001843.2	0.41	NRPS	tridecaptin M	Paenibacillus sp. M-152

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.79	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.43	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.42	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002531.3	0.41	NRPS	cepaciachelin	Burkholderia ambifaria AMMD
BGC0002005.2	0.41	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0001843.2	0.41	NRPS	tridecaptin M	Paenibacillus sp. M-152

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.15 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 26.44 out of 28.19

Confidence: strong

Additional weak hits (10):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.12 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 10.75 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.38 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.33 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.66 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.48 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.29 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.31 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.41 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 14.96 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
FuR variant 1	Ferric Uptake Regulator
ZuR variant 1	Zinc-responsive repressor

NZ_JAEVFI010000001.1 - Region 3 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 216,475 - 300,269 nt. (total: 83,795 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JJV70_RS01010: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

JJV70_RS01065: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

JJV70_RS01095: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

JJV70_RS01205: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acetyltransferase aminotransferase glycosyltransferase transferase

JJV70_RS00980: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

JJV70_RS01035: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

JJV70_RS01080: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

JJV70_RS01085: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: esterase hydrolase

JJV70_RS01055: thioesterase

smcogs: SMCOG1004: thioesterase

JJV70_RS01165: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: dehydratase hydratase

JJV70_RS00985: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

JJV70_RS00990: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

JJV70_RS01090: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

JJV70_RS01000: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

JJV70_RS01060: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JJV70_RS01105: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JJV70_RS01115: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JJV70_RS01120: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JJV70_RS01130: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JJV70_RS01135: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JJV70_RS01150: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JJV70_RS01155: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JJV70_RS01160: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JJV70_RS01170: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JJV70_RS01175: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

JJV70_RS01030: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.78	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.78	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.77	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.71	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.71	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.74	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.72	NRPS	enniatin	Fusarium equiseti
BGC0002164.2	0.71	NRPS	peramine	Epichloe festucae
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.36 out of 27.04

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.70 out of 23.79

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.86 out of 36.53

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.03 out of 26.85

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.06 out of 23.79

Confidence: medium

Additional weak hits (11):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.95 out of 30.25

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.32 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.74 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.29 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.78 out of 29.65

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.68 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.41 out of 36.53

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.18 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 216474 - 300269:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Orn) + (NH2) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 216474 - 295859:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Orn) + (NH2) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 258382 - 300269:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Orn) + (NH2) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JJV70_RS01060: X

AMP-binding (18..430): X

nrpys: Gua

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGIAFSVAAEESQLVVGSEVQEYGATEATVSQVL
Nearest Stachelhaus code(s):: Gua SVEQVGEVSK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

JJV70_RS01105: X

AMP-binding (15..406): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAACFDLSVCDVCALTGGEFNIYGPTETTVSAAA
Nearest Stachelhaus code(s):: bMe-Asp DLTKLGMVNK (62% 8Å match); Asn DLTKVGDVSK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

JJV70_RS01120: X

AMP-binding (531..936): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWFSHDPMLRDVNLFFGGDVNFYGTTETQVMSAY
Nearest Stachelhaus code(s):: D-Glu DPRHSGVVGK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

JJV70_RS01130: NH2

CAL_domain (34..482): NH2

minowa: NH2

Prediction, score:

NH2: 149.1
Acetyl-CoA: 44.7
fatty_acid: 37.1
AHBA: 6.0
shikimic_acid: -4.0

JJV70_RS01135: X

AMP-binding (16..403): X

nrpys: Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GIYVF-GMVAGTVALSSGASEVYGCTEAGIIASR
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

JJV70_RS01150: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (512..928): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: ASWAFDVFTGDRDLAVGADVNSYGITESTVDSGL
Nearest Stachelhaus code(s):: Lys DVGDVGSIDK (71% 8Å match); Orn DVGEIGSVDK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

JJV70_RS01160: X

AMP-binding (10..417): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWEAFDAILRDVHTALAGELNLYGPSETTMTKMF
Nearest Stachelhaus code(s):: Asp DVRHFALMAK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism

NZ_JAEVFI010000001.1 - Region 4 - terpene

Download region GenBank file

Download region SVG

Location: 315,341 - 339,205 nt. (total: 23,865 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

JJV70_RS01375: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.54	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.51	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002073.3	0.45	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002398.2	0.45	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002531.3	0.44	NRPS	cepaciachelin	Burkholderia ambifaria AMMD
BGC0001870.3	0.42	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0000924.5	0.42	other (other)	pyrrolnitrin	Pseudomonas chlororaphis
BGC0000639.3	0.41	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.41	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000642.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.54	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.51	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002073.3	0.45	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002398.2	0.45	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002531.3	0.44	NRPS	cepaciachelin	Burkholderia ambifaria AMMD
BGC0001870.3	0.42	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0000924.5	0.42	other (other)	pyrrolnitrin	Pseudomonas chlororaphis
BGC0000639.3	0.41	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.41	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000642.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

JJV70_RS22360: TS_Pyr4

Domain 1 (276 - 456): Pyr4 type terpene synthase

Subtype: unknown

JJV70_RS01375: PT_FPPS_like

Domain 1 (41 - 299): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: IPP, DMAPP → FPP

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.68 out of 23.43

Confidence: medium

Additional weak hits (4):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.88 out of 31.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.11 out of 32.74

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.42 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator

NZ_JAEVFI010000001.1 - Region 5 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 392,400 - 425,103 nt. (total: 32,704 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

JJV70_RS01670: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Isomerases: mutase

JJV70_RS01665: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.53	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0001531.5	0.51	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae
BGC0001499.5	0.49	other (other)	aerobactin	Pantoea ananatis
BGC0002633.2	0.47	other (other)	schizokinen	Leptolyngbya sp. PCC 7376

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.53	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0001531.5	0.51	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae
BGC0001499.5	0.49	other (other)	aerobactin	Pantoea ananatis
BGC0002633.2	0.47	other (other)	schizokinen	Leptolyngbya sp. PCC 7376

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.54 out of 18.46

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.16 out of 26.33

Confidence: medium

Additional weak hits (10):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.25 out of 35.63

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.46 out of 27.18

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.02 out of 27.18

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.26 out of 24.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.63 out of 25.88

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.56 out of 23.43

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.61 out of 26.85

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAEVFI010000025.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 27,423 - 63,012 nt. (total: 35,590 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

JJV70_RS17465: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase

JJV70_RS23290: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase

JJV70_RS17445: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

JJV70_RS17475: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JJV70_RS17480: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JJV70_RS17485: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.96 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.39 out of 30.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.56 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.58 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.10 out of 18.57

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.49 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.06 out of 33.14

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.02 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 27422 - 63012:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Gly) + (Ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JJV70_RS17475: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (523..945): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: NNQAFDISLWQAQVATVGEVNCYGPTECSDIVAR
Nearest Stachelhaus code(s):: Gly DIWQATCDDK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

JJV70_RS17480: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (476..883): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NSEAFDISVWQVQVAVTGEVNCYGPTECSDDVTQ
Nearest Stachelhaus code(s):: Gly DIWQATCDDK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

JJV70_RS17485: X

AMP-binding (468..871): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LFHAFDTSWEGADVMLGGEFNYYGPSEFCVEASG
Nearest Stachelhaus code(s):: Orn DTEDMGYVDK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_JAEVFI010000027.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 43,885 - 87,163 nt. (total: 43,279 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: formyltransferase halogenase

JJV70_RS18035: flavin-dependent tyrosine-like hpg halogenase

halogenases: flavin-dependent tyrosine-like hpg halogenase
smcogs: SMCOG1119: halogenase

JJV70_RS18110: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Lyases: dehydratase

JJV70_RS18045: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.76	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002582.3	0.61	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.76	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002582.3	0.61	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.04 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.46 out of 23.79

Confidence: medium

Additional weak hits (9):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.53 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.55 out of 36.54

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.05 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.48 out of 30.25

