GCF_018741645.1 - 14 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CP036117.1 (Bacillus mycoides (Bacillus weihenstephanensis))

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRP-metallophore,NRPS,T1PKS	513,809	589,596	Low	nostopeptolide A2	NRPS:Type I+PKS
Region 1.2	azole-containing-RiPP	1,270,427	1,293,961
Region 1.3	NI-siderophore	1,892,458	1,924,175	High	petrobactin	other:other
Region 1.4	NRP-metallophore,NRPS	2,209,159	2,260,911	High	bacillibactin	NRPS:Type I
Region 1.5	RiPP-like	2,295,854	2,306,183
Region 1.6	betalactone	2,481,479	2,506,716	Low	fengycin	NRPS:Type I
Region 1.7	NRPS	2,536,017	2,583,027
Region 1.8	RiPP-like	2,607,104	2,617,379
Region 1.9	lanthipeptide-class-i	3,155,937	3,182,380
Region 1.10	terpene	3,420,281	3,442,134
Region 1.11	terpene-precursor	4,027,545	4,048,438
Region 1.12	lassopeptide	5,026,675	5,050,591	High	paeninodin	ribosomal:unmodified

NZ_CP036118.1 (Bacillus mycoides (Bacillus weihenstephanensis))

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	deazapurine	117,989	140,485

NZ_CP036119.1 (Bacillus mycoides (Bacillus weihenstephanensis))

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	NRPS	93,612	159,547

No secondary metabolite regions were found in these records:: NZ_CP036115.1 (Bacillus mycoides (Bacillus weihenstephanensis)); NZ_CP036120.1 (Bacillus mycoides (Bacillus weihenstephanensis)); NZ_CP036116.1 (Bacillus mycoides (Bacillus weihenstephanensis))

Compact view

NZ_CP036117.1 - Region 1 - NRP-metallophore,NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 513,809 - 589,596 nt. (total: 75,788 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase

EXW43_RS03505: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase

EXW43_RS03500: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase

EXW43_RS03430: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase synthase

EXW43_RS03450: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

EXW43_RS03455: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

EXW43_RS03460: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

EXW43_RS03470: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

EXW43_RS03475: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

EXW43_RS03480: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

EXW43_RS03485: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.34	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	1.25	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	1.24	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	1.22	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001050.5	1.22	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001825.4	1.21	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	1.19	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.16	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	1.15	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001132.4	1.15	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001050.5	0.72	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	0.71	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 26.06 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.52 out of 26.06

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 28.43 out of 29.38

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.13 out of 27.78

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.33 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.19 out of 29.38

Confidence: medium

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 26.52 out of 33.14

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.73 out of 28.19

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.15 out of 24.78

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (8):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.71 out of 30.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.12 out of 36.54

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 17.35 out of 30.12

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.47 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.38 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.87 out of 33.14

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.97 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 513808 - 589596:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (Val - Ala - Ala - Pro) + (ohmal) + (Asp) + (D-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EXW43_RS03450: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (479..878): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LENAFDAATFEGWLLAGGDINGYGPTENTTFTCC
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

EXW43_RS03455: Val - Ala - Ala - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (483..882): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LENAFDAATFEGWLLAGGDINGYGPTENTTFTCC
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1545..1940): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: CATAFDIACVELQALTGGEWNGYGPTEATIYTTI
Nearest Stachelhaus code(s):: Ala DIVQLGLVYK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2601..2996): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: CATAFDIACVELQALTGGEWNGYGPTEATIYTTI
Nearest Stachelhaus code(s):: Ala DIVQLGLVYK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (3658..4065): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWQTFDVSYQETFLITAGEHNQYGPSETHVITAM
Nearest Stachelhaus code(s):: Pro DVQFIAQVVK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

EXW43_RS03460: mal

PKS_AT (536..821): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 157.3
inactive: 114.3
Methoxymalonyl-CoA: 61.9
Methylmalonyl-CoA: 48.9
Propionyl-CoA: 41.1
CHC-CoA: 26.2
2-Methylbutyryl-CoA: 24.6
Ethylmalonyl-CoA: 22.1
Benzoyl-CoA: 18.4
3-Methylbutyryl-CoA: 14.2
fatty_acid: 13.2
Isobutyryl-CoA: 12.7
Acetyl-CoA: 11.7
trans-1,2-CPDA: 0.0

