GCF_018324205.1 - 14 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_AP023356.1 (Actinoplanes ianthinogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1	NI-siderophore	28,516	58,720	Medium	desferrioxamine E	other:other
Region 2	T1PKS	1,930,973	1,976,723
Region 3	thioamide-NRP,betalactone,T1PKS,t3nrps-iterative	2,717,841	2,841,107	Medium	tripartilactam/niizalactam C	PKS
Region 4	T1PKS	3,103,532	3,148,157
Region 5	T3PKS	4,266,745	4,308,337	Medium	loseolamycin A1/loseolamycin A2	PKS
Region 6	terpene	4,860,790	4,882,815	Low	isorenieratene	terpene
Region 7	lanthipeptide-class-i	5,254,545	5,279,079	Medium	microbisporicin A2	ribosomal:RiPP:Lanthipeptide
Region 8	NRPS,T3PKS	5,612,019	5,693,934	Low	hormaomycin/hormaomycin A1/hormaomycin A2/hormaomycin A3/hormaomycin A4/hormaomycin A5/hormaomycin A6	NRPS:Type I
Region 9	RiPP-like	6,231,823	6,243,607
Region 10	terpene	6,552,475	6,574,184
Region 11	terpene	6,944,987	6,966,165
Region 12	NAPAA	8,763,281	8,797,123	High	ε-Poly-L-lysine	NRPS:Type I
Region 13	T2PKS	9,369,379	9,441,882	High	collinomycin	PKS
Region 14	NI-siderophore	9,516,525	9,547,418

NZ_AP023356.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 28,516 - 58,720 nt. (total: 30,205 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

Aiant_RS00215: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: kinase

Aiant_RS00195: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: hydrolase

Aiant_RS00260: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: decarboxylase dehydratase

Aiant_RS00210: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Aiant_RS00230: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: racemase

Aiant_RS00235: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.72	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0001478.5	0.67	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.64	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.63	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001453.5	0.57	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.57	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002464.3	0.55	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002620.2	0.54	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002469.2	0.53	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002690.2	0.52	other (other)	FW0622	Verrucosispora sp. FIM060022

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.72	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0001478.5	0.67	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.64	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.63	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001453.5	0.57	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.57	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002464.3	0.55	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002620.2	0.54	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002469.2	0.53	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002690.2	0.52	other (other)	FW0622	Verrucosispora sp. FIM060022

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.48 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.55 out of 24.78

Confidence: medium

Additional weak hits (5):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.49 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.82 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.27 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.39 out of 35.63

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response

NZ_AP023356.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 1,930,973 - 1,976,723 nt. (total: 45,751 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

Aiant_RS08900: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Aiant_RS08950: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Aiant_RS08955: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Aiant_RS09040: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Aiant_RS09045: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Aiant_RS09055: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Aiant_RS09060: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: decarboxylase

Aiant_RS08915: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

Aiant_RS08965: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.66	PKS	esperamicin	Actinomadura verrucosospora
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000107.3	0.56	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.66	PKS	esperamicin	Actinomadura verrucosospora
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000107.3	0.56	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.43 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.32 out of 20.97

Confidence: medium

Additional weak hits (11):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.74 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.92 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.10 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.80 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.61 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.11 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.50 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.18 out of 18.57

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.89 out of 25.88

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

Aiant_RS08965: mal

PKS_AT (618..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 82.9
Methylmalonyl-CoA: 53.4
Methoxymalonyl-CoA: 51.0
inactive: 41.5
Propionyl-CoA: 34.6
fatty_acid: 26.7
Ethylmalonyl-CoA: 25.7
CHC-CoA: 23.7
trans-1,2-CPDA: 19.7
Isobutyryl-CoA: 18.2
2-Methylbutyryl-CoA: 14.1
Benzoyl-CoA: 9.5
Acetyl-CoA: 4.8
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_AP023356.1 - Region 3 - T1PKS,betalactone,t3nrps-iterative,thioamide-NRP

Download region GenBank file

Download region SVG

Location: 2,717,841 - 2,841,107 nt. (total: 123,267 nt) Show pHMM detection rules used

thioamide-NRP: (ATP-grasp and AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC))
betalactone: (HMGL-like and AMP-binding)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

Aiant_RS12725: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Aiant_RS12795: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: PPTase acylase aminotransferase carboxylase kinase

Aiant_RS12590: aminotransferase

smcogs: SMCOG1019: aminotransferase

Aiant_RS12595: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Aiant_RS12635: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Aiant_RS12660: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Aiant_RS12700: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Aiant_RS12800: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Aiant_RS12810: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: esterase hydrolase

Aiant_RS12640: thioesterase

smcogs: SMCOG1004: thioesterase

Aiant_RS12665: thioesterase

smcogs: SMCOG1004: thioesterase

Aiant_RS12765: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase decarboxylase

Aiant_RS12680: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Aiant_RS12775: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase synthase

Aiant_RS12605: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Aiant_RS12615: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Aiant_RS12685: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Aiant_RS12690: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Aiant_RS12705: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Aiant_RS12710: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Aiant_RS12715: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Aiant_RS12730: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	1.28	PKS	asperlactone	Aspergillus ochraceus
BGC0000041.3	1.03	PKS	oronofacic acid	Pseudomonas syringae
BGC0000016.4	0.94	other (other)	amphotericin B	Streptomyces nodosus
BGC0001257.3	0.90	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.90	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.89	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001160.5	0.89	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.88	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.86	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.85	PKS	6-methylsalicyclic acid	Aspergillus terreus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.72	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.70	PKS	oronofacic acid	Pseudomonas syringae
BGC0000018.5	0.64	PKS	angolamycin	Streptomyces eurythermus
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.10 out of 23.79

Confidence: medium

Additional weak hits (32):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.42 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.41 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.71 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.65 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.65 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.32 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.36 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.54 out of 23.43

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.63 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.23 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.71 out of 26.85

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.35 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.09 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.53 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.82 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.17 out of 36.54

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.67 out of 30.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.92 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.30 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.28 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.88 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.32 out of 23.43

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.54 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.84 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.46 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.62 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.16 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 2717840 - 2841107:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal - ccmal) + (ccmal) + (ccmal - mal) + (ohmal) + (ccmal) + (ccmal - ccmal)
Non-colinear ordering:: Aiant_RS12660 + Aiant_RS12730 + Aiant_RS12725 + Aiant_RS12715 + Aiant_RS12710 + Aiant_RS12705

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

Aiant_RS12660: mal - mal - mal

PKS_AT (654..946): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 192.8
inactive: 112.5
Methoxymalonyl-CoA: 56.2
Methylmalonyl-CoA: 40.0
Propionyl-CoA: 26.7
Isobutyryl-CoA: 24.3
Acetyl-CoA: 13.3
fatty_acid: 10.0
Ethylmalonyl-CoA: 9.7
CHC-CoA: 8.6
Benzoyl-CoA: 7.8
2-Methylbutyryl-CoA: 3.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2354..2615): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 180.4
inactive: 92.7
Methoxymalonyl-CoA: 65.4
Methylmalonyl-CoA: 52.9
Isobutyryl-CoA: 29.7
Propionyl-CoA: 28.0
Ethylmalonyl-CoA: 24.7
Benzoyl-CoA: 20.7
Acetyl-CoA: 17.7
fatty_acid: 16.6
trans-1,2-CPDA: 16.2
CHC-CoA: 14.1
2-Methylbutyryl-CoA: 10.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (3999..4262): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 177.6
inactive: 89.6
Methoxymalonyl-CoA: 57.1
Methylmalonyl-CoA: 48.9
Isobutyryl-CoA: 36.7
Propionyl-CoA: 30.9
Acetyl-CoA: 24.7
Ethylmalonyl-CoA: 24.5
Benzoyl-CoA: 23.8
CHC-CoA: 21.7
trans-1,2-CPDA: 17.3
2-Methylbutyryl-CoA: 16.7
fatty_acid: 15.0
3-Methylbutyryl-CoA: 0.0

Aiant_RS12685: X

AMP-binding (13..406): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAIFWDYGLYKLPISNTGAVRQYGQTECKRITVM
Nearest Stachelhaus code(s):: 3S-Abu DYYPTTQRIK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

Aiant_RS12690: X

AMP-binding (30..418): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YLMAWDSAVSDCFSYFGGEVNVYGPTEITITTHR
Nearest Stachelhaus code(s):: Val DAFFIGVIYK (53% 8Å match); Trp DVSACGCITK (47% 8Å match); Ile DAWFYGVTFK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

Aiant_RS12700: pk

PKS_AT (23..255): pk

ATSignature: (unknown)

No matches above 50%

minowa: Propionyl-CoA

Prediction, score:

Propionyl-CoA: 13.2
2-Methylbutyryl-CoA: 10.4
CHC-CoA: 10.0
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Aiant_RS12705: mal - mal

PKS_AT (543..830): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 195.2
inactive: 100.7
Methoxymalonyl-CoA: 60.7
Methylmalonyl-CoA: 46.7
Isobutyryl-CoA: 28.7
Ethylmalonyl-CoA: 20.4
Acetyl-CoA: 16.9
CHC-CoA: 9.2
Propionyl-CoA: 2.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0
Benzoyl-CoA: -1.0
2-Methylbutyryl-CoA: -1.1

PKS_AT (2422..2683): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 175.9
inactive: 78.5
Methoxymalonyl-CoA: 61.8
Methylmalonyl-CoA: 48.4
Propionyl-CoA: 31.3
Isobutyryl-CoA: 28.0
Ethylmalonyl-CoA: 22.6
Benzoyl-CoA: 19.9
trans-1,2-CPDA: 19.5
Acetyl-CoA: 17.7
2-Methylbutyryl-CoA: 15.7
fatty_acid: 15.0
CHC-CoA: 8.6
3-Methylbutyryl-CoA: 0.0

Aiant_RS12710: mal

PKS_AT (540..801): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 175.2
inactive: 86.0
Methoxymalonyl-CoA: 58.0
Methylmalonyl-CoA: 51.7
Propionyl-CoA: 36.3
Ethylmalonyl-CoA: 28.5
Isobutyryl-CoA: 28.3
Acetyl-CoA: 24.7
Benzoyl-CoA: 24.3
CHC-CoA: 23.5
trans-1,2-CPDA: 20.0
2-Methylbutyryl-CoA: 16.5
fatty_acid: 16.0
3-Methylbutyryl-CoA: 0.0

Aiant_RS12715: mal

PKS_AT (545..806): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.9
inactive: 93.7
Methoxymalonyl-CoA: 64.2
Methylmalonyl-CoA: 52.2
Isobutyryl-CoA: 29.6
Propionyl-CoA: 27.1
Ethylmalonyl-CoA: 24.0
Benzoyl-CoA: 20.5
Acetyl-CoA: 17.9
fatty_acid: 12.1
trans-1,2-CPDA: 9.8
CHC-CoA: 9.6
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Aiant_RS12725: mal - mal

PKS_AT (525..786): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 173.8
inactive: 95.0
Methoxymalonyl-CoA: 58.5
Methylmalonyl-CoA: 48.3
Isobutyryl-CoA: 31.0
Propionyl-CoA: 28.9
Benzoyl-CoA: 24.8
Ethylmalonyl-CoA: 24.5
Acetyl-CoA: 17.9
CHC-CoA: 16.1
trans-1,2-CPDA: 13.8
fatty_acid: 13.5
2-Methylbutyryl-CoA: 9.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2231..2492): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 177.4
inactive: 98.2
Methoxymalonyl-CoA: 52.3
Methylmalonyl-CoA: 47.9
Isobutyryl-CoA: 30.8
Ethylmalonyl-CoA: 25.5
Propionyl-CoA: 25.2
Benzoyl-CoA: 22.6
fatty_acid: 20.9
Acetyl-CoA: 18.4
CHC-CoA: 18.0
trans-1,2-CPDA: 10.9
2-Methylbutyryl-CoA: 9.3
3-Methylbutyryl-CoA: 0.0

Aiant_RS12730: mal

PKS_AT (525..788): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 169.5
inactive: 90.1
Methoxymalonyl-CoA: 49.4
Methylmalonyl-CoA: 33.4
Isobutyryl-CoA: 23.6
Benzoyl-CoA: 18.2
Acetyl-CoA: 17.3
Propionyl-CoA: 16.9
Ethylmalonyl-CoA: 12.1
CHC-CoA: 9.0
2-Methylbutyryl-CoA: 6.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence

NZ_AP023356.1 - Region 4 - T1PKS

Download region GenBank file

Download region SVG

Location: 3,103,532 - 3,148,157 nt. (total: 44,626 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

Aiant_RS13985: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Aiant_RS14065: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

Aiant_RS14090: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: cyclase dehydratase

Aiant_RS13990: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Aiant_RS14075: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Aiant_RS14080: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase synthase

Aiant_RS14035: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Aiant_RS14050: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Aiant_RS14105: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Translocases: transport transporter

Aiant_RS13965: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Aiant_RS14040: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 22.28 out of 23.43

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

Additional weak hits (13):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.16 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.62 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.48 out of 30.25

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.78 out of 30.98

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.29 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.90 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.16 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.43 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.98 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.76 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.56 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.71 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 3103531 - 3148157:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

Aiant_RS14035: mal

PKS_AT (567..856): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 63.5
Methylmalonyl-CoA: 35.6
Methoxymalonyl-CoA: 35.0
Propionyl-CoA: 27.5
inactive: 24.5
fatty_acid: 19.6
Ethylmalonyl-CoA: 18.2
Isobutyryl-CoA: 10.8
2-Methylbutyryl-CoA: 7.7
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Aiant_RS14050: X

AMP-binding (50..446): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GSTSWAKHAWSACAVGAGERDGFGQTETSVQIAN
Nearest Stachelhaus code(s):: Phe or Tyr DAACVAGVAK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CelR	Cellobiose uptake repressor

NZ_AP023356.1 - Region 5 - T3PKS

Download region GenBank file

Download region SVG

Location: 4,266,745 - 4,308,337 nt. (total: 41,593 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: Prenylation aminotransferase methyltransferase

Aiant_RS19190: aminotransferase

smcogs: SMCOG1019: aminotransferase

Aiant_RS19290: Prenylation

MITE: MITE0000083Prenylation (identity: 75.80%)

Aiant_RS46870: Methylation

MITE: MITE0000082Methylation (identity: 70.60%)
smcogs: SMCOG1089: methyltransferase

Hydrolases: deformylase

Aiant_RS19325: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: synthase

Aiant_RS19210: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Aiant_RS19275: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Aiant_RS19280: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001077.4	0.66	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002362.3	0.64	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0000918.3	0.56	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001896.4	0.45	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0002584.2	0.44	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002132.3	0.43	ribosomal	group 1 methanobactin	Methylosinus sp. LW4
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001206.5	0.43	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000632.5	0.42	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001077.4	0.66	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002362.3	0.64	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0000918.3	0.56	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001896.4	0.45	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0002584.2	0.44	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002132.3	0.43	ribosomal	group 1 methanobactin	Methylosinus sp. LW4
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001206.5	0.43	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000632.5	0.42	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.19 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.59 out of 24.78

Confidence: medium

Additional weak hits (19):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.51 out of 20.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.37 out of 27.04

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.39 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.45 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.78 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.24 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.57 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.96 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.83 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.31 out of 23.43

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.10 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.14 out of 31.73

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.72 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
RpoN	Regulator of nitrogen assimilation and virulence

NZ_AP023356.1 - Region 6 - terpene

Download region GenBank file

Download region SVG

Location: 4,860,790 - 4,882,815 nt. (total: 22,026 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

Aiant_RS21930: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Aiant_RS21950: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Hydrolases: esterase

Aiant_RS21885: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Ligases: synthetase

Aiant_RS21935: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.55	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.52	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.52	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.52	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000649.3	0.50	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.49	terpene	carotenoid	Myxococcus xanthus
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000650.3	0.45	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000645.3	0.44	terpene	carotenoid	Halobacillus halophilus DSM 2266

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.55	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.52	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.52	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.52	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000649.3	0.50	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.49	terpene	carotenoid	Myxococcus xanthus
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000650.3	0.45	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000645.3	0.44	terpene	carotenoid	Halobacillus halophilus DSM 2266

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		PSPP	C30	acyclic	PP
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

Aiant_RS21935: PT_FPPS_like

Domain 1 (44 - 321): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Aiant_RS21940: PT_phytoene_like

Domain 1 (5 - 285): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (2):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.83 out of 36.54

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.71 out of 21.55

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_AP023356.1 - Region 7 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 5,254,545 - 5,279,079 nt. (total: 24,535 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

Aiant_RS23755: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Aiant_RS23760: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002635.2	0.81	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000544.4	0.79	ribosomal	planosporicin	Planomonospora alba
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001825.4	0.58	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	0.58	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001289.5	0.56	ribosomal	penisin	Paenibacillus ehimensis
BGC0000529.5	0.54	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000542.3	0.54	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.54	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000506.4	0.53	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002635.2	0.81	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000544.4	0.79	ribosomal	planosporicin	Planomonospora alba
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001825.4	0.58	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	0.58	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001289.5	0.56	ribosomal	penisin	Paenibacillus ehimensis
BGC0000529.5	0.54	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000542.3	0.54	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.54	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000506.4	0.53	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for Aiant_RS23760

Aiant_RS23765

Leader:

MSIDLITKPQTDITVDDLFDLDVDVNIEMTTASPM

Core:

ITSVSLCTPGCTSAGGGSQCSFCC

Core with dehydrations:

IDhbDhaVDhaLCysDhbPGCysDhbDhaAGGGDhaQCysDhaFCysCys

antiSMASH-DB 4.0 matches for Aiant_RS23765

100.0%

NZ_AP023356.1:

Lanthipeptides: Aiant_RS23765_lanthipeptide

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

ITSVSLCTPGCTSAGGGSQCSFCC

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

91.7%

NZ_AXWW01000016.1and 1 other:

NZ_JAMTCO010000009.1 Lanthipeptides: LV75_RS20160_lanthipeptide

Lanthipeptides: H504_RS39505_lanthipeptide

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

ITS+SLCTPGCTSAGGGS CSFCC

1

ITSISLCTPGCTSAGGGSNCSFCC

24

87.5%

NZ_FMZZ01000002.1:

Lanthipeptides: BLS56_RS30480_lanthipeptide

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

+TSVSLCTPGCTS GGGS CSFCC

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

with 101 more sequence matches

Only the first 10 are displayed here.

83.3%

NZ_FMHI01000015.1and 1 other:

NZ_LIXJ01000007.1 Lanthipeptides: AMK22_RS13160_lanthipeptide

Lanthipeptides: H180DRAFT_RS21560_lanthipeptide

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

ITSVS CTPGCTS GGGS CS CC

1

ITSVSYCTPGCTSEGGGSGCSHCC

24

83.3%

NZ_JACHEM010000003.1:

Lanthipeptides: HNQ79_RS07795_lanthipeptide

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

ITSVS CTPGCTS GGGS CS CC

1

ITSVSWCTPGCTSDGGGSGCSHCC

24

83.3%

NZ_JAMHJQ010000009.1and 2 others:

NZ_KN039946.1 Lanthipeptides: FM21_RS35825_lanthipeptideNZ_LIPF01000002.1 Lanthipeptides: AMK11_RS10850_lanthipeptide

Lanthipeptides: M1203_RS22635_lanthipeptide

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

ITSVS CTPGCTS GGGS CS CC

1

ITSVSWCTPGCTSEGGGSGCSHCC

24

83.3%

NZ_KI866523.1:

Lanthipeptides: MPTA5024_RS39835_lanthipeptide

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

+TS SLCTPGCTS GGGS CSFCC

1

VTSWSLCTPGCTSPGGGSNCSFCC

24

83.3%

NZ_LIVZ01000011.1:

Lanthipeptides: AMK31_RS29125_lanthipeptide

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

ITSVS CTPGCTS GGGS CS CC

1

ITSVSYCTPGCTSDGGGSGCSHCC

24

79.2%

NZ_CP048882.1and 1 other:

NZ_CP048882.1 Lanthipeptides: G4Z16_RS06545_lanthipeptide

Lanthipeptides: G4Z16_RS06545_lanthipeptide

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

ITS+S CTPGCTS GGGS CS CC

1

ITSISYCTPGCTSEGGGSGCSHCC

24

79.2%

NZ_JADDUE010000020.1:

Lanthipeptides: INP57_RS28495_lanthipeptide

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

+TSVS CTPGCTS GGGS CS CC

1

VTSVSYCTPGCTSEGGGSNCSHCC

24

79.2%

NZ_JAMTCQ010000009.1:

Lanthipeptides: LY41_RS11610_lanthipeptide

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

+TSVS CTPGCTS GGGS CS CC

1

VTSVSYCTPGCTSEGGGSGCSHCC

24

75.0%

NZ_CP007699.2:

Lanthipeptides: T261_RS08380_lanthipeptide

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

+TS+S CTPGCTS GGGS CS CC

1

VTSISYCTPGCTSDGGGSGCSHCC

24

75.0%

NZ_KB905819.1:

Lanthipeptides: F603_RS34750_lanthipeptide

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

+TS+S CTPGCTS GGGS CS CC

1

VTSISYCTPGCTSEGGGSGCSHCC

24

MIBiG 4.0 matches for Aiant_RS23765

29.4%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

1

ITSVSLCTPGCTS

13

ITS+SLCTPGC +

1

ITSISLCTPGCKT

13

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 26.66 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.69 out of 30.11

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.90 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.35 out of 23.79

Confidence: medium

Additional weak hits (7):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.99 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.08 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.22 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.81 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.50 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.68 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 26.85

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

Aiant_RS23765 - Class I

Cleavage pHMM score: 9.20

RODEO score: 31

Monoisotopic mass: 2077.9 Da

Molecular weight: 2079.4 Da

Number of bridges: 4

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2097.4 Da N = 1; 2115.5 Da N = 2; 2133.5 Da N = 3

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 163 - 251; Score: 58.6

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism

NZ_AP023356.1 - Region 8 - NRPS,T3PKS

Download region GenBank file

Download region SVG

Location: 5,612,019 - 5,693,934 nt. (total: 81,916 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

Aiant_RS25495: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Aiant_RS25525: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Aiant_RS25600: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Aiant_RS25675: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Aiant_RS25725: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

Aiant_RS25580: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: esterase hydrolase peptidase

Aiant_RS25570: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Aiant_RS25640: thioesterase

smcogs: SMCOG1004: thioesterase

Aiant_RS25720: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

Aiant_RS25545: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Aiant_RS25550: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Aiant_RS25605: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Aiant_RS25610: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Aiant_RS25655: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Aiant_RS25685: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Aiant_RS25690: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Aiant_RS25760: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	1.23	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.19	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.18	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	1.16	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	1.15	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	1.12	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	1.11	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	1.09	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	1.06	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	1.05	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.81 out of 20.97

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.94 out of 20.97

Confidence: medium

Additional weak hits (8):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.32 out of 21.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.61 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.52 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.72 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.17 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.74 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 8, location 5612018 - 5693934:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (X) + (Leu) + (Pro) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 5612018 - 5660798:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (X) + (Leu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 5632921 - 5673851:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (X) + (Leu) + (Pro) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 11, location 5641351 - 5693934:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Pro) + (Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

Aiant_RS25545: X - X

AMP-binding (10..417): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAITIDASLEEPSLFVGGDVADYGPTETTISCTT
Nearest Stachelhaus code(s):: Lys DAESVGTIIK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1069..1463): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWITFDVAIWEAHFQTSGEHNAYGQTETSEVALW
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (62% 8Å match)
Stachelhaus code match:: 60% (weak)

Aiant_RS25550: X

AMP-binding (492..836): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: EQLT-----EDWSV-----VAGYGPAETGRVTDQ
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Aiant_RS25605: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (184..588): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: NWMTFDVHIWEWFLVCGGEVNAFGPTEAVTDNVI
Nearest Stachelhaus code(s):: Dab DVWHVGAVDK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

Aiant_RS25655: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (528..925): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: QWQAFDIFYQETFMLTAGEYNQYGPIEVHLATSH
Nearest Stachelhaus code(s):: 4Me-Pro DVQFIAHLAK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

Aiant_RS25685: X

AMP-binding (474..867): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGAGFDVAVLEAKLVVGGDVASYGPTECTVLATV
Nearest Stachelhaus code(s):: Glu DVLKVGAVNK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

Aiant_RS25690: X

AMP-binding (19..410): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LASTVDSTMHDMEVITGGSHNGYGPTEASVAATW
Nearest Stachelhaus code(s):: Lys DVFESGGVAK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A

NZ_AP023356.1 - Region 9 - RiPP-like

Download region GenBank file

Download region SVG

Location: 6,231,823 - 6,243,607 nt. (total: 11,785 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001873.3	0.40	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001485.4	0.39	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001868.4	0.31	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001387.5	0.29	other (other)	nucleocidin	Streptomyces calvus
BGC0000598.5	0.28	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001148.5	0.27	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0002064.2	0.27	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001157.6	0.27	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.27	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001873.3	0.40	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001485.4	0.39	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001868.4	0.31	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001387.5	0.29	other (other)	nucleocidin	Streptomyces calvus
BGC0000598.5	0.28	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001148.5	0.27	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0002064.2	0.27	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001157.6	0.27	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.27	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.69 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_AP023356.1 - Region 10 - terpene

Download region GenBank file

Download region SVG

Location: 6,552,475 - 6,574,184 nt. (total: 21,710 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

Aiant_RS29930: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002309.2	0.47	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000636.3	0.40	terpene	carotenoid	Brevibacterium linens
BGC0000648.3	0.39	terpene	carotenoid	Myxococcus xanthus
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000644.3	0.39	terpene	carotenoid	Dietzia sp. CQ4
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001948.3	0.37	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001456.3	0.37	terpene	isorenieratene	Streptomyces argillaceus
BGC0001910.4	0.37	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.36	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002309.2	0.47	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000636.3	0.40	terpene	carotenoid	Brevibacterium linens
BGC0000648.3	0.39	terpene	carotenoid	Myxococcus xanthus
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000644.3	0.39	terpene	carotenoid	Dietzia sp. CQ4
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001948.3	0.37	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001456.3	0.37	terpene	isorenieratene	Streptomyces argillaceus
BGC0001910.4	0.37	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.36	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

Aiant_RS29920: Lycopene_cycl

Domain 1 (5 - 93): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Aiant_RS29925: Lycopene_cycl

Domain 1 (1 - 90): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Aiant_RS29930: PT_FPPS_like

Domain 1 (41 - 354): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.24 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

Additional weak hits (10):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.42 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 39.62

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.44 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.21 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.08 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.33 out of 27.18

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.93 out of 36.53

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.96 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_AP023356.1 - Region 11 - terpene

Download region GenBank file

Download region SVG

Location: 6,944,987 - 6,966,165 nt. (total: 21,179 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

Aiant_RS31680: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: aminotransferase methyltransferase

Aiant_RS31665: methyltransferase

smcogs: SMCOG1089: methyltransferase

Aiant_RS31685: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: cyclase

Aiant_RS31660: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.73	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001909.3	0.35	PKS	strobilurin A	Strobilurus tenacellus
BGC0002007.2	0.34	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000843.5	0.34	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001151.5	0.32	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0001285.5	0.32	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001768.4	0.32	NRPS	sansalvamide	[Nectria] haematococca mpVI 77-13-4
BGC0000723.5	0.31	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.73	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001909.3	0.35	PKS	strobilurin A	Strobilurus tenacellus
BGC0002007.2	0.34	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000843.5	0.34	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001151.5	0.32	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0001285.5	0.32	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001768.4	0.32	NRPS	sansalvamide	[Nectria] haematococca mpVI 77-13-4
BGC0000723.5	0.31	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

Aiant_RS31660: T1TS

Domain 1 (72 - 384): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.37 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (8):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.92 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.97 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.49 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.34 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.54 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.74 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism

NZ_AP023356.1 - Region 12 - NAPAA

Download region GenBank file

Download region SVG

Location: 8,763,281 - 8,797,123 nt. (total: 33,843 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

Aiant_RS39555: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Isomerases: racemase

Aiant_RS39660: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase

Aiant_RS39590: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.45 out of 32.74

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.19 out of 18.57

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 15, location 8763280 - 8797123:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

Aiant_RS39590: X

AMP-binding (38..414): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACG
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_AP023356.1 - Region 13 - T2PKS

Download region GenBank file

Download region SVG

Location: 9,369,379 - 9,441,882 nt. (total: 72,504 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

Aiant_RS42625: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Aiant_RS42655: Monooxygenation

MITE: MITE0000013Monooxygenation (identity: 69.70%)
smcogs: SMCOG1050: monooxygenase FAD-binding

Aiant_RS42660: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Aiant_RS42665: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Aiant_RS42675: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Aiant_RS42695: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Aiant_RS42710: Monooxygenation

MITE: MITE0000012Monooxygenation (identity: 63.20%)
smcogs: SMCOG1050: monooxygenase FAD-binding

Aiant_RS42720: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Aiant_RS42775: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Aiant_RS42780: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Aiant_RS42810: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acyltransferase carboxylase methyltransferase transferase

Aiant_RS42715: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Aiant_RS42795: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Aiant_RS42805: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Aiant_RS42820: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Aiant_RS42910: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase protease

Aiant_RS42735: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Aiant_RS42840: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Aiant_RS42845: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Aiant_RS42880: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Aiant_RS42950: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase

Aiant_RS42745: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Aiant_RS42770: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

Aiant_RS42755: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Aiant_RS42760: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Translocases: permease

Aiant_RS42855: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.65	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.62	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.61	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000275.4	0.59	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001513.3	0.57	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000215.5	0.57	PKS	curamycin	Streptomyces cyaneus
BGC0002000.4	0.56	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000219.4	0.55	PKS, saccharide	elloramycin	Streptomyces olivaceus
BGC0002047.2	0.54	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0001366.5	0.54	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.65	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.62	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.61	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000275.4	0.59	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001513.3	0.57	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000215.5	0.57	PKS	curamycin	Streptomyces cyaneus
BGC0002000.4	0.56	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000219.4	0.55	PKS, saccharide	elloramycin	Streptomyces olivaceus
BGC0002047.2	0.54	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0001366.5	0.54	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.40 out of 27.55

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.42 out of 24.78

Confidence: medium

Additional weak hits (13):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.46 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.19 out of 18.57

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.96 out of 32.74

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.17 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.90 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.94 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.21 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.55 out of 36.53

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.44 out of 25.88

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 9369378 to 9441882
Starter unit(s):: malonamyl-CoA (Score: 524.0; E-value: 0)
Malonyl elongations:: 11|12 (Score: 670.7; E-value: 1.4e-204)
Product class(es):: pentangular polyphenol
Product molecular weight(s):: malonamyl-CoA_11: 569 Da
malonamyl-CoA_12: 611 Da

Aiant_RS42625: KR (Score: 133.1; E-value: 3.3e-41)
Aiant_RS42655: OXY (Score: 482.4; E-value: 3.9e-147)
Aiant_RS42675: OXY (Score: 277.8; E-value: 4.3e-85)
Aiant_RS42710: OXY (Score: 288.1; E-value: 3.1e-88)
Aiant_RS42715: MET C13O|C17O (Score: 404.7; E-value: 6.1e-124)
Aiant_RS42720: OXY (Score: 295.3; E-value: 2.1e-90)
Aiant_RS42735: AMID (Score: 678.9; E-value: 1.3e-206); AMID CAM34350.1_Lysolipin_malonamyl-CoA (Score: 524.0; E-value: 0.0)
Aiant_RS42745: CYC C4-C21/C2-C23|C2-C19 (Score: 175.4; E-value: 6e-55)
Aiant_RS42750: CYC C5-C18 (Score: 205.9; E-value: 4e-64)
Aiant_RS42755: KS (Score: 759.8; E-value: 1.6e-231)
Aiant_RS42760: CLF 11|12 (Score: 670.7; E-value: 1.4e-204)
Aiant_RS42765: ACP (Score: 80.7; E-value: 1.4e-25)
Aiant_RS42770: CYC C9-C14 (Score: 252.4; E-value: 2.8e-78)
Aiant_RS42775: KR C11 (Score: 265.9; E-value: 7.3e-82)
Aiant_RS42780: KR C19 (Score: 404.7; E-value: 3.4e-124)

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_AP023356.1 - Region 14 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 9,516,525 - 9,547,418 nt. (total: 30,894 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

Aiant_RS43555: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acetyltransferase aminotransferase

Aiant_RS43550: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Aiant_RS43560: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

Aiant_RS43520: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: decarboxylase

Aiant_RS43510: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.52	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.52	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.52	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0002683.2	0.47	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0002470.2	0.46	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000853.3	0.45	other (other)	ectoine	Streptomyces anulatus
BGC0000947.5	0.45	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000943.5	0.43	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.52	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.52	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.52	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0002683.2	0.47	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0002470.2	0.46	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000853.3	0.45	other (other)	ectoine	Streptomyces anulatus
BGC0000947.5	0.45	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000943.5	0.43	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.00 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.83 out of 21.55

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.06 out of 27.04

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.32 out of 29.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description