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.65 out of 23.43

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.09 out of 36.53

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.02 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 43884 - 87163:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JJV70_RS18045: X

AMP-binding (31..437): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSDYADASTIESYLSAGGECNLYGPTENSVVSTV
Nearest Stachelhaus code(s):: Leu DAWYLGNVVK (59% 8Å match); Leu or Ile DAIYLGVVLK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JAEVFI010000002.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 135,626 - 160,820 nt. (total: 25,195 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

JJV70_RS02675: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

JJV70_RS22400: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Ligases: synthase

JJV70_RS02700: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.48	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000551.5	0.46	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001727.3	0.45	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000506.4	0.45	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000515.4	0.45	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000536.3	0.44	ribosomal	nisin Q	Lactococcus lactis
BGC0000559.4	0.44	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0002698.2	0.43	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000504.5	0.43	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.48	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000551.5	0.46	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001727.3	0.45	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000506.4	0.45	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000515.4	0.45	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000536.3	0.44	ribosomal	nisin Q	Lactococcus lactis
BGC0000559.4	0.44	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0002698.2	0.43	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000504.5	0.43	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for JJV70_RS02675

JJV70_RS02680

Leader:

MSESTAVATATAPVPSVEAQPDPFGLDITFIEGTPATE

Core:

TVLMCSTGDTCGSSCPSACVTS

Core with dehydrations:

DhbVLMCysDhaDhbGDDhbCysGDhaDhaCysPDhaACysVDhbDha

antiSMASH-DB 4.0 matches for JJV70_RS02680

100.0%

NZ_BMVW01000003.1and 2 others:

NZ_CP011799.1 Lanthipeptides: QR97_RS02045_lanthipeptideNZ_JAEVFI010000002.1 Lanthipeptides: JJV70_RS02680_lanthipeptide

Lanthipeptides: IE242_RS12765_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

TVLMCSTGDTCGSSCPSACVTS

1

TVLMCSTGDTCGSSCPSACVTS

22

95.5%

NZ_BBYG01000011.1and 23 others:

NZ_BBZE01000004.1 Lanthipeptides: AOQ56_RS00075_lanthipeptideNZ_BMUG01000008.1 Lanthipeptides: IE264_RS24565_lanthipeptideNZ_CP013219.1 Lanthipeptides: SHL15_RS30830_lanthipeptideNZ_CP021978.1 Lanthipeptides: CEB94_RS33350_lanthipeptideNZ_CP029342.1 Lanthipeptides: B9S64_RS02555_lanthipeptideNZ_CP030073.1 Lanthipeptides: DN051_RS07240_lanthipeptideNZ_CP041610.2 Lanthipeptides: FNV62_RS40125_lanthipeptideNZ_CP041613.2 Lanthipeptides: FNV68_RS42745_lanthipeptideNZ_CP051006.1 Lanthipeptides: HEP81_RS07390_lanthipeptideNZ_CP074102.1 Lanthipeptides: SMIR_RS04425_lanthipeptideNZ_CP101397.1 Lanthipeptides: NLU04_RS20150_lanthipeptideNZ_CP113910.1 Lanthipeptides: HUV60_RS04250_lanthipeptideNZ_FKJI03000004.1 Lanthipeptides: A7P67_RS09720_lanthipeptideNZ_JACHCX010000047.1 Lanthipeptides: HDC93_RS37275_lanthipeptideNZ_KQ948477.1 Lanthipeptides: AQJ27_RS43755_lanthipeptideNZ_KQ948550.1 Lanthipeptides: AQJ30_RS07460_lanthipeptideNZ_LIVY01000006.1 Lanthipeptides: AMK30_RS21645_lanthipeptideNZ_LMDL01000002.1 Lanthipeptides: ASD08_RS03885_lanthipeptideNZ_RAII01000001.1 Lanthipeptides: EBH12_RS06225_lanthipeptideNZ_SHKS01000004.1 Lanthipeptides: EV567_RS16240_lanthipeptideNZ_SHKU01000001.1 Lanthipeptides: EV284_RS02155_lanthipeptideNZ_SZNQ01000001.1 Lanthipeptides: E4U91_RS28815_lanthipeptideNZ_VIUV01000003.1 Lanthipeptides: FB570_RS08885_lanthipeptide