EXW43_RS03475: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (460..864): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGISADLGNTVTKIVFGGEVNHYGPTETTIGVTT
Nearest Stachelhaus code(s):: Asp DLTKVGHIGK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

EXW43_RS03485: X

AMP-binding (266..680): X

nrpys: Glu, Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HGMAFDVSVWQSQLSVGGELNTYGPTECADGVTR
Nearest Stachelhaus code(s):: Dpr DIWQSTADDK (56% 8Å match); dnmeProp or Dab DIWQSTADDK (53% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor
ZuR variant 2	Zinc-responsive repressor

NZ_CP036117.1 - Region 2 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 1,270,427 - 1,293,961 nt. (total: 23,535 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

EXW43_RS07005: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001174.4	0.44	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0000607.5	0.43	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001535.3	0.42	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001146.5	0.41	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000569.5	0.41	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001173.5	0.41	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000606.5	0.39	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001145.5	0.38	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001640.3	0.38	ribosomal	kocurin	Kocuria rosea
BGC0000605.5	0.38	ribosomal	GE37468	Streptomyces sp. ATCC 55365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001174.4	0.44	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0000607.5	0.43	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001535.3	0.42	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001146.5	0.41	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000569.5	0.41	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001173.5	0.41	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000606.5	0.39	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001145.5	0.38	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001640.3	0.38	ribosomal	kocurin	Kocuria rosea
BGC0000605.5	0.38	ribosomal	GE37468	Streptomyces sp. ATCC 55365

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.43 out of 32.93

Confidence: medium

Additional weak hits (3):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 30.06 out of 39.62

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.18 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.71 out of 31.73

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Heterocycloanthracin_C_RRE; Location: 0 - 100; Score: 181.4; RRE type: Thiopeptide_F_RRE; Location: 9 - 89; Score: 41.5

TFBS definitions

Regulator	Description
LexA variant 3	Repressor of DNA damage response

Core peptide predictions

No core peptides found.

NZ_CP036117.1 - Region 3 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 1,892,458 - 1,924,175 nt. (total: 31,718 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

EXW43_RS10290: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: deacetylase

EXW43_RS10220: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Ligases: ligase synthase

EXW43_RS10195: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

EXW43_RS10255: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.4	0.87	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0000941.3	0.50	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001531.5	0.49	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002633.2	0.48	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002683.2	0.48	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002694.2	0.47	other (other)	roseobactin	Phaeobacter inhibens 2.10
BGC0002471.3	0.47	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0002470.2	0.46	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.4	0.87	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0000941.3	0.50	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001531.5	0.49	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002633.2	0.48	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002683.2	0.48	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002694.2	0.47	other (other)	roseobactin	Phaeobacter inhibens 2.10
BGC0002471.3	0.47	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0002470.2	0.46	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.61 out of 29.38

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.55 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.55 out of 19.26

Confidence: medium

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 26.04 out of 35.63

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.06 out of 25.88

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.18 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 15.13 out of 18.16

Confidence: strong

Additional weak hits (2):

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 16.35 out of 20.47

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.12 out of 29.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
FuR variant 1	Ferric Uptake Regulator
NrtR	NAD synthesis repressor
PsrA	Oleic acid responsive regulator
ZuR variant 1	Zinc-responsive repressor

NZ_CP036117.1 - Region 4 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 2,209,159 - 2,260,911 nt. (total: 51,753 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

EXW43_RS11850: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

EXW43_RS11855: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

EXW43_RS11860: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

EXW43_RS11915: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

EXW43_RS11990: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: PPTase

EXW43_RS11950: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: hydrolase

EXW43_RS11930: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: hydratase

EXW43_RS11870: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Isomerases: isomerase

EXW43_RS11920: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

EXW43_RS11925: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

EXW43_RS11935: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

EXW43_RS12000: Pseudouridine synthase

smcogs: SMCOG1154: Pseudouridine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001185.5	1.05	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	0.93	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0000401.5	0.89	NRPS	paenibactin	Paenibacillus elgii B69
BGC0002075.3	0.86	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.85	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.74	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002695.2	0.73	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001185.5	0.80	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	0.76	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0000401.5	0.75	NRPS	paenibactin	Paenibacillus elgii B69
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.74	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002695.2	0.69	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.83 out of 27.78

Confidence: strong

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.00 out of 21.55

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 25.31

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.71 out of 27.78

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.11 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.40 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.38 out of 29.38

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 25.19 out of 30.25

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.17 out of 24.78

Confidence: medium

Additional weak hits (9):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.16 out of 27.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.85 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.92 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 25.52 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.17 out of 29.38

Confidence: weak

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 15.72 out of 18.46

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.93 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.53 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.54 out of 30.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 2209158 - 2260911:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EXW43_RS11925: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SVSLYPMSSPGGALQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PMPAQGVVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

EXW43_RS11935: Gly - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (465..865): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDISALELQALVGGETNLYGPTETTIWSTF
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1525..1938): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEINMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
FuR variant 1	Ferric Uptake Regulator
LexA variant 2	Repressor of DNA damage response

NZ_CP036117.1 - Region 5 - RiPP-like

Download region GenBank file

Download region SVG

Location: 2,295,854 - 2,306,183 nt. (total: 10,330 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: phosphate reductase

EXW43_RS12245: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

Transferases: aminotransferase

EXW43_RS12265: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.47	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.47	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.46	other (other)	ectoine	Methylarcula marina
BGC0000853.3	0.46	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.45	other (ectoine)	ectoine	Streptomyces sp.
BGC0000854.3	0.44	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.47	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.47	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.46	other (other)	ectoine	Methylarcula marina
BGC0000853.3	0.46	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.45	other (ectoine)	ectoine	Streptomyces sp.
BGC0000854.3	0.44	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.83 out of 21.55

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.80 out of 29.72

Confidence: medium

Additional weak hits (1):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.99 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
NtrC	Nitrogen regulatory protein C

NZ_CP036117.1 - Region 6 - betalactone

Download region GenBank file

Download region SVG

Location: 2,481,479 - 2,506,716 nt. (total: 25,238 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

EXW43_RS13090: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acetyltransferase carboxylase transferase

EXW43_RS13095: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

EXW43_RS13115: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

EXW43_RS13160: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Lyases: hydratase

EXW43_RS13110: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

EXW43_RS13105: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

EXW43_RS13120: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002284.3	0.55	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000131.5	0.46	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000234.5	0.43	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001103.5	0.42	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000623.3	0.42	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000913.3	0.41	other (other)	MK-8	Enterobacter cloacae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002284.3	0.55	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000131.5	0.46	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000234.5	0.43	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001103.5	0.42	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000623.3	0.42	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000913.3	0.41	other (other)	MK-8	Enterobacter cloacae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.23 out of 26.06

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.54 out of 18.46

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.54 out of 18.46

Confidence: medium

Additional weak hits (5):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.89 out of 32.74

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.02 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.04 out of 29.65

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.62 out of 29.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence

NZ_CP036117.1 - Region 7 - NRPS

Download region GenBank file

Download region SVG

Location: 2,536,017 - 2,583,027 nt. (total: 47,011 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

EXW43_RS13495: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: aminotransferase

EXW43_RS13360: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase glucanase hydrolase

EXW43_RS13395: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

smcogs: SMCOG1283: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

EXW43_RS13405: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

EXW43_RS13425: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: decarboxylase

EXW43_RS13420: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: ligase

EXW43_RS13415: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 25.84 out of 29.25

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.59 out of 25.88

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.01 out of 30.25

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.81 out of 20.97

Confidence: medium

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 28.23 out of 31.73

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.79 out of 23.79

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 24.13 out of 29.25

Confidence: medium

Additional weak hits (2):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.36 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 2536016 - 2583027:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EXW43_RS13415: X - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (266..656): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FVMAFDISLLELESLLAGELNIYGPTETTICATV
Nearest Stachelhaus code(s):: Ala DILICALICK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1303..1683): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNTLHSGDVSLGGATEASIWSIY
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
ColR	Phenol-responsive regulator
HexR	Glucose-responsive regulator
IolR	Regulator of the inositol catabolism
PsrA	Oleic acid responsive regulator
SypG	Regulator of biofilm formation and host colonization

NZ_CP036117.1 - Region 8 - RiPP-like

Download region GenBank file

Download region SVG

Location: 2,607,104 - 2,617,379 nt. (total: 10,276 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

EXW43_RS13655: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	RiPP-like	Similarity score	Type	Compound(s)	Organism
BGC0001994.4		0.35	other (other)	β-ethynylserine	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002373.3		0.19	NRPS	bonnevillamide D, bonnevillamide E	Streptomyces sp.

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0001994.4		0.35	other (other)	β-ethynylserine	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002373.3		0.19	NRPS	bonnevillamide D, bonnevillamide E	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 23.81 out of 29.25

Confidence: medium

Additional weak hits (2):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 26.71 out of 30.97

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.88 out of 30.98

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
SypG	Regulator of biofilm formation and host colonization

NZ_CP036117.1 - Region 9 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 3,155,937 - 3,182,380 nt. (total: 26,444 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase protease

EXW43_RS16545: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

EXW43_RS16650: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

EXW43_RS16655: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: cyclase dehydratase

EXW43_RS16590: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

EXW43_RS16600: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000541.5	0.61	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.61	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001289.5	0.60	ribosomal	penisin	Paenibacillus ehimensis
BGC0002668.2	0.56	ribosomal	cesin A	Clostridium estertheticum
BGC0002635.2	0.56	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001618.3	0.56	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0000560.5	0.55	ribosomal	subtilomycin	Bacillus subtilis
BGC0000506.4	0.55	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000541.5	0.61	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.61	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001289.5	0.60	ribosomal	penisin	Paenibacillus ehimensis
BGC0002668.2	0.56	ribosomal	cesin A	Clostridium estertheticum
BGC0002635.2	0.56	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001618.3	0.56	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0000560.5	0.55	ribosomal	subtilomycin	Bacillus subtilis
BGC0000506.4	0.55	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for EXW43_RS16600

EXW43_RS16605

Leader:

MINEKNLFDLDVQVTTASGDVDPQ

EXW43_RS16610

Leader:

MINEKNLFDLDVQVTTASGDVDPQ

EXW43_RS16615

Leader:

MINEKNLFDLDVQVTTASGDVDPQ

EXW43_RS16620

Leader:

MINEKNLFDLDVQVTTASGDVDPQ

Shared core:

ITSISACTPGCGNTGSFNSFCC

Core with dehydrations:

IDhbDhaIDhaACysDhbPGCysGNDhbGDhaFNDhaFCysCys

antiSMASH-DB 4.0 matches for EXW43_RS16605

100.0%

NC_022873.1and 92 others:

NZ_CM000742.1 Lanthipeptides: BMYCO0001_RS26515_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18180_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18175_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18170_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18165_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19775_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19770_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19765_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18710_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18705_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18700_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21370_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21365_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21360_lanthipeptideNZ_CP035965.1 Lanthipeptides: EXW35_RS16385_lanthipeptideNZ_CP035965.1 Lanthipeptides: EXW35_RS16380_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16155_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16150_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16145_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16140_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26195_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26190_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26185_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26180_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16265_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16260_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16255_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16250_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16620_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16615_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16610_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16605_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16110_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16105_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16100_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16095_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14125_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14120_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14115_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18355_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18350_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18345_lanthipeptideNZ_CP047366.1 Lanthipeptides: GSN03_RS15835_lanthipeptideNZ_CP047366.1 Lanthipeptides: GSN03_RS15830_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16415_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16410_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16405_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15130_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15125_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15120_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15990_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15985_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15980_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15975_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25975_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25970_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25965_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25960_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15810_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15805_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15800_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15795_lanthipeptideNZ_JAIPUK010000008.1 Lanthipeptides: K9P71_RS24265_lanthipeptideNZ_JAIPUK010000008.1 Lanthipeptides: K9P71_RS24260_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06155_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06150_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06145_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06140_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21535_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21530_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21525_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11095_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11090_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11085_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11080_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11075_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18900_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18895_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18890_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18885_lanthipeptideNZ_LDHL01000037.1 Lanthipeptides: ABD98_RS26430_lanthipeptideNZ_LDHL01000037.1 Lanthipeptides: ABD98_RS26425_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27280_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27275_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27270_lanthipeptideNZ_MSTN01000016.1 Lanthipeptides: BVF97_RS28620_lanthipeptideNZ_NIUP01000011.1 Lanthipeptides: CEU84_RS08145_lanthipeptideNZ_NIUP01000011.1 Lanthipeptides: CEU84_RS08140_lanthipeptideNZ_NKAX01000026.1 Lanthipeptides: CE086_RS26165_lanthipeptideNZ_NKAX01000026.1 Lanthipeptides: CE086_RS26160_lanthipeptideNZ_NVGU01000011.1 Lanthipeptides: COL71_RS14760_lanthipeptideNZ_NVGU01000011.1 Lanthipeptides: COL71_RS14755_lanthipeptide

Lanthipeptides: YBT1518_RS19670_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITSISACTPGCGNTGSFNSFCC

1

ITSISACTPGCGNTGSFNSFCC

22

95.5%

NC_022873.1:

Lanthipeptides: YBT1518_RS19675_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

IT ISACTPGCGNTGSFNSFCC

1

ITRISACTPGCGNTGSFNSFCC

22

82.6%

NZ_CP047792.1and 1 other:

NZ_JAGSAY010000004.1 Lanthipeptides: KC186_RS06745_lanthipeptide

Lanthipeptides: E3S88_RS07345_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGC NTGSFNSFCC

2

ITSHSLCTPGCANTGSFNSFCC

23

with 111 more sequence matches

Only the first 10 are displayed here.

81.8%

NC_006582.1and 6 others:

NZ_BOQQ01000001.1 Lanthipeptides: KI354_RS00530_lanthipeptideNZ_BOQS01000001.1 Lanthipeptides: KI364_RS00675_lanthipeptideNZ_CP019985.1 Lanthipeptides: BC8716_RS09795_lanthipeptideNZ_CP104963.1 Lanthipeptides: N7M99_RS07725_lanthipeptideNZ_FRBS01000002.1 Lanthipeptides: BUC05_RS08990_lanthipeptideNZ_JAODPB010000001.1 Lanthipeptides: N6H06_RS03040_lanthipeptide

Lanthipeptides: ABC_RS22115_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

TS+S CTPGCG TGSFNSFCC

1

FTSVSFCTPGCGETGSFNSFCC

22

81.8%

NC_014023.1and 36 others:

NC_014023.1 Lanthipeptides: BMQ_RS27575_lanthipeptideNZ_CP018875.1 Lanthipeptides: BUW91_RS26425_lanthipeptideNZ_CP018875.1 Lanthipeptides: BUW91_RS26420_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28075_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28070_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28065_lanthipeptideNZ_CP031776.1 Lanthipeptides: D0441_RS30140_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01185_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01180_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01175_lanthipeptideNZ_CP048884.1 Lanthipeptides: BMG_RS27510_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26980_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26975_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26970_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26985_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26980_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26975_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27820_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27815_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27810_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25635_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25630_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25625_lanthipeptideNZ_JAHHYI010000015.1 Lanthipeptides: KM925_RS26245_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28075_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28070_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28065_lanthipeptideNZ_NKAQ01000005.1 Lanthipeptides: CE057_RS19640_lanthipeptideNZ_NKAQ01000005.1 Lanthipeptides: CE057_RS19635_lanthipeptideNZ_NTZG01000054.1 Lanthipeptides: CN510_RS18265_lanthipeptideNZ_NUIN01000020.1 Lanthipeptides: CN973_RS26930_lanthipeptideNZ_NUOI01000090.1 Lanthipeptides: COE08_RS30285_lanthipeptideNZ_NUOI01000090.1 Lanthipeptides: COE08_RS30280_lanthipeptideNZ_NUOQ01000009.1 Lanthipeptides: COE31_RS05925_lanthipeptideNZ_NUXL01000007.1 Lanthipeptides: COJ36_RS20885_lanthipeptideNZ_NUZS01000089.1 Lanthipeptides: COJ90_RS28785_lanthipeptide

Lanthipeptides: BMQ_RS27580_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS+S CTPGCG+TGS+NSFCC

1

ITSVSLCTPGCGDTGSWNSFCC

22

81.8%

NZ_FNNQ01000006.1and 2 others:

NZ_FNNQ01000006.1 Lanthipeptides: BLV90_RS07685_lanthipeptideNZ_FNNQ01000006.1 Lanthipeptides: BLV90_RS07680_lanthipeptide

Lanthipeptides: BLV90_RS07690_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS+S CTPGCG TGSFNS+CC

1

ITSVSLCTPGCGETGSFNSYCC

22

81.8%

NZ_FPAA01000016.1and 3 others:

NZ_FPAA01000016.1 Lanthipeptides: CHX35_RS15995_lanthipeptideNZ_FPAA01000016.1 Lanthipeptides: CHX35_RS15990_lanthipeptideNZ_FPAA01000016.1 Lanthipeptides: CHX35_RS15985_lanthipeptide

Lanthipeptides: CHX35_RS16000_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS+S CTPGCG+TGSFNS+CC

1

ITSVSLCTPGCGDTGSFNSYCC

22

81.8%

NZ_LELK01000004.1:

Lanthipeptides: AB986_RS12540_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGCG TGSFNS+CC

1

ITSYSFCTPGCGETGSFNSYCC

22

78.3%

NC_003923.1and 9 others:

NC_009641.1 Lanthipeptides: NWMN_RS09635_lanthipeptideNZ_CP023076.1 Lanthipeptides: CJ017_RS08945_lanthipeptideNZ_CP054876.1 Lanthipeptides: HUW54_RS09150_lanthipeptideNZ_CP077098.1 Lanthipeptides: KSF82_RS09475_lanthipeptideNZ_CP092781.1 Lanthipeptides: ML436_RS08940_lanthipeptideNZ_CP102959.1 Lanthipeptides: NW979_RS08780_lanthipeptideNZ_CP102962.1 Lanthipeptides: NW971_RS09555_lanthipeptideNZ_LR133917.1 Lanthipeptides: ELZ45_RS09155_lanthipeptideNZ_LS483317.1 Lanthipeptides: DQL75_RS09700_lanthipeptide

Lanthipeptides: MW_RS09420_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGC TGSFNSFCC

2

ITSHSLCTPGCAKTGSFNSFCC

23

78.3%

NZ_LR134304.1:

Lanthipeptides: EL116_RS09245_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS+ CTPGCG TGSFNSFCC

2

ITSVIGCTPGCGKTGSFNSFCC

23

77.3%

NZ_AP019791.1:

Lanthipeptides: RxyAA322_RS06460_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGC TGSFNS+CC

1

ITSYSLCTPGCAKTGSFNSYCC

22

72.7%

NZ_QGTF01000010.1:

Lanthipeptides: BDW27_RS18560_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

+TS+S CTPGC N G+FNSFCC

1

VTSVSVCTPGCEN-GTFNSFCC

21

70.8%

NZ_VKCY01000012.1:

Lanthipeptides: FNK43_RS09020_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGC TGSFNS+CC

3

ITSFSLCTPGCAKTGSFNSYCC

24

MIBiG 4.0 matches for EXW43_RS16605

35.3%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

1

ITSISACTPGCGNTGSF

17

ITSIS CTPGC TG+

1

ITSISLCTPGC-KTGAL

16

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.16 out of 30.25

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.81 out of 25.88

Confidence: medium

Additional weak hits (1):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.59 out of 32.74

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

EXW43_RS16605 - Class I

Cleavage pHMM score: 9.90

RODEO score: 33

Monoisotopic mass: 1996.9 Da

Molecular weight: 1998.3 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2016.3 Da N = 1; 2034.3 Da N = 2; 2052.3 Da N = 3

EXW43_RS16610 - Class I

Cleavage pHMM score: 9.90

RODEO score: 33

Monoisotopic mass: 1996.9 Da

Molecular weight: 1998.3 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2016.3 Da N = 1; 2034.3 Da N = 2; 2052.3 Da N = 3

EXW43_RS16615 - Class I

Cleavage pHMM score: 9.90

RODEO score: 33

Monoisotopic mass: 1996.9 Da

Molecular weight: 1998.3 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2016.3 Da N = 1; 2034.3 Da N = 2; 2052.3 Da N = 3

EXW43_RS16620 - Class I

Cleavage pHMM score: 9.90

RODEO score: 33

Monoisotopic mass: 1996.9 Da

Molecular weight: 1998.3 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2016.3 Da N = 1; 2034.3 Da N = 2; 2052.3 Da N = 3

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 162 - 259; Score: 89.9

TFBS definitions

Regulator	Description
ColR	Phenol-responsive regulator
PsrA	Oleic acid responsive regulator

NZ_CP036117.1 - Region 10 - terpene

Download region GenBank file

Download region SVG

Location: 3,420,281 - 3,442,134 nt. (total: 21,854 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

EXW43_RS17905: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

EXW43_RS17910: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: lyase

EXW43_RS17880: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Translocases: permease

EXW43_RS17940: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002493.3	0.40	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000812.3	0.40	other (other)	huperzine A	Shiraia sp. slf14
BGC0000234.5	0.39	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0002161.2	0.39	PKS	scytalone, T3HN	Pestalotiopsis fici W106-1
BGC0001882.3	0.38	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002493.3	0.40	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000812.3	0.40	other (other)	huperzine A	Shiraia sp. slf14
BGC0000234.5	0.39	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0002161.2	0.39	PKS	scytalone, T3HN	Pestalotiopsis fici W106-1
BGC0001882.3	0.38	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

EXW43_RS17920: T2TS

Domain 1 (4 - 614): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.97 out of 25.31

Confidence: strong

Additional weak hits (3):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.31 out of 23.43

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.93 out of 27.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.18 out of 29.25

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_CP036117.1 - Region 11 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 4,027,545 - 4,048,438 nt. (total: 20,894 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase

EXW43_RS21030: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

EXW43_RS20995: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

EXW43_RS21000: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000638.3	0.37	terpene	carotenoid	Pantoea ananatis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000638.3	0.37	terpene	carotenoid	Pantoea ananatis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

EXW43_RS21000: PT_FPPS_like

Domain 1 (33 - 296): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.49 out of 27.78

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.53 out of 25.88

Confidence: medium

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 25.44 out of 28.14

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

Additional weak hits (1):

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 25.40 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
PerR	Peroxide regulator
PsrA	Oleic acid responsive regulator

NZ_CP036117.1 - Region 12 - lassopeptide

Download region GenBank file

Download region SVG

Location: 5,026,675 - 5,050,591 nt. (total: 23,917 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase aminotransferase glycosyltransferase transferase

EXW43_RS26340: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

EXW43_RS26400: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

EXW43_RS26410: sugar transferase

smcogs: SMCOG1146: sugar transferase

EXW43_RS26430: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Hydrolases: hydrolase

EXW43_RS26395: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001356.4	0.68	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0000749.3	0.55	saccharide	capsular polysaccharide	Escherichia coli
BGC0002312.2	0.53	ribosomal	ubonodin	Burkholderia ubonensis
BGC0001634.3	0.52	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000741.3	0.51	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.51	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.51	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000764.3	0.50	saccharide	exopolysaccharide	Lactococcus lactis
BGC0000740.3	0.49	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000746.3	0.49	saccharide	capsular polysaccharide	Streptococcus agalactiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001356.4	0.68	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0000749.3	0.55	saccharide	capsular polysaccharide	Escherichia coli
BGC0002312.2	0.53	ribosomal	ubonodin	Burkholderia ubonensis
BGC0001634.3	0.52	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000741.3	0.51	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.51	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.51	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000764.3	0.50	saccharide	exopolysaccharide	Lactococcus lactis
BGC0000740.3	0.49	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000746.3	0.49	saccharide	capsular polysaccharide	Streptococcus agalactiae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.03 out of 20.97

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 22.91 out of 25.88

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.51 out of 30.25

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.33 out of 27.78

Confidence: medium

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 28.12 out of 33.14

Confidence: medium

Additional weak hits (2):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.13 out of 25.88

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.27 out of 31.73

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 12 - 95; Score: 84.8

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
PsrA	Oleic acid responsive regulator
ZuR variant 2	Zinc-responsive repressor

NZ_CP036118.1 - Region 1 - deazapurine

Download region GenBank file

Download region SVG

Location: 117,989 - 140,485 nt. (total: 22,497 nt) Show pHMM detection rules used

deazapurine: (GTP_cyclohydroI and PTPS and QueE and QueC and not (dpdA1 or bTGT))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

EXW43_RS28225: methyltransferase

smcogs: SMCOG1248: methyltransferase

Translocases: permease

EXW43_RS28300: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001217.5	0.52	other (other)	PreQ0 Base	Streptomyces qinglanensis
BGC0000802.5	0.51	saccharide	succinoglycan	Sinorhizobium meliloti
BGC0002508.2	0.50	other (other)	8-azaguanine	Streptomyces pathocidini
BGC0001937.4	0.48	other (other)	tubercidin	Streptomyces tubercidicus
BGC0000881.3	0.46	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001808.5	0.46	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0002354.4	0.45	other (other)	huimycin	Kutzneria albida DSM 43870
BGC0000879.5	0.44	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0000598.5	0.42	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0002700.2	0.41	ribosomal	bacinapeptin	Bacillus nakamurai

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001217.5	0.52	other (other)	PreQ0 Base	Streptomyces qinglanensis
BGC0000802.5	0.51	saccharide	succinoglycan	Sinorhizobium meliloti
BGC0002508.2	0.50	other (other)	8-azaguanine	Streptomyces pathocidini
BGC0001937.4	0.48	other (other)	tubercidin	Streptomyces tubercidicus
BGC0000881.3	0.46	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001808.5	0.46	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0002354.4	0.45	other (other)	huimycin	Kutzneria albida DSM 43870
BGC0000879.5	0.44	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0000598.5	0.42	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0002700.2	0.41	ribosomal	bacinapeptin	Bacillus nakamurai

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.21 out of 26.06

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.67 out of 27.78

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.98 out of 27.78

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.93 out of 29.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.77 out of 26.06

Confidence: medium

Additional weak hits (2):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.71 out of 23.43

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 20.52 out of 29.51

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes
SypG	Regulator of biofilm formation and host colonization

NZ_CP036119.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 93,612 - 159,547 nt. (total: 65,936 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase methyltransferase

EXW43_RS29320: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

EXW43_RS29365: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase hydrolase

EXW43_RS29335: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

EXW43_RS29370: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

EXW43_RS29350: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

EXW43_RS29355: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

EXW43_RS29360: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.27 out of 26.06

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.97 out of 27.78

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.05 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.55 out of 19.26

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.71 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.53 out of 28.19

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.39 out of 32.93

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.52 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.71 out of 26.06

Confidence: medium

Additional weak hits (9):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 26.91 out of 30.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.52 out of 36.53

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.06 out of 32.74

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.62 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.75 out of 36.54

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 24.30 out of 35.63

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.52 out of 27.18

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.16 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 93611 - 159547:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Thr) + (X - Ala) + (Ser - Leu - D-Thr - Glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EXW43_RS29350: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (457..866): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

EXW43_RS29355: X - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (466..870): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWMTFDVSVWEWQFFSGGETNFYGPTEATIYVNA
Nearest Stachelhaus code(s):: Glu DVWHFGRINK (71% 8Å match); Gln DAWQFGLIDK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1527..1919): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: MWATFDLSVFEVNTNLAGEYNLYGPSEDTTYSTY
Nearest Stachelhaus code(s):: Ala DLFNNALTYK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

EXW43_RS29360: Ser - Leu - Thr - Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (496..901): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFTSGEINLYGPTEATVDVTY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1559..1946): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: MWHAFDSAVQEPFAITGGDINQYGPSENTVVTTD
Nearest Stachelhaus code(s):: Pro DVQFIAQVVK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2602..3008): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4124..4524): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDSSVKQMDILVGGEYNVYGPTECTVDATC
Nearest Stachelhaus code(s):: Glu DAKDLGVVDK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor