GCF_018729515.1 - 15 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JAHHZH010000011.1 (Pseudomonas sp. MG-9)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	hserlactone	145,160	165,771

NZ_JAHHZH010000001.1 (Pseudomonas sp. MG-9)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	NI-siderophore	591,625	621,475
Region 10.2	RiPP-like	1,014,122	1,026,326

NZ_JAHHZH010000002.1 (Pseudomonas sp. MG-9)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	RiPP-like	166,636	177,481
Region 14.2	redox-cofactor	710,293	732,449

NZ_JAHHZH010000003.1 (Pseudomonas sp. MG-9)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	hydrogen-cyanide	179,732	192,704	High	hydrogen cyanide	other:other
Region 15.2	betalactone	318,920	342,142
Region 15.3	NRP-metallophore,NRPS	475,724	556,580	Low	Pf-5 pyoverdine	NRPS:Type I

NZ_JAHHZH010000004.1 (Pseudomonas sp. MG-9)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	NRPS-like	1	31,957
Region 16.2	arylpolyene	312,917	356,521	Low	APE Vf	other:other

NZ_JAHHZH010000005.1 (Pseudomonas sp. MG-9)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	RiPP-like	154,684	165,571

NZ_JAHHZH010000007.1 (Pseudomonas sp. MG-9)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	NRPS	12,313	65,311	Low	Pf-5 pyoverdine	NRPS:Type I
Region 19.2	NAGGN	197,321	212,195

NZ_JAHHZH010000008.1 (Pseudomonas sp. MG-9)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	lanthipeptide-class-ii	99,636	122,776
Region 20.2	terpene-precursor	244,968	265,855

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	hserlactone	145,160	165,771
Region 10.1	NI-siderophore	591,625	621,475
Region 10.2	RiPP-like	1,014,122	1,026,326
Region 14.1	RiPP-like	166,636	177,481
Region 14.2	redox-cofactor	710,293	732,449
Region 15.1	hydrogen-cyanide	179,732	192,704	High	hydrogen cyanide	other:other
Region 15.2	betalactone	318,920	342,142
Region 15.3	NRP-metallophore,NRPS	475,724	556,580	Low	Pf-5 pyoverdine	NRPS:Type I
Region 16.1	NRPS-like	1	31,957
Region 16.2	arylpolyene	312,917	356,521	Low	APE Vf	other:other
Region 17.1	RiPP-like	154,684	165,571
Region 19.1	NRPS	12,313	65,311	Low	Pf-5 pyoverdine	NRPS:Type I
Region 19.2	NAGGN	197,321	212,195
Region 20.1	lanthipeptide-class-ii	99,636	122,776
Region 20.2	terpene-precursor	244,968	265,855

No secondary metabolite regions were found in these records:: NZ_JAHHZH010000010.1 (Pseudomonas sp. MG-9); NZ_JAHHZH010000012.1 (Pseudomonas sp. MG-9); NZ_JAHHZH010000013.1 (Pseudomonas sp. MG-9); NZ_JAHHZH010000014.1 (Pseudomonas sp. MG-9); NZ_JAHHZH010000015.1 (Pseudomonas sp. MG-9); NZ_JAHHZH010000016.1 (Pseudomonas sp. MG-9); NZ_JAHHZH010000017.1 (Pseudomonas sp. MG-9); NZ_JAHHZH010000018.1 (Pseudomonas sp. MG-9); NZ_JAHHZH010000019.1 (Pseudomonas sp. MG-9); NZ_JAHHZH010000020.1 (Pseudomonas sp. MG-9); NZ_JAHHZH010000021.1 (Pseudomonas sp. MG-9); NZ_JAHHZH010000006.1 (Pseudomonas sp. MG-9); NZ_JAHHZH010000009.1 (Pseudomonas sp. MG-9)

Compact view

NZ_JAHHZH010000011.1 - Region 1 - hserlactone

Download region GenBank file

Download region SVG

Location: 145,160 - 165,771 nt. (total: 20,612 nt) Show pHMM detection rules used

hserlactone: Autoind_synth

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: sulfotransferase

KKQ10_RS25545: glutathione S-transferase

smcogs: SMCOG1193: glutathione S-transferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000863.3	0.32	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0001897.4	0.32	PKS	cepacin A	Burkholderia ambifaria IOP40-10
BGC0001245.3	0.28	PKS	lasiodiplodin	Lasiodiplodia theobromae
BGC0000076.3	0.26	PKS	hypothemycin	Hypomyces subiculosus
BGC0000077.3	0.25	PKS	hypothemycin	Hypomyces subiculosus
BGC0001437.5	0.24	NRPS	obafluorin	Pseudomonas fluorescens
BGC0000466.5	0.22	NRPS	yatakemycin	Streptomyces sp. TP-A2060
BGC0002656.2	0.22	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0000961.5	0.22	NRPS, PKS	bactobolin	Burkholderia thailandensis E264
BGC0000350.5	0.19	NRPS	ET-743	uncultured organism

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000863.3	0.32	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0001897.4	0.32	PKS	cepacin A	Burkholderia ambifaria IOP40-10
BGC0001245.3	0.28	PKS	lasiodiplodin	Lasiodiplodia theobromae
BGC0000076.3	0.26	PKS	hypothemycin	Hypomyces subiculosus
BGC0000077.3	0.25	PKS	hypothemycin	Hypomyces subiculosus
BGC0001437.5	0.24	NRPS	obafluorin	Pseudomonas fluorescens
BGC0000466.5	0.22	NRPS	yatakemycin	Streptomyces sp. TP-A2060
BGC0002656.2	0.22	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0000961.5	0.22	NRPS, PKS	bactobolin	Burkholderia thailandensis E264
BGC0000350.5	0.19	NRPS	ET-743	uncultured organism

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.02 out of 21.84

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.16 out of 20.97

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.10 out of 21.84

Confidence: medium

Additional weak hits (5):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.33 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.57 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.55 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.26 out of 30.22

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.70 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAHHZH010000001.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 591,625 - 621,475 nt. (total: 29,851 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KKQ10_RS02860: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase

KKQ10_RS02795: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: peptidase

KKQ10_RS02760: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Lyases: decarboxylase

KKQ10_RS02820: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

KKQ10_RS02815: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000947.5	0.50	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001587.5	0.48	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.48	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002681.3	0.47	other (other)	rhizoferrin	Francisella tularensis subsp. tularensis SCHU S4
BGC0002490.2	0.45	other (other)	yersinopine	Yersinia pestis CO92
BGC0000939.5	0.43	other (other)	aerobactin	Grimontia hollisae
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002567.2	0.43	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0000943.5	0.42	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002692.2	0.42	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000947.5	0.50	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001587.5	0.48	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.48	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002681.3	0.47	other (other)	rhizoferrin	Francisella tularensis subsp. tularensis SCHU S4
BGC0002490.2	0.45	other (other)	yersinopine	Yersinia pestis CO92
BGC0000939.5	0.43	other (other)	aerobactin	Grimontia hollisae
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002567.2	0.43	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0000943.5	0.42	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002692.2	0.42	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 26.51 out of 32.74

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.05 out of 20.97

Confidence: medium

Additional weak hits (7):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.46 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.63 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.58 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.56 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.93 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
FuR variant 2	Ferric Uptake Regulator

NZ_JAHHZH010000001.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1,014,122 - 1,026,326 nt. (total: 12,205 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000846.5	0.31	other (other)	tabtoxin	Pseudomonas syringae
BGC0001221.5	0.31	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001285.5	0.28	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001093.3	0.26	NRPS, PKS	disorazol A	Sorangium cellulosum
BGC0000873.3	0.26	other (other)	A-201A	Saccharothrix mutabilis subsp. capreolus
BGC0000253.4	0.24	PKS	oviedomycin	Streptomyces antibioticus
BGC0001055.5	0.24	NRPS, PKS	yersiniabactin	Escherichia coli
BGC0001584.5	0.22	PKS	C-1027	Streptomyces sp. CB02366
BGC0001397.5	0.21	NRPS, PKS	lidamycin	Streptomyces globisporus C-1027
BGC0000965.5	0.21	PKS	C-1027	Streptomyces globisporus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000846.5	0.31	other (other)	tabtoxin	Pseudomonas syringae
BGC0001221.5	0.31	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001285.5	0.28	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001093.3	0.26	NRPS, PKS	disorazol A	Sorangium cellulosum
BGC0000873.3	0.26	other (other)	A-201A	Saccharothrix mutabilis subsp. capreolus
BGC0000253.4	0.24	PKS	oviedomycin	Streptomyces antibioticus
BGC0001055.5	0.24	NRPS, PKS	yersiniabactin	Escherichia coli
BGC0001584.5	0.22	PKS	C-1027	Streptomyces sp. CB02366
BGC0001397.5	0.21	NRPS, PKS	lidamycin	Streptomyces globisporus C-1027
BGC0000965.5	0.21	PKS	C-1027	Streptomyces globisporus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.31 out of 18.57

Confidence: medium

Additional weak hits (3):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.99 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.08 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_JAHHZH010000002.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 166,636 - 177,481 nt. (total: 10,846 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

KKQ10_RS05465: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001483.4	0.25	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000969.5	0.22	NRPS, PKS	chondramide A	Chondromyces crocatus
BGC0000058.5	0.21	PKS	FD-891	Streptomyces graminofaciens
BGC0001212.4	0.21	NRPS, PKS	nannocystin a	Nannocystis sp. MB1016
BGC0000283.4	0.20	other (cyclitol)	cetoniacytone A	Actinomyces sp. Lu 9419
BGC0001110.5	0.19	NRPS, PKS	psymberin, irciniastatin B	uncultured bacterium psy1
BGC0000207.5	0.18	PKS	chartreusin	Streptomyces chartreusis
BGC0001205.3	0.18	PKS	communesin A, communesin B, communesin C, communesin D, communesin E, communesin G, communesin H	Penicillium expansum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001483.4	0.25	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000969.5	0.22	NRPS, PKS	chondramide A	Chondromyces crocatus
BGC0000058.5	0.21	PKS	FD-891	Streptomyces graminofaciens
BGC0001212.4	0.21	NRPS, PKS	nannocystin a	Nannocystis sp. MB1016
BGC0000283.4	0.20	other (cyclitol)	cetoniacytone A	Actinomyces sp. Lu 9419
BGC0001110.5	0.19	NRPS, PKS	psymberin, irciniastatin B	uncultured bacterium psy1
BGC0000207.5	0.18	PKS	chartreusin	Streptomyces chartreusis
BGC0001205.3	0.18	PKS	communesin A, communesin B, communesin C, communesin D, communesin E, communesin G, communesin H	Penicillium expansum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.98 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.87 out of 28.19

Confidence: medium

Additional weak hits (2):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.42 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.55 out of 30.22

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
ZuR variant 1	Zinc-responsive repressor

NZ_JAHHZH010000002.1 - Region 2 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 710,293 - 732,449 nt. (total: 22,157 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KKQ10_RS07920: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase

KKQ10_RS07930: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: cyclase hydratase

KKQ10_RS07915: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

KKQ10_RS07975: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000919.5	0.45	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0000906.3	0.43	other (other)	heme D1	Heliophilum fasciatum
BGC0000258.3	0.42	PKS	prodigiosin	Serratia sp.
BGC0000259.3	0.41	PKS	prodigiosin	Serratia marcescens
BGC0000707.5	0.41	saccharide	kasugamycin	Streptomyces kasugaensis
BGC0000260.3	0.41	PKS	prodigiosin	Hahella chejuensis KCTC 2396
BGC0002675.2	0.40	PKS	prodigiosin	Pseudoalteromonas rubra
BGC0000895.5	0.40	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002683.2	0.38	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0001440.5	0.38	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000919.5	0.45	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0000906.3	0.43	other (other)	heme D1	Heliophilum fasciatum
BGC0000258.3	0.42	PKS	prodigiosin	Serratia sp.
BGC0000259.3	0.41	PKS	prodigiosin	Serratia marcescens
BGC0000707.5	0.41	saccharide	kasugamycin	Streptomyces kasugaensis
BGC0000260.3	0.41	PKS	prodigiosin	Hahella chejuensis KCTC 2396
BGC0002675.2	0.40	PKS	prodigiosin	Pseudoalteromonas rubra
BGC0000895.5	0.40	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002683.2	0.38	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0001440.5	0.38	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.83 out of 28.19

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.75 out of 27.18

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

Additional weak hits (9):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.00 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.79 out of 23.43

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.93 out of 26.06

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.57 out of 36.53

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.44 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.03 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.41 out of 33.73

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 1 - 90; Score: 115.2

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
MexT	Global virulence regulator
NrdR	Represses ribonucleotide reductase encoding genes
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_JAHHZH010000003.1 - Region 1 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 179,732 - 192,704 nt. (total: 12,973 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

KKQ10_RS09105: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.90	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002575.2	0.39	ribosomal	cochonodin I	Streptococcus suis
BGC0001789.3	0.33	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000537.3	0.33	ribosomal	nisin U	Streptococcus uberis
BGC0000188.5	0.33	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000652.5	0.30	terpene	napyradiomycin	Streptomyces sp. CNQ525
BGC0002443.3	0.30	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus
BGC0000260.3	0.30	PKS	prodigiosin	Hahella chejuensis KCTC 2396
BGC0001079.5	0.30	PKS, terpene	napyradiomycin A80915C, napyradiomycin 2, napyradiomycin 3, napyradiomycin 4	Streptomyces aculeolatus
BGC0001429.4	0.30	NRPS, PKS	myxochromide S1	Stigmatella aurantiaca DW4/3-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.90	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002575.2	0.39	ribosomal	cochonodin I	Streptococcus suis
BGC0001789.3	0.33	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000537.3	0.33	ribosomal	nisin U	Streptococcus uberis
BGC0000188.5	0.33	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000652.5	0.30	terpene	napyradiomycin	Streptomyces sp. CNQ525
BGC0002443.3	0.30	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus
BGC0000260.3	0.30	PKS	prodigiosin	Hahella chejuensis KCTC 2396
BGC0001079.5	0.30	PKS, terpene	napyradiomycin A80915C, napyradiomycin 2, napyradiomycin 3, napyradiomycin 4	Streptomyces aculeolatus
BGC0001429.4	0.30	NRPS, PKS	myxochromide S1	Stigmatella aurantiaca DW4/3-1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 25.04 out of 26.12

Confidence: strong

Additional weak hits (5):

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.83 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.44 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.50 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.50 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.52 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
LuxO	Repressor of luminescence

NZ_JAHHZH010000003.1 - Region 2 - betalactone

Download region GenBank file

Download region SVG

Location: 318,920 - 342,142 nt. (total: 23,223 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KKQ10_RS09745: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

KKQ10_RS09770: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: carboxylase transferase

KKQ10_RS09775: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

KKQ10_RS09785: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Lyases: hydratase

KKQ10_RS09780: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

KKQ10_RS09760: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

KKQ10_RS09765: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002193.2	0.56	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0002284.3	0.54	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.52	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000131.5	0.45	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000234.5	0.43	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000343.5	0.42	NRPS	enterobactin	Pseudomonas sp. J465
BGC0000312.4	0.41	NRPS	bassianolide	Beauveria bassiana
BGC0000595.3	0.40	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002711.2	0.39	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002193.2	0.56	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0002284.3	0.54	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.52	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000131.5	0.45	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000234.5	0.43	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000343.5	0.42	NRPS	enterobactin	Pseudomonas sp. J465
BGC0000312.4	0.41	NRPS	bassianolide	Beauveria bassiana
BGC0000595.3	0.40	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002711.2	0.39	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.49 out of 26.85

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.61 out of 29.38

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.22 out of 27.04

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.12 out of 23.79

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.00 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.95 out of 28.19

Confidence: medium

Additional weak hits (18):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.50 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.78 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.94 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.59 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.41 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.68 out of 20.01

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.52 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.06 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.32 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.24 out of 28.14

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.12 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.89 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.71 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.76 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.94 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.93 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.52 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.60 out of 30.98

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
FuR variant 1	Ferric Uptake Regulator
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
ZuR variant 1	Zinc-responsive repressor

NZ_JAHHZH010000003.1 - Region 3 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 475,724 - 556,580 nt. (total: 80,857 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

KKQ10_RS10420: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

KKQ10_RS10460: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

KKQ10_RS10540: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase

KKQ10_RS10495: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: esterase hydrolase

KKQ10_RS10515: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

KKQ10_RS10530: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

KKQ10_RS10520: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KKQ10_RS10525: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.87	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.86	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.83	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.83	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.83	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.82	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.80	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001133.4	0.79	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.77	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.76	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001133.4	0.72	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 23.03 out of 26.33

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.07 out of 24.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (45):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.12 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.92 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.72 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.26 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.83 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.15 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.82 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.27 out of 26.85

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.12 out of 27.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.40 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.31 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.86 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.82 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.07 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.43 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.18 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.31 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.62 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.15 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.51 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.46 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.05 out of 21.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.07 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.77 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.28 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.69 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.28 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.24 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.17 out of 18.57

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.10 out of 39.62

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.99 out of 26.33

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.03 out of 25.88

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.93 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.35 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.54 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.78 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.88 out of 36.54

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.79 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.45 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.50 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.04 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 475723 - 556580:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ala - Lys - Thr) + (D-Ser - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KKQ10_RS10520: Ser - X - X

Search NORINE for peptide: strict or relaxed

AMP-binding (515..914): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEYNLYGPTEAAIDVTH
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2026..2425): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAIAFDGAHERTCFTPCAEINGYGPTETVITPLI
Nearest Stachelhaus code(s):: OH-Orn DGEVVGGVTK (76% 8Å match); Cys DHESDVGITK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (3075..3474): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: lys (Lys)

Stachelhaus prediction details:

Stachelhaus sequence:: HGIMFDGAQERSCFCFGGDVNGYGPTETVVTPLL
Nearest Stachelhaus code(s):: OH-Orn DGEACGGVTK (79% 8Å match); Fo-OH-Orn DGEVCGGVTK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

KKQ10_RS10525: Ala - Lys - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (518..907): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWSTFDLSVWEVNTNLAGEFDLYGPSEDTTYSTW
Nearest Stachelhaus code(s):: Ala DLWNNALTYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2012..2413): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FSAAFDGFVEQPDLHVGGELNTYGPTEATVVSSV
Nearest Stachelhaus code(s):: Lys DGEDHGTVVK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3062..3465): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQIFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
LexA variant 2	Repressor of DNA damage response
ToxT	Regulator of MSHA biosynthesis

NZ_JAHHZH010000004.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 31,957 nt. (total: 31,957 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

KKQ10_RS11055: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase

KKQ10_RS11030: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001249.5	0.59	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001249.5	0.59	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.85 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.83 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.89 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.89 out of 18.16

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.03 out of 26.85

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.14 out of 27.04

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.59 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.78 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (19):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.93 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.24 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.85 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 22.01 out of 26.12

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 19.71 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.38 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.38 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.38 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 31957:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KKQ10_RS11030: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (183..566): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: FWYSFDSSLIDPFLMTGGDHNLYGPTEATVLITA
Nearest Stachelhaus code(s):: Val DALFVGIVLK (79% 8Å match); Leu or Ile DAIYLGVVLK (56% 8Å match); Arg DALFFGLVDK (53% 8Å match); Ala DVFFVGLVAK (44% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
DasR	N-acetylglucosamine dependent repressor
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JAHHZH010000004.1 - Region 2 - arylpolyene

Download region GenBank file

Download region SVG

Location: 312,917 - 356,521 nt. (total: 43,605 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase reductase

KKQ10_RS12390: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

KKQ10_RS12425: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acyltransferase halogenase methyltransferase

KKQ10_RS12445: methyltransferase

smcogs: SMCOG1089: methyltransferase

KKQ10_RS12450: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

KKQ10_RS12510: acyltransferase

smcogs: SMCOG1141: acyltransferase

Ligases: ligase synthase

KKQ10_RS12375: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

KKQ10_RS12420: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

KKQ10_RS12435: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

KKQ10_RS12485: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

KKQ10_RS12490: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0000836.5	0.60	other (other)	APE Ec	Escherichia coli CFT073
BGC0002008.3	0.60	other (other)	aryl polyenes	Xenorhabdus doucetiae
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000837.4	0.49	other (other)	APE Vf	Aliivibrio fischeri ES114
BGC0001197.5	0.48	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001940.3	0.48	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0002711.2	0.48	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0001987.2	0.48	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0000836.5	0.60	other (other)	APE Ec	Escherichia coli CFT073
BGC0002008.3	0.60	other (other)	aryl polyenes	Xenorhabdus doucetiae
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000837.4	0.49	other (other)	APE Vf	Aliivibrio fischeri ES114
BGC0001197.5	0.48	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001940.3	0.48	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0002711.2	0.48	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0001987.2	0.48	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 25.19 out of 30.25

Confidence: medium

Additional weak hits (4):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.21 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.26 out of 18.57

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.70 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.72 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

KKQ10_RS12490: X

AMP-binding (23..338): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: EALAIYGLLFRWVSFSSGG----WPTEILGSSET
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
ColR	Phenol-responsive regulator

NZ_JAHHZH010000005.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 154,684 - 165,571 nt. (total: 10,888 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000486.4	0.41	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0001743.3	0.39	ribosomal	plantaricyclin	Lactobacillus plantarum
BGC0001222.3	0.39	ribosomal	acidocin B	Lactobacillus acidophilus
BGC0001887.3	0.38	ribosomal	huazacin	Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
BGC0000496.5	0.37	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001210.5	0.36	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001579.4	0.34	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001364.3	0.34	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001391.3	0.33	ribosomal	thusin	Bacillus thuringiensis serovar rongseni

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000486.4	0.41	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0001743.3	0.39	ribosomal	plantaricyclin	Lactobacillus plantarum
BGC0001222.3	0.39	ribosomal	acidocin B	Lactobacillus acidophilus
BGC0001887.3	0.38	ribosomal	huazacin	Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
BGC0000496.5	0.37	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001210.5	0.36	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001579.4	0.34	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001364.3	0.34	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001391.3	0.33	ribosomal	thusin	Bacillus thuringiensis serovar rongseni

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.86 out of 21.84

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.65 out of 27.78

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.77 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.72 out of 28.19

Confidence: medium

Additional weak hits (6):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.35 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.60 out of 30.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.20 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.96 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.92 out of 28.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MexT	Global virulence regulator
ZuR variant 1	Zinc-responsive repressor

NZ_JAHHZH010000007.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 12,313 - 65,311 nt. (total: 52,999 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KKQ10_RS18805: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KKQ10_RS18815: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase carboxylase transferase

KKQ10_RS18725: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

KKQ10_RS18810: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

KKQ10_RS18825: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Hydrolases: dehalogenase

KKQ10_RS18770: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: hydratase

KKQ10_RS18820: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Isomerases: isomerase

KKQ10_RS18760: disulfide isomerase/thiol-disulfide oxidase

smcogs: SMCOG1233: disulfide isomerase/thiol-disulfide oxidase

Ligases: ligase

KKQ10_RS18775: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.95 out of 27.78

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.99 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.10 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.46 out of 28.19

Confidence: medium

Additional weak hits (21):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.55 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.26 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.93 out of 29.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.89 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 19.11 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.62 out of 28.14

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.89 out of 25.88

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.89 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.82 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.94 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.20 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.49 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.56 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.99 out of 30.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.69 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.69 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.89 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.57 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.19 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 12312 - 65311:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2 - Glu - D-Tyr - Dab)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KKQ10_RS18775: NH2 - Glu - Tyr - Dab

Search NORINE for peptide: strict or relaxed

CAL_domain (41..477): NH2

minowa: NH2

Prediction, score:

NH2: 153.2
Acetyl-CoA: 42.0
fatty_acid: 11.6
AHBA: 9.7
shikimic_acid: -2.6

AMP-binding (1131..1528): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMAFDVSVWEWHFFSGGEHNRYGPTETAINVTH
Nearest Stachelhaus code(s):: Glu DVWHFGRINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2190..2594): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAVYFDAATERVGFITGGEFNAYGPTETVVMPLA
Nearest Stachelhaus code(s):: Tyr DAEGIGAVMK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3723..4129): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NSKAFDISVWQAESLPTGEVNAYGPAECSDDVAF
Nearest Stachelhaus code(s):: Dab DIWELTADDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JAHHZH010000007.1 - Region 2 - NAGGN

Download region GenBank file

Download region SVG

Location: 197,321 - 212,195 nt. (total: 14,875 nt) Show pHMM detection rules used

NAGGN: ((TIGR03104 or cds(GATase_7 and Asn_synthase)) and TIGR03103 and (TIGR03106 or Peptidase_M42))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

KKQ10_RS19500: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

KKQ10_RS19535: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

KKQ10_RS19505: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001880.3	0.44	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000846.5	0.42	other (other)	tabtoxin	Pseudomonas syringae
BGC0000888.5	0.40	other (other)	bacilysin	Bacillus sp. CS93
BGC0000885.3	0.40	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001184.4	0.37	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001928.2	0.36	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000254.5	0.33	PKS	oxytetracycline	Streptomyces rimosus
BGC0000937.5	0.33	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001739.3	0.33	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001374.5	0.32	other (other)	thienodolin	Streptomyces albogriseolus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001880.3	0.44	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000846.5	0.42	other (other)	tabtoxin	Pseudomonas syringae
BGC0000888.5	0.40	other (other)	bacilysin	Bacillus sp. CS93
BGC0000885.3	0.40	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001184.4	0.37	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001928.2	0.36	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000254.5	0.33	PKS	oxytetracycline	Streptomyces rimosus
BGC0000937.5	0.33	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001739.3	0.33	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001374.5	0.32	other (other)	thienodolin	Streptomyces albogriseolus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.23 out of 29.72

Confidence: medium

Additional weak hits (8):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.61 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.40 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.85 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.24 out of 28.14

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.63 out of 26.12

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.82 out of 30.25

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.00 out of 30.98

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.96 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

NZ_JAHHZH010000008.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 99,636 - 122,776 nt. (total: 23,141 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

KKQ10_RS20855: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

KKQ10_RS20895: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: synthase

KKQ10_RS20905: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.4	0.47	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001077.4	0.41	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001267.3	0.35	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0000595.3	0.34	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001521.3	0.34	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002571.2	0.34	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0001573.3	0.33	other (other)	dihydrolysergic acid	Claviceps africana
BGC0000999.4	0.33	NRPS, PKS	heat-stable antifungal factor	Lysobacter enzymogenes
BGC0002362.3	0.32	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.4	0.47	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001077.4	0.41	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001267.3	0.35	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0000595.3	0.34	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001521.3	0.34	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002571.2	0.34	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0001573.3	0.33	other (other)	dihydrolysergic acid	Claviceps africana
BGC0000999.4	0.33	NRPS, PKS	heat-stable antifungal factor	Lysobacter enzymogenes
BGC0002362.3	0.32	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for KKQ10_RS20895

allorf_106724_106882

Leader:

MRGTSDSGLNYCGLTGMSSAGA

Core:

VYARVFLEYKRETQNWHDRSDQWCLIRICR

Core with dehydrations:

VYARVFLEYKREDhbQNWHDRDhaDQWCysLIRICysR

antiSMASH-DB 4.0 matches for allorf_106724_106882

100.0%

NZ_CP101655.1and 1 other:

NZ_JAHHZH010000008.1 Lanthipeptides: allorf_106724_106882_lanthipeptide

Lanthipeptides: allorf_2707159_2707317_lanthipeptide

1

VYARVFLEYKRETQNWHDRSDQWCLIRICR

30

VYARVFLEYKRETQNWHDRSDQWCLIRICR

1

VYARVFLEYKRETQNWHDRSDQWCLIRICR

30

20.0%

NZ_CP023466.1and 2 others:

NZ_JHVT01000005.1 Lanthipeptides: allorf_225959_226054_lanthipeptideNZ_KB906329.1 Lanthipeptides: allorf_148726_148821_lanthipeptide

Lanthipeptides: allorf_0913536_0913631_lanthipeptide

14

QNWHDRSDQWCLIRI

28

+W DRS Q+C + +

2

HHWSDRSCQFCCVPL

16

19.4%

NZ_BMVL01000013.1and 1 other:

NZ_BMVL01000013.1 Lanthipeptides: allorf_063434_063604_lanthipeptide

Lanthipeptides: allorf_063434_063604_lanthipeptide

1

VYARVFLEYKRETQNWHDRSDQWC

24

++AR RE H R ++ C

12

IFARSSCVVNREGGPGHARQERLC

35

allorf_106741_106917

Leader:

MGGILVGVLAA

Core:

VCGAHQIQDLIIVVLPVCPVQAQSTLGFFWNTRGKHKIGMTGLTSGV

Core with dehydrations:

VCysGAHQIQDLIIVVLPVCysPVQAQDhaDhbLGFFWNDhbRGKHKIGMDhbGLDhbDhaGV

antiSMASH-DB 4.0 matches for allorf_106741_106917

100.0%

NZ_CP101655.1and 1 other:

NZ_JAHHZH010000008.1 Lanthipeptides: allorf_106741_106917_lanthipeptide

Lanthipeptides: allorf_2707176_2707352_lanthipeptide

1

VCGAHQIQDLIIVVLPVCPVQAQSTLGFFWNTRGKHKIGMTGLTSGV

47

VCGAHQIQDLIIVVLPVCPVQAQSTLGFFWNTRGKHKIGMTGLTSGV

1

VCGAHQIQDLIIVVLPVCPVQAQSTLGFFWNTRGKHKIGMTGLTSGV

47

76.0%

NZ_CP023466.1and 2 others:

NZ_JHVT01000005.1 Lanthipeptides: allorf_225835_226020_lanthipeptideNZ_KB906329.1 Lanthipeptides: allorf_148760_148945_lanthipeptide

Lanthipeptides: allorf_0913412_0913597_lanthipeptide

4

AHQIQDLIIVVLPVCPVQAQSTLGFFWNTRGKHKIGMTGLTSG

46

AHQIQDLIIVVLPVCPVQAQSTL FF TRG+ KIGMTGLTSG

4

AHQIQDLIIVVLPVCPVQAQSTLDFFRITRGRSKIGMTGLTSG

46

46.8%

NZ_KN639174.1and 1 other:

NZ_LT629746.1 Lanthipeptides: allorf_2033258_2033398_lanthipeptide

Lanthipeptides: allorf_1025089_1025229_lanthipeptide

4

AHQIQDLIIVVLPVCPVQAQSTLGFF

29

AHQIQDLIIVVLPVCPVQAQS F+

4

AHQIQDLIIVVLPVCPVQAQSRRCFW

29

with 4 more sequence matches

44.7%

NZ_NEHJ01000011.1:

Lanthipeptides: allorf_106799_106939_lanthipeptide

3

GAHQIQDLIIVVLPVCPVQAQSTLGFF

29

GAHQIQDLIIVVLPVCPV+ QS F

3

GAHQIQDLIIVVLPVCPVRVQSRRCFL

29

17.0%

NZ_FPJC01000031.1and 1 other:

NZ_SMCJ01000020.1 Lanthipeptides: allorf_004032_004139_lanthipeptide

Lanthipeptides: allorf_04653_04760_lanthipeptide

30

WNTRGKHKIGMTGLTS

45

W G H G+TGL+S

7

WLASGLHYCGLTGLSS

22

14.9%

NZ_CP028286.1:

Lanthipeptides: allorf_099257_099355_lanthipeptide

2

CGAHQIQDLII

12

CGAH+ DL+I

1

CGAHEKTDLLI

11

14.6%

NZ_CP034118.1and 1 other:

NZ_CP034118.1 Lanthipeptides: EG886_RS06325_lanthipeptide

Lanthipeptides: EG886_RS06325_lanthipeptide

24

STLGFFWNTRGKHKIGM

40

S++ F W TR + +IG+

10

SSIKFKWKTRSRVEIGI

26

allorf_120935_121060

Leader:

MNRRLVCKVPLIAREIRRNSLTG

Core:

KPIFSIIGLRTFYLCSRT

Core with dehydrations:

KPIFDhaIIGLRDhbFYLCysDhaRDhb

antiSMASH-DB 4.0 matches for allorf_120935_121060

100.0%

NZ_CP101655.1and 1 other:

NZ_JAHHZH010000008.1 Lanthipeptides: allorf_120935_121060_lanthipeptide

Lanthipeptides: allorf_2721370_2721495_lanthipeptide

1

KPIFSIIGLRTFYLCSRT

18

KPIFSIIGLRTFYLCSRT

1

KPIFSIIGLRTFYLCSRT

18

83.3%

NZ_FYDR01000007.1:

Lanthipeptides: allorf_187762_187929_lanthipeptide

2

PIFSIIGLRTFYLCSRT

18

P FSI+GLRTFYLCSRT

1

PKFSIVGLRTFYLCSRT

17

9.1%

NZ_NUBO01000052.1and 1 other:

NZ_NVJC01000007.1 Lanthipeptides: allorf_20591_20770_lanthipeptide

Lanthipeptides: allorf_20310_20489_lanthipeptide

1

KPIFSIIGL

9

+PI+S++G+

4

EPIWSVVGV

12

allorf_120972_121070

Leader:

MIEKIGFPVSELRRISRA

Core:

ISGTLQTNRRFMCR

Core with dehydrations:

IDhaGDhbLQDhbNRRFMCysR

antiSMASH-DB 4.0 matches for allorf_120972_121070

100.0%

NZ_CP101655.1and 1 other:

NZ_JAHHZH010000008.1 Lanthipeptides: allorf_120972_121070_lanthipeptide

Lanthipeptides: allorf_2721407_2721505_lanthipeptide

1

ISGTLQTNRRFMCR

14

ISGTLQTNRRFMCR

1

ISGTLQTNRRFMCR

14

25.0%

NZ_CP020083.1:

Lassopeptides: B5J99_RS01555_lassopeptide

5

LQTNRRFMC

13

L+TN+RF+

10

LETNQRFLV

18

20.0%

NZ_CP016458.1:

Lassopeptides: BSY18_RS20855_lassopeptide

5

LQTNRRFMC

13

++TN+RF+

10

IETNQRFLV

18

with 1 more sequence matches

11.1%

NZ_CP018787.1and 1 other:

NZ_CP098244.1 Lanthipeptides: allorf_1031790_1031951_lanthipeptide

Lanthipeptides: allorf_1316452_1316613_lanthipeptide

8

NRRFMCR

14

NR+F CR

6

NRQFSCR

12

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.30 out of 25.31

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.04 out of 18.57

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.02 out of 21.84

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.51 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.55 out of 27.04

Confidence: medium

Additional weak hits (5):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.93 out of 27.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.38 out of 21.55

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 22.40

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.83 out of 26.12

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.95 out of 33.14

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_106724_106882 - Class II

Cleavage pHMM score: -3.00

RODEO score: 0

Monoisotopic mass: 3846.9 Da

Molecular weight: 3849.4 Da

Number of bridges: 2

allorf_106741_106917 - Class II

Cleavage pHMM score: -2.30

RODEO score: 0

Monoisotopic mass: 4910.6 Da

Molecular weight: 4913.8 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4931.8 Da N = 1; 4949.8 Da N = 2; 4967.8 Da N = 3; 4985.8 Da N = 4

allorf_120935_121060 - Class II

Cleavage pHMM score: -6.30

RODEO score: 0

Monoisotopic mass: 2042.2 Da

Molecular weight: 2043.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2061.5 Da N = 1; 2079.5 Da N = 2; 2097.5 Da N = 3

allorf_120972_121070 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 1627.9 Da

Molecular weight: 1628.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1646.9 Da N = 1; 1664.9 Da N = 2

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
DasR	N-acetylglucosamine dependent repressor
MexT	Global virulence regulator
ToxT	Regulator of MSHA biosynthesis

NZ_JAHHZH010000008.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 244,968 - 265,855 nt. (total: 20,888 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase synthetase

KKQ10_RS21570: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

KKQ10_RS21575: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002283.2	0.46	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.46	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002400.2	0.45	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000927.3	0.43	other (flavin)	roseoflavin	Streptomyces davaonensis JCM 4913
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000929.3	0.38	other (other)	xanthothricin	Burkholderia glumae
BGC0001959.4	0.37	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0000640.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002152.2	0.37	other (other)	toxoflavin	Pseudomonas protegens Pf-5

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002283.2	0.46	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.46	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002400.2	0.45	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000927.3	0.43	other (flavin)	roseoflavin	Streptomyces davaonensis JCM 4913
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000929.3	0.38	other (other)	xanthothricin	Burkholderia glumae
BGC0001959.4	0.37	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0000640.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002152.2	0.37	other (other)	toxoflavin	Pseudomonas protegens Pf-5

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

KKQ10_RS21570: PT_FPPS_like

Domain 1 (31 - 294): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

Additional weak hits (5):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.89 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.29 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.94 out of 30.25

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.84 out of 32.38

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production