Lanthipeptides: AOQ37_RS11080_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

TVLMCSTGDTCGSSCPSAC TS

1

TVLMCSTGDTCGSSCPSACTTS

22

90.9%

NZ_CP029042.1:

Lanthipeptides: DDE74_RS17120_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

TVLMCSTGD CGSSCPSAC TS

1

TVLMCSTGDNCGSSCPSACTTS

22

with 191 more sequence matches

Only the first 10 are displayed here.

90.9%

NZ_CP050976.1:

Lanthipeptides: HEP86_RS36805_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

TVLMC+TGDTCGSSCPSAC TS

1

TVLMCTTGDTCGSSCPSACTTS

22

90.9%

NZ_CP070379.1:

Lanthipeptides: JVE63_RS10125_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

TVL C+TGDTCGSSCPSACVTS

1

TVLTCTTGDTCGSSCPSACVTS

22

86.4%

NZ_BMSO01000039.1and 5 others:

NZ_BMTU01000002.1 Lanthipeptides: IE118_RS05930_lanthipeptideNZ_BMUK01000002.1 Lanthipeptides: IE276_RS05195_lanthipeptideNZ_CP036534.1 Lanthipeptides: EZV63_RS30040_lanthipeptideNZ_KB907208.1 Lanthipeptides: G339_RS0101560_lanthipeptideNZ_KB907208.1 Lanthipeptides: G339_RS0101560_lanthipeptide

Lanthipeptides: IE184_RS41715_lanthipeptide

3

LMCSTGDTCGSSCPSACVTS

22

LMCSTGDTCGSSCPSAC TS

1

LMCSTGDTCGSSCPSACTTS

20

86.4%

NZ_CP045178.1:

Lanthipeptides: GBW32_RS14380_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

T+LMCSTGD CGSSCPSAC TS

1

TMLMCSTGDNCGSSCPSACTTS

22

86.4%

NZ_KI866523.1and 2 others:

NZ_VYTZ01000014.1 Lanthipeptides: F5972_RS30195_lanthipeptideNZ_VYTZ01000014.1 Lanthipeptides: F5972_RS30195_lanthipeptide

Lanthipeptides: MPTA5024_RS18085_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

TVL+CSTGD CGSSCPSAC TS

1

TVLLCSTGDNCGSSCPSACTTS

22

86.4%

NZ_ML123117.1:

Lanthipeptides: EES46_RS09865_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

TVLMC TGD CGSSCPSAC TS

1

TVLMCGTGDNCGSSCPSACTTS

22

81.8%

NZ_CP036455.1:

Lanthipeptides: EKD16_RS21370_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

T L+CSTGD CGSSCPSAC TS

1

TELLCSTGDNCGSSCPSACTTS

22

81.8%

NZ_FNCN01000004.1:

Lanthipeptides: BLQ73_RS05220_lanthipeptide

3

LMCSTGDTCGSSCPSACVTS

22

LMC TGDTCGSSCPSAC TS

1

LMCGTGDTCGSSCPSACTTS

20

81.8%

NZ_JAHLXF010000013.1:

Lanthipeptides: KQY13_RS21225_lanthipeptide

3

LMCSTGDTCGSSCPSACVTS

22

LMCSTGD CGSSCPSAC TS

1

LMCSTGDNCGSSCPSACTTS

20

77.3%

NZ_FOQY01000053.1:

Lanthipeptides: BM085_RS43985_lanthipeptide

3

LMCSTGDTCGSSCPSACVTS

22

LMCSTGD CG+SCPSAC TS

1

LMCSTGDNCGTSCPSACTTS

20

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.32 out of 28.19

Confidence: strong

Additional weak hits (16):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.79 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.56 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.60 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.65 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.99 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.38 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.47 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.05 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.21 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.43 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.79 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.11 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.57 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.75 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.19 out of 23.43

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

JJV70_RS02680 - Class I

Cleavage pHMM score: -9.90

RODEO score: 24

Monoisotopic mass: 1946.8 Da

Molecular weight: 1948.2 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 1966.2 Da N = 1; 1984.2 Da N = 2; 2002.3 Da N = 3; 2020.3 Da N = 4; 2038.3 Da N = 5

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 156 - 241; Score: 55.7

TFBS definitions

Regulator	Description
ZuR variant 1	Zinc-responsive repressor

NZ_JAEVFI010000032.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 119,810 - 142,247 nt. (total: 22,438 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase

JJV70_RS19845: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Lyases: cyclase

JJV70_RS19870: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Isomerases: mutase

JJV70_RS19895: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthetase

JJV70_RS19865: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.57	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.54	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.50	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.49	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002398.2	0.47	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001910.4	0.45	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000286.3	0.41	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001456.3	0.40	terpene	isorenieratene	Streptomyces argillaceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.57	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.54	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.50	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.49	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002398.2	0.47	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001910.4	0.45	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000286.3	0.41	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001456.3	0.40	terpene	isorenieratene	Streptomyces argillaceus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

JJV70_RS19865: PT_FPPS_like

Domain 1 (48 - 356): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

JJV70_RS19870: T1TS

Domain 1 (3 - 332): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.13 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.62 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAEVFI010000039.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 11,942 - 47,663 nt. (total: 35,722 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

JJV70_RS21060: methyltransferase

smcogs: SMCOG1089: methyltransferase

JJV70_RS21075: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: esterase

JJV70_RS21085: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

JJV70_RS21080: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000016.4	0.54	other (other)	amphotericin B	Streptomyces nodosus
BGC0001844.4	0.48	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0002518.3	0.47	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000016.4	0.54	other (other)	amphotericin B	Streptomyces nodosus
BGC0001844.4	0.48	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0002518.3	0.47	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.58 out of 30.11

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (10):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.78 out of 21.55

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.44 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.40 out of 28.14

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.76 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.22 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.67 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.94 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 11941 - 47663:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JJV70_RS21080: Acetyl-CoA - Cys

Search NORINE for peptide: strict or relaxed

CAL_domain (53..560): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 18.3
NH2: 9.2
AHBA: 4.8
shikimic_acid: 1.8
fatty_acid: 0.0

AMP-binding (1278..1709): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDFSFDLSVADGDSWLSGDTAAGGATEAAIWSVA
Nearest Stachelhaus code(s):: Cys DLYDMSMIWK (76% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CelR	Cellobiose uptake repressor
NtrC	Nitrogen regulatory protein C
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAEVFI010000043.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 2,256 - 17,030 nt. (total: 14,775 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase transferase

JJV70_RS21445: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

JJV70_RS21450: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Lyases: cyclase dehydratase

JJV70_RS21490: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

JJV70_RS21495: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001289.5	0.45	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0000556.5	0.41	ribosomal	streptin	Streptococcus pyogenes
BGC0000234.5	0.40	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002120.3	0.37	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000253.4	0.35	PKS	oviedomycin	Streptomyces antibioticus
BGC0001103.5	0.34	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000261.5	0.33	PKS	R1128	Streptomyces sp. R1128

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001289.5	0.45	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0000556.5	0.41	ribosomal	streptin	Streptococcus pyogenes
BGC0000234.5	0.40	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002120.3	0.37	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000253.4	0.35	PKS	oviedomycin	Streptomyces antibioticus
BGC0001103.5	0.34	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000261.5	0.33	PKS	R1128	Streptomyces sp. R1128

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

RREFinder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 160 - 251; Score: 50.8

NZ_JAEVFI010000044.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 1 - 17,169 nt. (total: 17,169 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

JJV70_RS21505: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Lyases: decarboxylase

JJV70_RS21515: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

JJV70_RS21525: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.67	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002073.3	0.61	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001478.5	0.60	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0001572.3	0.60	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000941.3	0.58	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.57	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001453.5	0.57	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.57	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0000244.4	0.55	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0002620.2	0.51	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.67	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002073.3	0.61	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001478.5	0.60	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0001572.3	0.60	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000941.3	0.58	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.57	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001453.5	0.57	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.57	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0000244.4	0.55	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0002620.2	0.51	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.03 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.19 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.20 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.33 out of 36.53

Confidence: medium

Additional weak hits (4):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 39.62

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.73 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_JAEVFI010000046.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 6,122 - 19,429 nt. (total: 13,308 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

JJV70_RS21725: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: hydratase

JJV70_RS21700: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Translocases: permease

JJV70_RS21690: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001645.3	0.73	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001889.2	0.66	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001781.4	0.64	ribosomal	sphaericin	Planomonospora sphaerica
BGC0000575.5	0.62	ribosomal	lariatin	Rhodococcus jostii
BGC0001551.4	0.61	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001493.5	0.60	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus
BGC0001506.5	0.59	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002053.3	0.59	ribosomal	ulleungdin	Streptomyces sp.
BGC0002074.2	0.57	ribosomal	huascopeptin	Streptomyces huasconensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001645.3	0.73	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001889.2	0.66	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001781.4	0.64	ribosomal	sphaericin	Planomonospora sphaerica
BGC0000575.5	0.62	ribosomal	lariatin	Rhodococcus jostii
BGC0001551.4	0.61	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001493.5	0.60	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus
BGC0001506.5	0.59	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002053.3	0.59	ribosomal	ulleungdin	Streptomyces sp.
BGC0002074.2	0.57	ribosomal	huascopeptin	Streptomyces huasconensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.04 out of 26.06

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.17 out of 27.18

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.90 out of 18.57

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 84; Score: 71.7

TFBS definitions

Regulator	Description

NZ_JAEVFI010000048.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 1 - 13,338 nt. (total: 13,338 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer

JJV70_RS21990: flavodoxin

smcogs: SMCOG1134: flavodoxin

Hydrolases: esterase

JJV70_RS21985: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001499.5	0.44	other (other)	aerobactin	Pantoea ananatis
BGC0000939.5	0.44	other (other)	aerobactin	Grimontia hollisae
BGC0002682.2	0.44	other (other)	aerobactin	Vibrio mimicus
BGC0000295.5	0.44	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001498.5	0.43	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001210.5	0.41	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002692.2	0.40	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001499.5	0.44	other (other)	aerobactin	Pantoea ananatis
BGC0000939.5	0.44	other (other)	aerobactin	Grimontia hollisae
BGC0002682.2	0.44	other (other)	aerobactin	Vibrio mimicus
BGC0000295.5	0.44	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001498.5	0.43	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001210.5	0.41	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002692.2	0.40	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.02 out of 23.79

Confidence: medium

Additional weak hits (2):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.84 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.23 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JAEVFI010000004.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 1 - 38,986 nt. (total: 38,986 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxidoreductase oxygenase

JJV70_RS04325: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

JJV70_RS04370: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

JJV70_RS04395: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Ligases: synthase

JJV70_RS04320: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.83	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000902.4	0.67	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002127.3	0.59	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000285.5	0.58	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000281.3	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0002213.3	0.40	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001483.4	0.40	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.83	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000902.4	0.67	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002127.3	0.59	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000285.5	0.58	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000281.3	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0002213.3	0.40	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001483.4	0.40	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.31 out of 18.57

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.49 out of 24.78

Confidence: medium

Additional weak hits (33):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.33 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.92 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.38 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.08 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.35 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.60 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.60 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.25 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.70 out of 21.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.41 out of 32.74

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.28 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.56 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.76 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.29 out of 28.14

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.30 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.53 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.27 out of 28.14

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.39 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.53 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.13 out of 20.01

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.26 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.49 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.20 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.42 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.74 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.97 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.62 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
ToxT	Regulator of MSHA biosynthesis

NZ_JAEVFI010000053.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1 - 5,650 nt. (total: 5,650 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

JJV70_RS22195: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.63	ribosomal	albusnodin	Streptomyces albus
BGC0001307.3	0.42	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0002064.2	0.35	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0000579.4	0.35	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083
BGC0002425.3	0.33	ribosomal	stlassin	Streptomyces sp.
BGC0001435.4	0.25	NRPS, PKS	ikarugamycin	Streptomyces sp. ZJ306
BGC0001918.3	0.22	NRPS, PKS	JBIR-06	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.63	ribosomal	albusnodin	Streptomyces albus
BGC0001307.3	0.42	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0002064.2	0.35	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0000579.4	0.35	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083
BGC0002425.3	0.33	ribosomal	stlassin	Streptomyces sp.
BGC0001435.4	0.25	NRPS, PKS	ikarugamycin	Streptomyces sp. ZJ306
BGC0001918.3	0.22	NRPS, PKS	JBIR-06	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Lasso peptides

Core peptide predictions

No core peptides found.

NZ_JAEVFI010000056.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,199 nt. (total: 2,199 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

JJV70_RS22225: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 2199:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JJV70_RS22225: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (1..390): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TAQVWDIFILEGWFITGGEVNGYGPAESMVITNA
Nearest Stachelhaus code(s):: Val DALWIGGVFK (50% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

NZ_JAEVFI010000005.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 24,575 - 67,985 nt. (total: 43,411 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

JJV70_RS04975: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

JJV70_RS04995: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

JJV70_RS05060: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JJV70_RS05080: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Hydrolases: hydrolase

JJV70_RS05035: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

JJV70_RS05030: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

JJV70_RS05025: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JJV70_RS05070: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.60	NRPS	peramine	Epichloe festucae
BGC0001249.5	0.59	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.58	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000343.5	0.53	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001868.4	0.52	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001302.5	0.50	other (other)	lomofungin	Streptomyces lomondensis
BGC0002561.3	0.48	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.60	NRPS	peramine	Epichloe festucae
BGC0001249.5	0.59	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.58	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000343.5	0.53	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001868.4	0.52	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001302.5	0.50	other (other)	lomofungin	Streptomyces lomondensis
BGC0002561.3	0.48	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.51 out of 27.04

Confidence: medium

Additional weak hits (9):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.18 out of 39.62

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.38 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.83 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.68 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.21 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.12 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.53 out of 27.04

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.10 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 24574 - 67985:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JJV70_RS05025: X

AMP-binding (45..479): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MGTMHVAGHSSNSLVLGGAHNIYGSTEAAGISVD
Nearest Stachelhaus code(s):: Lys DAESVGTIIK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

JJV70_RS05070: X

AMP-binding (11..415): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NVNLHTFGQTGAYGISGGAYEGYGLSETSPTAAV
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor

NZ_JAEVFI010000005.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 195,251 - 205,703 nt. (total: 10,453 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

JJV70_RS05680: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Similar gene clusters

Analysis type:

Reference	RiPP-like	Similarity score	Type	Compound(s)	Organism
BGC0000395.5		0.20	NRPS	nocardicin A	Nocardia uniformis subsp. tsuyamanensis

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0000395.5		0.20	NRPS	nocardicin A	Nocardia uniformis subsp. tsuyamanensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

Additional weak hits (4):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.59 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.28 out of 28.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_JAEVFI010000007.1 - Region 1 - CDPS

Download region GenBank file

Download region SVG

Location: 120,207 - 140,917 nt. (total: 20,711 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

JJV70_RS07455: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

JJV70_RS07490: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

JJV70_RS07500: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Transferases: carboxylase kinase methyltransferase transferase

JJV70_RS07415: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

JJV70_RS07435: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

JJV70_RS07470: methyltransferase

smcogs: SMCOG1089: methyltransferase

JJV70_RS07480: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: hydrolase

JJV70_RS07425: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001986.3	0.59	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000234.5	0.46	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000903.3	0.46	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000902.4	0.41	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001529.5	0.41	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0002070.3	0.41	PKS	SEK90, pentangumycin	Saccharothrix espanaensis DSM 44229
BGC0000253.4	0.40	PKS	oviedomycin	Streptomyces antibioticus
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002547.2	0.40	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces youssoufiensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001986.3	0.59	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000234.5	0.46	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000903.3	0.46	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000902.4	0.41	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001529.5	0.41	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0002070.3	0.41	PKS	SEK90, pentangumycin	Saccharothrix espanaensis DSM 44229
BGC0000253.4	0.40	PKS	oviedomycin	Streptomyces antibioticus
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002547.2	0.40	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces youssoufiensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.56 out of 29.51

Confidence: medium

Additional weak hits (6):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.68 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.54 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.56 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.81 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
DosR	Hypoxia stress response regulator

NZ_JAEVFI010000008.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 17,640 - 42,115 nt. (total: 24,476 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JJV70_RS07610: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: transferase

JJV70_RS07605: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: cyclase dehydratase

JJV70_RS07665: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

JJV70_RS07685: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

JJV70_RS07650: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000647.3	0.58	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000663.5	0.55	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000647.3	0.58	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000663.5	0.55	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		hydroxysqualene	C30	acyclic	OH
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none

Genes with terpene domains:

JJV70_RS07635: PT_phytoene_like

Domain 1 (17 - 305): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

JJV70_RS07640: PT_phytoene_like

Domain 1 (36 - 318): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

JJV70_RS07650: PT_FPPS_like

Domain 1 (62 - 349): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (11):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.06 out of 32.93

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.60 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.61 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.50 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.07 out of 30.98

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.36 out of 24.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.71 out of 27.18

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_JAEVFI010000008.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 72,697 - 99,498 nt. (total: 26,802 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JJV70_RS07880: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: acetyltransferase methyltransferase

JJV70_RS07865: methyltransferase

smcogs: SMCOG1089: methyltransferase

JJV70_RS07940: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Lyases: dehydratase

JJV70_RS07945: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

JJV70_RS07885: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: transport

JJV70_RS07830: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.67	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.63	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.62	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.61	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.61	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.67	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.63	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.62	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.61	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.61	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

JJV70_RS07860: Lycopene_cycl

Domain 1 (10 - 385): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

JJV70_RS07875: PT_phytoene_like

Domain 1 (16 - 307): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

JJV70_RS07885: PT_FPPS_like

Domain 1 (29 - 338): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.06 out of 26.85

Confidence: medium

Additional weak hits (5):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.25 out of 27.78

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.47 out of 32.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.12 out of 32.74

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_JAEVFI010000009.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 47,925 - 70,257 nt. (total: 22,333 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

JJV70_RS08615: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: acetyltransferase glycosyltransferase

JJV70_RS08660: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

JJV70_RS08725: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: deacetylase hydrolase

JJV70_RS08650: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

JJV70_RS08670: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Isomerases: mutase

JJV70_RS08610: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.67	ribosomal	albusnodin	Streptomyces albus
BGC0002053.3	0.43	ribosomal	ulleungdin	Streptomyces sp.
BGC0001506.5	0.43	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001539.4	0.43	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001781.4	0.43	ribosomal	sphaericin	Planomonospora sphaerica
BGC0002074.2	0.42	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001307.3	0.42	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0002298.2	0.41	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0001507.3	0.41	ribosomal	anantin C	Streptomyces olindensis
BGC0001176.4	0.40	ribosomal	streptomonomicin	Streptomonospora alba

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.67	ribosomal	albusnodin	Streptomyces albus
BGC0002053.3	0.43	ribosomal	ulleungdin	Streptomyces sp.
BGC0001506.5	0.43	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001539.4	0.43	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001781.4	0.43	ribosomal	sphaericin	Planomonospora sphaerica
BGC0002074.2	0.42	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001307.3	0.42	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0002298.2	0.41	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0001507.3	0.41	ribosomal	anantin C	Streptomyces olindensis
BGC0001176.4	0.40	ribosomal	streptomonomicin	Streptomonospora alba

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (8):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.40 out of 21.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 39.62

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.53 out of 32.74

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.35 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.76 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.27 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Lasso peptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems