GCF_018070575.1 - 29 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JAGPXN010000001.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS-like	1	40,900
Region 1.2	T3PKS	905,108	946,166	High	loseolamycin A1/loseolamycin A2	PKS

NZ_JAGPXN010000010.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	NAGGN	109,712	124,518

NZ_JAGPXN010000011.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	NRPS-like,NRPS,T1PKS,azole-containing-RiPP	16,795	160,386	Low	scopranone A/scopranone B/scopranone C	PKS

NZ_JAGPXN010000012.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	T1PKS	1	63,031
Region 4.2	NRPS,lassopeptide	70,985	197,459	Low	rimosamide	NRPS:Type I

NZ_JAGPXN010000013.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	NRPS,lanthipeptide-class-ii,betalactone	126,756	203,425	Low	cyclomarin D	NRPS:Type I

NZ_JAGPXN010000015.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	lanthipeptide-class-iii	14,686	37,286	High	SapB	ribosomal:RiPP:Lanthipeptide

NZ_JAGPXN010000016.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	terpene-precursor	126,293	147,357	Low	CDA1b/CDA2a/CDA2b/CDA3a/CDA3b/CDA4a/CDA4b	NRPS:Type I

NZ_JAGPXN010000017.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	NRPS-like,T1PKS	26,026	70,968	High	matlystatin A	NRPS:Type I+PKS

NZ_JAGPXN010000018.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	other,betalactone,NRPS	15,294	89,332
Region 10.2	terpene	110,354	131,604

NZ_JAGPXN010000019.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	NRPS-like,lanthipeptide-class-ii	1	42,408	Low	actagardine	ribosomal:RiPP:Lanthipeptide

NZ_JAGPXN010000002.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	terpene	39,792	60,796

NZ_JAGPXN010000021.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	terpene	50,041	72,199	Low	isorenieratene	terpene

NZ_JAGPXN010000022.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	NRPS,thioamide-NRP,T1PKS	16,291	113,224	Low	pellasoren/pellasoren B	NRPS:Type I+PKS:Type I

NZ_JAGPXN010000024.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	NRPS,RiPP-like	41,184	90,383

NZ_JAGPXN010000027.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	NI-siderophore,NRPS,2dos,NRPS-like,T1PKS	1	67,757	Low	quinolidomicin A	PKS

NZ_JAGPXN010000028.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	T1PKS	6,445	52,267	Low	sporolide A/sporolide B	NRPS:Type I+PKS:Enediyne type I

NZ_JAGPXN010000003.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	terpene-precursor	142,591	163,673
Region 23.2	terpene	223,351	244,304

NZ_JAGPXN010000032.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	T1PKS	1	32,011	Low	funisamine	PKS

NZ_JAGPXN010000038.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 32.1	T1PKS	1	15,081

NZ_JAGPXN010000004.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 34.1	T1PKS	1	108,516	Low	quinolidomicin A	PKS

NZ_JAGPXN010000041.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 36.1	lanthipeptide-class-i	1	9,315

NZ_JAGPXN010000046.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 41.1	T1PKS	1	5,813

NZ_JAGPXN010000005.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 45.1	terpene,RiPP-like	166,902	192,576	Low	lymphostin/neolymphostinol B/lymphostinol/neolymphostin b	PKS+NRPS:Type I

NZ_JAGPXN010000058.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 54.1	T1PKS	1	1,425

NZ_JAGPXN010000009.1 (Micromonospora sp. C31)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 66.1	T2PKS	98,619	171,137	Low	pradimicin-A	PKS

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS-like	1	40,900
Region 1.2	T3PKS	905,108	946,166	High	loseolamycin A1/loseolamycin A2	PKS
Region 2.1	NAGGN	109,712	124,518
Region 3.1	NRPS-like,NRPS,T1PKS,azole-containing-RiPP	16,795	160,386	Low	scopranone A/scopranone B/scopranone C	PKS
Region 4.1	T1PKS	1	63,031
Region 4.2	NRPS,lassopeptide	70,985	197,459	Low	rimosamide	NRPS:Type I
Region 5.1	NRPS,lanthipeptide-class-ii,betalactone	126,756	203,425	Low	cyclomarin D	NRPS:Type I
Region 7.1	lanthipeptide-class-iii	14,686	37,286	High	SapB	ribosomal:RiPP:Lanthipeptide
Region 8.1	terpene-precursor	126,293	147,357	Low	CDA1b/CDA2a/CDA2b/CDA3a/CDA3b/CDA4a/CDA4b	NRPS:Type I
Region 9.1	NRPS-like,T1PKS	26,026	70,968	High	matlystatin A	NRPS:Type I+PKS
Region 10.1	other,betalactone,NRPS	15,294	89,332
Region 10.2	terpene	110,354	131,604
Region 11.1	NRPS-like,lanthipeptide-class-ii	1	42,408	Low	actagardine	ribosomal:RiPP:Lanthipeptide
Region 12.1	terpene	39,792	60,796
Region 14.1	terpene	50,041	72,199	Low	isorenieratene	terpene
Region 15.1	NRPS,thioamide-NRP,T1PKS	16,291	113,224	Low	pellasoren/pellasoren B	NRPS:Type I+PKS:Type I
Region 17.1	NRPS,RiPP-like	41,184	90,383
Region 20.1	NI-siderophore,NRPS,2dos,NRPS-like,T1PKS	1	67,757	Low	quinolidomicin A	PKS
Region 21.1	T1PKS	6,445	52,267	Low	sporolide A/sporolide B	NRPS:Type I+PKS:Enediyne type I
Region 23.1	terpene-precursor	142,591	163,673
Region 23.2	terpene	223,351	244,304
Region 26.1	T1PKS	1	32,011	Low	funisamine	PKS
Region 32.1	T1PKS	1	15,081
Region 34.1	T1PKS	1	108,516	Low	quinolidomicin A	PKS
Region 36.1	lanthipeptide-class-i	1	9,315
Region 41.1	T1PKS	1	5,813
Region 45.1	terpene,RiPP-like	166,902	192,576	Low	lymphostin/neolymphostinol B/lymphostinol/neolymphostin b	PKS+NRPS:Type I
Region 54.1	T1PKS	1	1,425
Region 66.1	T2PKS	98,619	171,137	Low	pradimicin-A	PKS

No secondary metabolite regions were found in these records:: NZ_JAGPXN010000014.1 (Micromonospora sp. C31); NZ_JAGPXN010000020.1 (Micromonospora sp. C31); NZ_JAGPXN010000023.1 (Micromonospora sp. C31); NZ_JAGPXN010000025.1 (Micromonospora sp. C31); NZ_JAGPXN010000026.1 (Micromonospora sp. C31); NZ_JAGPXN010000029.1 (Micromonospora sp. C31); NZ_JAGPXN010000030.1 (Micromonospora sp. C31); NZ_JAGPXN010000031.1 (Micromonospora sp. C31); NZ_JAGPXN010000033.1 (Micromonospora sp. C31); NZ_JAGPXN010000034.1 (Micromonospora sp. C31); NZ_JAGPXN010000035.1 (Micromonospora sp. C31); NZ_JAGPXN010000036.1 (Micromonospora sp. C31); NZ_JAGPXN010000037.1 (Micromonospora sp. C31); NZ_JAGPXN010000039.1 (Micromonospora sp. C31); NZ_JAGPXN010000040.1 (Micromonospora sp. C31); NZ_JAGPXN010000042.1 (Micromonospora sp. C31); NZ_JAGPXN010000043.1 (Micromonospora sp. C31); NZ_JAGPXN010000044.1 (Micromonospora sp. C31); NZ_JAGPXN010000045.1 (Micromonospora sp. C31); NZ_JAGPXN010000047.1 (Micromonospora sp. C31); NZ_JAGPXN010000048.1 (Micromonospora sp. C31); NZ_JAGPXN010000049.1 (Micromonospora sp. C31); NZ_JAGPXN010000050.1 (Micromonospora sp. C31); NZ_JAGPXN010000051.1 (Micromonospora sp. C31); NZ_JAGPXN010000052.1 (Micromonospora sp. C31); NZ_JAGPXN010000053.1 (Micromonospora sp. C31); NZ_JAGPXN010000054.1 (Micromonospora sp. C31); NZ_JAGPXN010000055.1 (Micromonospora sp. C31); NZ_JAGPXN010000056.1 (Micromonospora sp. C31); NZ_JAGPXN010000057.1 (Micromonospora sp. C31); NZ_JAGPXN010000059.1 (Micromonospora sp. C31); NZ_JAGPXN010000006.1 (Micromonospora sp. C31); NZ_JAGPXN010000060.1 (Micromonospora sp. C31); NZ_JAGPXN010000061.1 (Micromonospora sp. C31); NZ_JAGPXN010000062.1 (Micromonospora sp. C31); NZ_JAGPXN010000063.1 (Micromonospora sp. C31); NZ_JAGPXN010000064.1 (Micromonospora sp. C31); NZ_JAGPXN010000065.1 (Micromonospora sp. C31); NZ_JAGPXN010000066.1 (Micromonospora sp. C31); NZ_JAGPXN010000007.1 (Micromonospora sp. C31); NZ_JAGPXN010000008.1 (Micromonospora sp. C31)

Compact view

NZ_JAGPXN010000001.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 40,900 nt. (total: 40,900 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

KBX06_RS00070: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

KBX06_RS00090: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: sulfotransferase

KBX06_RS00085: Sulfotransferase domain

extras: Sulfotransfer_5: Sulfotransferase domain

Hydrolases: amidase protease

KBX06_RS00065: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

KBX06_RS00160: amidase

smcogs: SMCOG1105: amidase

Lyases: hydratase

KBX06_RS00015: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: ligase synthase

KBX06_RS00095: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS00100: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS00190: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.59	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	0.58	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000597.4	0.49	ribosomal	SWA-2138	Streptomyces sp. e14

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.59	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	0.58	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000597.4	0.49	ribosomal	SWA-2138	Streptomyces sp. e14

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.72 out of 20.47

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 26.18 out of 30.22

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.68 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.21 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (16):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.58 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.49 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.39 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.96 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.68 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.99 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.58 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.73 out of 32.93

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.20 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 40900:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KBX06_RS00095: Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (46..445): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: RFMSFDSSVWQWDFIVGGETNGYGPTEASIGMIF
Nearest Stachelhaus code(s):: Glu DVWHIGSIGK (62% 8Å match); Val DFWNIGGIFK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

KBX06_RS00100: X

AMP-binding (12..419): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VGLNIGGLSWAGLAVYGSAAQIYGLTETGNSAVC
Nearest Stachelhaus code(s):: Hmp GALLVGITVK (24% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAGPXN010000001.1 - Region 2 - T3PKS

Download region GenBank file

Download region SVG

Location: 905,108 - 946,166 nt. (total: 41,059 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KBX06_RS04330: Hydroxylation

MITE: MITE0000081Hydroxylation (identity: 78.20%)
smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase methyltransferase

KBX06_RS04245: aminotransferase

smcogs: SMCOG1019: aminotransferase

KBX06_RS04335: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deformylase

KBX06_RS04365: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: synthase

KBX06_RS04325: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001077.4	0.78	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002362.3	0.75	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0000918.3	0.56	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001896.4	0.43	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001206.5	0.43	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002554.2	0.42	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0001903.3	0.41	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001485.4	0.41	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002007.2	0.41	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001077.4	0.78	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002362.3	0.75	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0000918.3	0.56	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001896.4	0.43	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001206.5	0.43	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002554.2	0.42	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0001903.3	0.41	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001485.4	0.41	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002007.2	0.41	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.36 out of 29.51

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.21 out of 20.47

Confidence: medium

Additional weak hits (12):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.37 out of 26.85

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.27 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.18 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.57 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.36 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.27 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.87 out of 36.54

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.83 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.32 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.63 out of 26.12

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
DosR	Hypoxia stress response regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAGPXN010000010.1 - Region 1 - NAGGN

Download region GenBank file

Download region SVG

Location: 109,712 - 124,518 nt. (total: 14,807 nt) Show pHMM detection rules used

NAGGN: ((TIGR03104 or cds(GATase_7 and Asn_synthase)) and TIGR03103 and (TIGR03106 or Peptidase_M42))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: sulfhydrylase

KBX06_RS15670: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: amidase hydrolase

KBX06_RS15655: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

KBX06_RS15675: amidase

smcogs: SMCOG1105: amidase

Ligases: synthase

KBX06_RS15630: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001880.3	0.45	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000885.3	0.42	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000846.5	0.42	other (other)	tabtoxin	Pseudomonas syringae
BGC0001587.5	0.38	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002213.3	0.37	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0000943.5	0.36	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0000783.3	0.35	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0001739.3	0.34	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001374.5	0.34	other (other)	thienodolin	Streptomyces albogriseolus
BGC0002568.2	0.34	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001880.3	0.45	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000885.3	0.42	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000846.5	0.42	other (other)	tabtoxin	Pseudomonas syringae
BGC0001587.5	0.38	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002213.3	0.37	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0000943.5	0.36	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0000783.3	0.35	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0001739.3	0.34	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001374.5	0.34	other (other)	thienodolin	Streptomyces albogriseolus
BGC0002568.2	0.34	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.03 out of 20.97

Confidence: medium

Additional weak hits (8):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.73 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.30 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.63 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.24 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.95 out of 27.04

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.58 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_JAGPXN010000011.1 - Region 1 - NRPS,NRPS-like,T1PKS,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 16,795 - 160,386 nt. (total: 143,592 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

KBX06_RS16490: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

KBX06_RS16520: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

KBX06_RS16605: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

KBX06_RS16660: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

KBX06_RS16665: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

KBX06_RS16680: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

KBX06_RS16765: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: acylase acyltransferase kinase methyltransferase

KBX06_RS16365: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

KBX06_RS16480: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

KBX06_RS16685: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

KBX06_RS28245: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: amidase dehalogenase esterase

KBX06_RS16450: amidase

smcogs: SMCOG1105: amidase

KBX06_RS16610: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

KBX06_RS16645: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

KBX06_RS16475: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS16495: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

KBX06_RS16515: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

KBX06_RS16525: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

KBX06_RS16540: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS16595: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS16625: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

KBX06_RS16700: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	2.13	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001244.3	2.09	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001833.4	2.01	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	1.96	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	1.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001250.4	1.70	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	1.70	NRPS	epichloenin A	Epichloe festucae
BGC0001240.4	1.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001166.5	1.58	NRPS	HC-toxin	Alternaria jesenskae
BGC0002276.2	1.58	NRPS	choline	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001168.5	0.79	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.53 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (33):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.36 out of 28.14

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.17 out of 26.12

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.29 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.51 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.18 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.77 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.25 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.32 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.35 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.40 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.82 out of 23.43

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.44 out of 28.14

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.61 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.16 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.29 out of 18.57

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.97 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.13 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.41 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.15 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.53 out of 20.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.69 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.48 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.47 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.08 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.88 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.15 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.89 out of 29.65

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Azole RiPPs

Predicted core structure(s)

For candidate cluster 1, location 16794 - 134855:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn) + (X) + (AHBA - ccmal - ccmal) + (Me-ccmal - mal) + (ohmal - pk) + (Me-ccmal - ccmal) + (ccmal) + (Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 16794 - 58585:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn) + (X) + (AHBA - ccmal - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 18620 - 61590:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn) + (X) + (AHBA - ccmal - ccmal) + (Me-ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 24151 - 115799:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn) + (X) + (AHBA - ccmal - ccmal) + (Me-ccmal - mal) + (ohmal - pk) + (Me-ccmal - ccmal) + (ccmal) + (Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 91021 - 134855:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 117371 - 160386:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KBX06_RS16475: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (16..416): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YHVSFDLTVTAAKVMAGGEVNEYGPTETTVGCST
Nearest Stachelhaus code(s):: Asn DLTKMGEVGK (62% 8Å match)
Stachelhaus code match:: 100% (strong)

KBX06_RS16480: X

AMP-binding (438..808): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ARLSTDAALTEVQALVAHEHHGY----TTPGVAG
Nearest Stachelhaus code(s):: Trp DGVQMAGVGK (38% 8Å match); Phe DAWVLAGIQK (24% 8Å match)
Stachelhaus code match:: 60% (weak)

KBX06_RS16495: AHBA - mal - mal

CAL_domain (34..424): AHBA

minowa: AHBA

Prediction, score:

AHBA: 189.7
shikimic_acid: 144.8
fatty_acid: 0.0
NH2: 0.0
Acetyl-CoA: 0.0

PKS_AT (1469..1742): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 140.7
inactive: 65.5
Methoxymalonyl-CoA: 60.0
Methylmalonyl-CoA: 52.4
Isobutyryl-CoA: 30.8
Propionyl-CoA: 19.5
Acetyl-CoA: 15.0
CHC-CoA: 9.2
Benzoyl-CoA: 8.3
Ethylmalonyl-CoA: 0.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -3.8

PKS_AT (3135..3418): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 204.2
inactive: 103.8
Methoxymalonyl-CoA: 67.7
Methylmalonyl-CoA: 64.5
Isobutyryl-CoA: 38.7
Propionyl-CoA: 36.1
Ethylmalonyl-CoA: 29.3
Acetyl-CoA: 22.3
2-Methylbutyryl-CoA: 17.7
CHC-CoA: 16.3
Benzoyl-CoA: 14.1
fatty_acid: 12.7
trans-1,2-CPDA: 7.8
3-Methylbutyryl-CoA: 0.0

KBX06_RS16515: mmal - mal

PKS_AT (543..837): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.9
Ethylmalonyl-CoA: 203.3
Methoxymalonyl-CoA: 173.1
2-Methylbutyryl-CoA: 138.3
trans-1,2-CPDA: 122.6
Malonyl-CoA: 104.6
Propionyl-CoA: 99.1
Isobutyryl-CoA: 95.9
CHC-CoA: 95.0
Benzoyl-CoA: 72.7
Acetyl-CoA: 50.9
3-Methylbutyryl-CoA: 39.3
fatty_acid: 35.6
inactive: 23.4

PKS_AT (2255..2530): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 200.1
inactive: 100.5
Methylmalonyl-CoA: 68.9
Methoxymalonyl-CoA: 67.3
Propionyl-CoA: 39.4
Ethylmalonyl-CoA: 27.0
Isobutyryl-CoA: 24.8
Acetyl-CoA: 23.4
Benzoyl-CoA: 19.7
trans-1,2-CPDA: 16.2
CHC-CoA: 15.2
2-Methylbutyryl-CoA: 14.6
fatty_acid: 10.0
3-Methylbutyryl-CoA: 0.0

KBX06_RS16520: mal - pk

PKS_AT (545..829): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.1
inactive: 91.5
Methoxymalonyl-CoA: 68.2
Methylmalonyl-CoA: 65.0
Propionyl-CoA: 44.1
Isobutyryl-CoA: 31.4
Acetyl-CoA: 26.9
trans-1,2-CPDA: 26.6
CHC-CoA: 25.1
Ethylmalonyl-CoA: 24.3
2-Methylbutyryl-CoA: 24.2
Benzoyl-CoA: 20.1
fatty_acid: 12.0
3-Methylbutyryl-CoA: 4.8

PKS_AT (2029..2322): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 222.4
Methylmalonyl-CoA: 220.2
Methoxymalonyl-CoA: 184.1
2-Methylbutyryl-CoA: 151.5
trans-1,2-CPDA: 140.4
Propionyl-CoA: 127.8
Malonyl-CoA: 106.2
CHC-CoA: 105.8
Benzoyl-CoA: 73.8
Isobutyryl-CoA: 72.8
Acetyl-CoA: 59.4
fatty_acid: 43.9
3-Methylbutyryl-CoA: 35.3
inactive: 27.3

KBX06_RS16525: mmal - mal

PKS_AT (547..845): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 223.4
Ethylmalonyl-CoA: 215.3
Methoxymalonyl-CoA: 186.4
2-Methylbutyryl-CoA: 150.2
trans-1,2-CPDA: 140.7
CHC-CoA: 121.2
Propionyl-CoA: 117.2
Malonyl-CoA: 106.8
Isobutyryl-CoA: 90.0
Benzoyl-CoA: 76.9
Acetyl-CoA: 54.6
3-Methylbutyryl-CoA: 53.7
fatty_acid: 43.4
inactive: 30.8

PKS_AT (2221..2493): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 193.7
inactive: 93.6
Methoxymalonyl-CoA: 64.4
Methylmalonyl-CoA: 63.2
Isobutyryl-CoA: 48.6
Propionyl-CoA: 31.8
Acetyl-CoA: 29.9
Ethylmalonyl-CoA: 27.0
Benzoyl-CoA: 15.7
fatty_acid: 8.3
2-Methylbutyryl-CoA: 3.5
CHC-CoA: 3.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

KBX06_RS28245: mal

PKS_AT (546..815): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 195.0
inactive: 101.7
Methoxymalonyl-CoA: 70.3
Methylmalonyl-CoA: 57.5
Isobutyryl-CoA: 37.7
Propionyl-CoA: 27.0
Acetyl-CoA: 23.6
CHC-CoA: 14.5
Ethylmalonyl-CoA: 12.3
fatty_acid: 9.3
trans-1,2-CPDA: 8.7
2-Methylbutyryl-CoA: 6.4
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

KBX06_RS16540: X

AMP-binding (12..419): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VALM-GFHIGGWCLVYGGAAQIYGLTETGNTAIC
Nearest Stachelhaus code(s):: Val DFFCVGIVHK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

KBX06_RS16595: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (461..863): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHHAFDTSWEGWDIALGGEYNLYGPTECTVDTLW
Nearest Stachelhaus code(s):: Orn DTEDMGLVDK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

KBX06_RS16700: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (15..407): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LELGFDTSIEQVDLIVGGEINAYGLTETTITSCL
Nearest Stachelhaus code(s):: Arg DTEDIGAITK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 9 - 107; Score: 87.4; RRE type: NHLP_CD_RRE; Location: 8 - 92; Score: 66.4; RRE type: Cyanobactin_D_RRE; Location: 10 - 85; Score: 53.6

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
ZuR variant 1	Zinc-responsive repressor

Core peptide predictions

No core peptides found.

NZ_JAGPXN010000012.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 63,031 nt. (total: 63,031 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KBX06_RS17270: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KBX06_RS17290: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

KBX06_RS28495: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase kinase

KBX06_RS17365: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

KBX06_RS17380: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: esterase

KBX06_RS17285: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase hydratase

KBX06_RS17360: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

KBX06_RS17370: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

KBX06_RS17275: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

KBX06_RS17330: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS17345: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS17350: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

KBX06_RS17335: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.83	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.83	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.45	PKS	oronofacic acid	Pseudomonas syringae
BGC0000016.4	0.43	other (other)	amphotericin B	Streptomyces nodosus
BGC0001244.3	0.41	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002171.2	0.37	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.37	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000024.5	0.35	PKS	aureothin	Streptomyces thioluteus
BGC0000996.5	0.34	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.56 out of 27.18

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (6):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.79 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.90 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.36 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.20 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 63031:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal) + (ccmal - redmal) + (ccmal)
Non-colinear ordering:: KBX06_RS17270 + KBX06_RS17275 + KBX06_RS17350

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 35973:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal) + (ccmal - redmal)
Non-colinear ordering:: KBX06_RS17270 + KBX06_RS17275

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 17391 - 63031:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KBX06_RS17270: mmal

PKS_AT (142..438): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA, Ethylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Methylmalonyl-CoA: 75.0%; Ethylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 160.6
Ethylmalonyl-CoA: 152.0
Methoxymalonyl-CoA: 136.5
2-Methylbutyryl-CoA: 95.1
Malonyl-CoA: 94.7
Propionyl-CoA: 87.7
trans-1,2-CPDA: 81.4
Isobutyryl-CoA: 80.5
CHC-CoA: 79.9
Benzoyl-CoA: 51.7
fatty_acid: 36.6
3-Methylbutyryl-CoA: 23.4
Acetyl-CoA: 20.0
inactive: 17.6

KBX06_RS17275: mal - mal

PKS_AT (562..857): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 193.0
inactive: 110.9
Methylmalonyl-CoA: 68.7
Methoxymalonyl-CoA: 66.2
Propionyl-CoA: 39.5
Isobutyryl-CoA: 39.4
Ethylmalonyl-CoA: 37.3
Acetyl-CoA: 28.5
CHC-CoA: 25.9
Benzoyl-CoA: 23.2
fatty_acid: 22.2
2-Methylbutyryl-CoA: 17.9
3-Methylbutyryl-CoA: 0.0
trans-1,2-CPDA: -1.4

PKS_AT (2284..2585): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.4
inactive: 99.1
Methoxymalonyl-CoA: 68.1
Methylmalonyl-CoA: 64.5
Propionyl-CoA: 29.8
Isobutyryl-CoA: 29.8
Ethylmalonyl-CoA: 26.5
Acetyl-CoA: 25.3
fatty_acid: 19.7
CHC-CoA: 19.4
Benzoyl-CoA: 18.3
trans-1,2-CPDA: 13.9
3-Methylbutyryl-CoA: 8.0
2-Methylbutyryl-CoA: 5.8

KBX06_RS17330: X

AMP-binding (54..472): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MVEDHELTTMQMEAVNSFDVQSWSQSENGALCIR
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

KBX06_RS17345: NH2

CAL_domain (151..467): NH2

minowa: NH2

Prediction, score:

NH2: 24.8
fatty_acid: 23.5
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

KBX06_RS17350: mal

PKS_AT (630..920): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 193.6
inactive: 91.8
Methoxymalonyl-CoA: 68.5
Methylmalonyl-CoA: 58.4
Propionyl-CoA: 40.1
CHC-CoA: 35.1
2-Methylbutyryl-CoA: 31.3
trans-1,2-CPDA: 30.0
Benzoyl-CoA: 24.9
Acetyl-CoA: 23.2
Isobutyryl-CoA: 23.1
fatty_acid: 12.8
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -1.9

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
NrdR	Represses ribonucleotide reductase encoding genes
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAGPXN010000012.1 - Region 2 - NRPS,lassopeptide

Download region GenBank file

Download region SVG

Location: 70,985 - 197,459 nt. (total: 126,475 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

KBX06_RS17555: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

KBX06_RS17725: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

KBX06_RS17730: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

KBX06_RS17750: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KBX06_RS17865: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: halogenase sulfhydrylase

KBX06_RS17550: halogenase

smcogs: SMCOG1119: halogenase

KBX06_RS17785: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: deacetylase esterase protease

KBX06_RS17625: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

KBX06_RS17685: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

KBX06_RS17740: thioesterase

smcogs: SMCOG1004: thioesterase

KBX06_RS17745: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: hydratase

KBX06_RS17780: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Isomerases: racemase

KBX06_RS17610: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase synthase

KBX06_RS17525: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS17570: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

KBX06_RS17575: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS17580: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS17590: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS17595: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS17720: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS17735: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS17755: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS17760: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS17765: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.85	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.84	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.83	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.83	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.83	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.82	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.82	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.79	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.79	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.75	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001878.2	0.81	NRPS, PKS	detoxin N2, detoxin N3	Streptomyces sp. NRRL B-1347
BGC0001758.4	0.77	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.76	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.76	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.52 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.34 out of 23.79

Confidence: medium

Additional weak hits (22):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.43 out of 30.22

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.25 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.36 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.10 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.00 out of 29.38

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.68 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.27 out of 36.54

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.37 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.06 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.68 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.26 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.04 out of 24.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.83 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.97 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.47 out of 23.43

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.34 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 4, location 70984 - 197459:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser) + (X) + (Glu) + (Ala) + (Val) + (Gly) + (Thr - Arg - Pro - Cys) + (Val) + (Ile - Pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 70984 - 147740:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (Gly) + (Thr - Arg - Pro - Cys) + (Val) + (Ile - Pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 134880 - 197459:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala) + (Glu) + (X) + (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KBX06_RS17525: X

AMP-binding (17..414): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VALPIGGLWWSGCVVYGGSAQIYGLSESGNTAVC
Nearest Stachelhaus code(s):: Pen or C4:0 IGWCGGVCTK (59% 8Å match)
Stachelhaus code match:: 60% (weak)

KBX06_RS17570: Ile - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (12..434): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LPGAFDALSFEVFILVGGEHNVYGPTEATTFALC
Nearest Stachelhaus code(s):: Ile DAFFLGVTFK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1127..1527): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWQSFDVSFQEGFLVTAGEFNHYGPTETHVVSSL
Nearest Stachelhaus code(s):: Pro DVQFVAHVVK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

KBX06_RS17575: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (534..916): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNWSFDVSVQELYLLVGVELNGYGPTETTVYSTA
Nearest Stachelhaus code(s):: Met DVFYLGGVFK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

KBX06_RS17580: Thr - Arg - Pro - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (495..900): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1585..1993): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: arg (Arg)
Single AA prediction:: arg (Arg)

Stachelhaus prediction details:

Stachelhaus sequence:: VAWAFDVFTADRDFVCGSDVNAYGVTEAAVDSTC
Nearest Stachelhaus code(s):: Arg DVADVGAIDK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2646..3053): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWQAFDVSAQESFLVTAGEYNQYGPTETHVVSQF
Nearest Stachelhaus code(s):: Pro DVQFVAQVVK (88% 8Å match); Hpr DVQFVAQVVK (71% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3701..4096): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVSFDLSVFDGNSMLSGDESLGGATEASIWSIH
Nearest Stachelhaus code(s):: Cys DLFNMSLIWK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

KBX06_RS17590: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (477..865): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAFSFDIALLDLQALSGGEWNLYGPTETTVYSTG
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

KBX06_RS17595: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (453..848): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LGPAFDASTWEGFLLTGGDVNAYGPTENTTLTSC
Nearest Stachelhaus code(s):: Ile DAWFLGMTFK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

KBX06_RS17720: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (33..418): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWITFDLSVFEGNTCLAGECNLYGPSEDTTYSTW
Nearest Stachelhaus code(s):: Ala DLFNCALTYK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

KBX06_RS17735: Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (398..772): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDASVKQVDLLVGGEVNLYGPTECTVDSTA
Nearest Stachelhaus code(s):: Glu DAKDLGVVDK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

KBX06_RS17755: X

AMP-binding (381..768): X

nrpys: Piz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMFGITETTVHVTA
Nearest Stachelhaus code(s):: Piz DFWNVGMVHK (100% 8Å match); Thr DFWNVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

KBX06_RS17765: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (261..656): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFASGEVNLYGPTEATVDVSH
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 13 - 92; Score: 69.0

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JAGPXN010000013.1 - Region 1 - NRPS,betalactone,lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 126,756 - 203,425 nt. (total: 76,670 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

KBX06_RS18595: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Transferases: aminotransferase carbamoyltransferase methyltransferase

KBX06_RS18555: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

KBX06_RS18560: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

KBX06_RS18570: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: deaminase

KBX06_RS18630: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: cyclase lyase

KBX06_RS18550: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

KBX06_RS18680: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

KBX06_RS18575: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

KBX06_RS18585: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS18590: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS18605: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS18610: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS18625: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

KBX06_RS18635: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS18660: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS18665: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS18670: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS18675: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.96	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.95	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.95	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.94	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.93	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.92	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.91	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002075.3	0.89	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001261.3	0.87	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.86	NRPS	dimethylcoprogen	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.78	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.78	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.78	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.78	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.78	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.78	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.76	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.75	NRPS	dimethylcoprogen	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (13):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.44 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.95 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.40 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.21 out of 27.04

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.96 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.66 out of 32.74

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 35.63

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.54 out of 29.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.17 out of 25.88

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.51 out of 24.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.55 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 1, location 126755 - 203425:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2 - Thr) + (X - Thr) + (Ser) + (Ser - Gly) + (Ser) + (Gln - X) + (Ser - Phe)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KBX06_RS18585: Ser - Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (501..881): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTETAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1531..1914): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAQAFDASVWELTLVTGGELHAYGPTETTVVATI
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

KBX06_RS18590: Gln - X

Search NORINE for peptide: strict or relaxed

AMP-binding (470..875): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWSTFDASLWEAQLCSAGEWNTYGPTECAIDATA
Nearest Stachelhaus code(s):: Gln DAWQCGLIDK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1547..1952): X

nrpys: Asp, Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HVISFDVAMDGAEINVGSDLVNYGPTEATVTCLL
Nearest Stachelhaus code(s):: Ahp DVENAGVVTK (53% 8Å match); Orn DVGEIGSVDK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

KBX06_RS18605: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (32..428): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWRTFDVSVCESRFLCSGEFNLYGPTEAAVEVTS
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (82% 8Å match); Dpr DVRHLSMVEK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

KBX06_RS18610: Ser - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (505..895): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVCSGEHNLYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1563..1956): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDPSVLELQALCGGEWDVYGPTETTVWSTA
Nearest Stachelhaus code(s):: Gly DILQLGVVWK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

KBX06_RS18635: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (27..419): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWGTFDVSVPEGHFVCSGELNLYGPTEAAVEVTG
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (82% 8Å match)
Stachelhaus code match:: 80% (moderate)

KBX06_RS18660: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (42..445): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LTTHFDFSVWEGSQVFGGEVNMYGITETTVHASY
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

KBX06_RS18665: Thr - X

Search NORINE for peptide: strict or relaxed

AMP-binding (14..415): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LTTHFDFSVWEGSQVLGGEVNMYGITETTVHSSY
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1119..1525): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISVWQAEVWVASELNMWGTTETSDDVLH
Nearest Stachelhaus code(s):: Dpr DIWEMTADDK (74% 8Å match); Dab DIWELTADDK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

KBX06_RS18670: NH2

CAL_domain (35..467): NH2

minowa: NH2

Prediction, score:

NH2: 130.8
fatty_acid: 25.9
AHBA: 18.8
Acetyl-CoA: 7.7
shikimic_acid: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_JAGPXN010000015.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 14,686 - 37,286 nt. (total: 22,601 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

KBX06_RS19660: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.76	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.68	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.61	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.53	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000553.3	0.51	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002111.3	0.48	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000546.3	0.46	ribosomal	SAL-2242	Streptomyces albidoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.76	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.68	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.61	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.53	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000553.3	0.51	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002111.3	0.48	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000546.3	0.46	ribosomal	SAL-2242	Streptomyces albidoflavus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for KBX06_RS19675

KBX06_RS19680

Leader:

MALLDLQGLEMAPADRTGGGSQ

KBX06_RS19685

Leader:

MALLDLQGMEMAPADRTGGGSQ

Shared core:

ASLLLCGDSSLSVTTCN

Core with dehydrations:

ADhaLLLCysGDDhaDhaLDhaVDhbDhbCysN

antiSMASH-DB 4.0 matches for KBX06_RS19680

100.0%

NC_015434.1and 117 others:

NC_018750.1 Lanthipeptides: SVEN_RS32110_lanthipeptideNC_018750.1 Lanthipeptides: SVEN_RS32110_lanthipeptideNZ_BBNO01000003.1 Lanthipeptides: TU31_RS37940_lanthipeptideNZ_BMSV01000002.1 Lanthipeptides: IE106_RS06150_lanthipeptideNZ_BMTO01000007.1 Lanthipeptides: IE136_RS15615_lanthipeptideNZ_BMTP01000009.1 Lanthipeptides: IE109_RS18470_lanthipeptideNZ_BMTU01000009.1 Lanthipeptides: IE118_RS22890_lanthipeptideNZ_BMUN01000001.1 Lanthipeptides: IE238_RS00740_lanthipeptideNZ_CP007699.2 Lanthipeptides: T261_RS39185_lanthipeptideNZ_CP009754.1 Lanthipeptides: NI25_RS05015_lanthipeptideNZ_CP015866.1 Lanthipeptides: Spa2297_RS27800_lanthipeptideNZ_CP017157.1 Lanthipeptides: SL103_RS15895_lanthipeptideNZ_CP019457.1 Lanthipeptides: BXT88_RS03410_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS35355_lanthipeptideNZ_CP019779.1 Lanthipeptides: STRMOE7_RS03775_lanthipeptideNZ_CP020042.1 Lanthipeptides: B4U46_RS32710_lanthipeptideNZ_CP023202.1 Lanthipeptides: SXIN_RS23100_lanthipeptideNZ_CP023691.1 Lanthipeptides: CP981_RS03050_lanthipeptideNZ_CP023692.1 Lanthipeptides: CP980_RS04735_lanthipeptideNZ_CP023700.1 Lanthipeptides: CP969_RS04700_lanthipeptideNZ_CP027299.1 Lanthipeptides: C1N79_RS34970_lanthipeptideNZ_CP028158.1 Lanthipeptides: C6361_RS04660_lanthipeptideNZ_CP028159.1 Lanthipeptides: C6W10_RS01185_lanthipeptideNZ_CP029042.1 Lanthipeptides: DDE74_RS03525_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029541.1 Lanthipeptides: DKG71_RS05245_lanthipeptideNZ_CP034279.1 Lanthipeptides: EIZ62_RS28660_lanthipeptideNZ_CP034353.1 Lanthipeptides: D1J63_RS04900_lanthipeptideNZ_CP039123.1 Lanthipeptides: E5N77_RS35250_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS09720_lanthipeptideNZ_CP045309.1 Lanthipeptides: GCE86_RS12520_lanthipeptideNZ_CP046104.1 Lanthipeptides: GKC29_RS19975_lanthipeptideNZ_CP046905.1 Lanthipeptides: GPZ77_RS32930_lanthipeptideNZ_CP047140.1 Lanthipeptides: GLX30_RS11420_lanthipeptideNZ_CP050976.1 Lanthipeptides: HEP86_RS04470_lanthipeptideNZ_CP054920.1 Lanthipeptides: HUT15_RS04615_lanthipeptideNZ_CP059322.1 Lanthipeptides: H1D33_RS20095_lanthipeptideNZ_CP059322.1 Lanthipeptides: H1D33_RS20090_lanthipeptideNZ_CP060825.1 Lanthipeptides: IAG43_RS32355_lanthipeptideNZ_CP074111.1 Lanthipeptides: KE639_RS31630_lanthipeptideNZ_CP084681.1 Lanthipeptides: KI385_RS00885_lanthipeptideNZ_CP085300.1 Lanthipeptides: LJA35_RS05220_lanthipeptideNZ_CP086217.1 Lanthipeptides: LJ741_RS03435_lanthipeptideNZ_CP092183.1 Lanthipeptides: COUCH_RS09775_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS09690_lanthipeptideNZ_CP098437.1 Lanthipeptides: NCG97_RS34740_lanthipeptideNZ_CP099468.1 Lanthipeptides: NFX46_RS16770_lanthipeptideNZ_CP101137.1 Lanthipeptides: M6G08_RS24535_lanthipeptideNZ_CP102332.1 Lanthipeptides: NRO40_RS01140_lanthipeptideNZ_CP102609.1 Lanthipeptides: NUT86_RS03980_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33560_lanthipeptideNZ_CP114202.1 Lanthipeptides: STRLI_RS35870_lanthipeptideNZ_CP114203.1 Lanthipeptides: STRNI_RS37360_lanthipeptideNZ_CP114205.1 Lanthipeptides: STRTU_RS33380_lanthipeptideNZ_FMCR01000005.1 Lanthipeptides: GA0070561_RS23835_lanthipeptideNZ_FMCS01000001.1 Lanthipeptides: GA0070214_RS02345_lanthipeptideNZ_FMCU01000002.1 Lanthipeptides: GA0070216_RS07020_lanthipeptideNZ_FMCU01000002.1 Lanthipeptides: GA0070216_RS07015_lanthipeptideNZ_FMCU01000002.1 Lanthipeptides: GA0070216_RS07010_lanthipeptideNZ_FMDM01000002.1 Lanthipeptides: GA0070213_RS04970_lanthipeptideNZ_FNHI01000003.1 Lanthipeptides: BLT82_RS06465_lanthipeptideNZ_HF570108.1 Lanthipeptides: MILUP08_RS22425_lanthipeptideNZ_JACHJE010000006.1 Lanthipeptides: FHS32_RS15850_lanthipeptideNZ_JACHJI010000005.1 Lanthipeptides: FHS37_RS15430_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACWAA010000001.1 Lanthipeptides: ICA23_RS00800_lanthipeptideNZ_JADMLH010000003.1 Lanthipeptides: IT780_RS09875_lanthipeptideNZ_JADMLH010000003.1 Lanthipeptides: IT780_RS09870_lanthipeptideNZ_JAFEJA010000002.1 Lanthipeptides: JE024_RS34830_lanthipeptideNZ_JAFEUO010000005.1 Lanthipeptides: JQN84_RS18770_lanthipeptideNZ_JAFEUO010000005.1 Lanthipeptides: JQN84_RS18765_lanthipeptideNZ_JAGFWR010000037.1 Lanthipeptides: JQN83_RS31375_lanthipeptideNZ_JAGFWR010000037.1 Lanthipeptides: JQN83_RS31370_lanthipeptideNZ_JAGGOI010000031.1 Lanthipeptides: J7E87_RS22160_lanthipeptideNZ_JAGPXN010000015.1 Lanthipeptides: KBX06_RS19685_lanthipeptideNZ_JAGPXN010000015.1 Lanthipeptides: KBX06_RS19680_lanthipeptideNZ_JAGPXW010000002.1 Lanthipeptides: KBX71_RS04195_lanthipeptideNZ_JAGPXX010000007.1 Lanthipeptides: KBZ10_RS10785_lanthipeptideNZ_JAGPYC010000033.1 Lanthipeptides: KBZ00_RS31440_lanthipeptideNZ_JAHLXF010000022.1 Lanthipeptides: KQY13_RS30555_lanthipeptideNZ_JAIHBQ010000001.1 Lanthipeptides: K4902_RS04515_lanthipeptideNZ_JAJJMU010000026.1 Lanthipeptides: LOC25_RS31275_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAPKNL010000004.1 Lanthipeptides: OSI21_RS07750_lanthipeptideNZ_JAPNLM010000003.1 Lanthipeptides: OTB16_RS07305_lanthipeptideNZ_JH993790.1 Lanthipeptides: STRVIR_RS0131905_lanthipeptideNZ_KN039948.1 Lanthipeptides: FM21_RS29525_lanthipeptideNZ_LIPF01000004.1 Lanthipeptides: AMK11_RS16660_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVX01000004.1 Lanthipeptides: AMK29_RS15650_lanthipeptideNZ_LIWB01000010.1 Lanthipeptides: AMK33_RS24360_lanthipeptideNZ_LIYH01000004.1 Lanthipeptides: AMK26_RS17765_lanthipeptideNZ_LT607409.1 Lanthipeptides: GA0070612_RS21605_lanthipeptideNZ_LT607733.1 Lanthipeptides: GA0070610_RS13855_lanthipeptideNZ_LT607733.1 Lanthipeptides: GA0070610_RS13850_lanthipeptideNZ_LT607752.1 Lanthipeptides: GA0070623_RS04340_lanthipeptideNZ_LT607752.1 Lanthipeptides: GA0070623_RS04335_lanthipeptideNZ_LT607752.1 Lanthipeptides: GA0070623_RS04330_lanthipeptideNZ_MPOH02000012.1 Lanthipeptides: BM536_RS17150_lanthipeptideNZ_NBCN01000003.1 Lanthipeptides: BKD26_RS06570_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_QGGR01000008.1 Lanthipeptides: BC793_RS19230_lanthipeptideNZ_RAIF01000032.1 Lanthipeptides: EBH09_RS35480_lanthipeptideNZ_RBAK01000011.1 Lanthipeptides: D7223_RS24620_lanthipeptideNZ_SOPG01000008.1 Lanthipeptides: E0I08_RS17090_lanthipeptide

Lanthipeptides: VAB18032_RS17930_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLSVTTCN

1

ASLLLCGDSSLSVTTCN

17

94.1%

NZ_BBOL01000008.1and 7 others:

NZ_BBOL01000008.1 Lanthipeptides: LPU61_RS25375_lanthipeptideNZ_CP058322.1 Lanthipeptides: HXZ27_RS14120_lanthipeptideNZ_CP058322.1 Lanthipeptides: HXZ27_RS14115_lanthipeptideNZ_FMCT01000009.1 Lanthipeptides: GA0070563_RS21095_lanthipeptideNZ_FMCT01000009.1 Lanthipeptides: GA0070563_RS21090_lanthipeptideNZ_FMCW01000007.1 Lanthipeptides: GA0070558_RS08825_lanthipeptideNZ_FMCW01000007.1 Lanthipeptides: GA0070558_RS08820_lanthipeptide

Lanthipeptides: LPU61_RS25380_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDS LSVTTCN

1

ASLLLCGDSGLSVTTCN

17

94.1%

NZ_BMQY01000002.1and 1 other:

NZ_PGGW01000069.1 Lanthipeptides: CUT44_RS29865_lanthipeptide

Lanthipeptides: IEY99_RS07885_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLSVTTC+

1

ASLLLCGDSSLSVTTCD

17

with 47 more sequence matches

Only the first 10 are displayed here.

88.2%

NZ_CP045309.1and 1 other:

NZ_LT607410.1 Lanthipeptides: GA0074696_RS16340_lanthipeptide

Lanthipeptides: GCE86_RS12515_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLS+TTC

1

ASLLLCGDSSLSITTCK

17

88.2%

NZ_CP118615.1:

Lanthipeptides: PVK37_RS22580_lanthipeptide

2

SLLLCGDSSLSVTTCN

17

SLLLCGDSSLS+TTCN

1

SLLLCGDSSLSLTTCN

16

88.2%

NZ_FMCS01000001.1:

Lanthipeptides: GA0070214_RS02340_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLS+TTC

1

ASLLLCGDSSLSLTTCK

17

88.2%

NZ_LT607410.1:

Lanthipeptides: GA0074696_RS16335_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLS+TTC+

1

ASLLLCGDSSLSITTCH

17

84.2%

NZ_BMXJ01000002.1and 3 others:

NZ_CP099837.1 Lanthipeptides: NE857_RS18075_lanthipeptideNZ_KI911536.1 Lanthipeptides: B042_RS0117070_lanthipeptideNZ_VWVU01000023.1 Lanthipeptides: FYX01_RS21045_lanthipeptide

Lanthipeptides: IE195_RS04480_lanthipeptide

1

ASLLLCGDSSLSVTTC

16

ASLLLCGDSSLSVTTC

4

ASLLLCGDSSLSVTTC

19

80.0%

NZ_CP077658.1and 1 other:

NZ_JACHJG010000001.1 Lanthipeptides: FHS38_RS02665_lanthipeptide

Lanthipeptides: KQY30_RS33045_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLSV TCN

4

ASLLLCGDSSLSVVTCN

20

77.8%

NZ_CP086120.1:

Lanthipeptides: test1122_RS04940_lanthipeptide

1

ASLLLCGDSSLSVTTC

16

ASLLLCGDSS+S+TTC

3

ASLLLCGDSSVSLTTC

18

76.2%

NZ_BBOK01000011.1and 50 others:

NZ_BEWD01000001.1 Lanthipeptides: Sru02f_RS01660_lanthipeptideNZ_BMSL01000016.1 Lanthipeptides: IE215_RS23330_lanthipeptideNZ_BMUC01000023.1 Lanthipeptides: IE172_RS32210_lanthipeptideNZ_BMVE01000003.1 Lanthipeptides: IE248_RS10435_lanthipeptideNZ_BMVL01000005.1 Lanthipeptides: IE257_RS16230_lanthipeptideNZ_BMVQ01000005.1 Lanthipeptides: IE283_RS17035_lanthipeptideNZ_BMWI01000025.1 Lanthipeptides: IE253_RS33945_lanthipeptideNZ_CM002280.1 Lanthipeptides: M877_RS44575_lanthipeptideNZ_CP011664.1 Lanthipeptides: M444_RS30240_lanthipeptideNZ_CP012382.1 Lanthipeptides: SAM23877_RS30085_lanthipeptideNZ_CP012949.1 Lanthipeptides: SAM40697_RS29010_lanthipeptideNZ_CP018047.1 Lanthipeptides: BBN63_RS03065_lanthipeptideNZ_CP020039.1 Lanthipeptides: B4U39_RS34445_lanthipeptideNZ_CP020555.1 Lanthipeptides: B6R96_RS03515_lanthipeptideNZ_CP023701.1 Lanthipeptides: CP968_RS29065_lanthipeptideNZ_CP024087.1 Lanthipeptides: CSH63_RS05810_lanthipeptideNZ_CP029189.1 Lanthipeptides: DEJ51_RS31910_lanthipeptideNZ_CP030286.1 Lanthipeptides: DRB89_RS16930_lanthipeptideNZ_CP033581.1 Lanthipeptides: EES41_RS31595_lanthipeptideNZ_CP034350.1 Lanthipeptides: D1J60_RS32970_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS34495_lanthipeptideNZ_CP043638.1 Lanthipeptides: F1D59_RS34930_lanthipeptideNZ_CP043959.1 Lanthipeptides: F3L20_RS19105_lanthipeptideNZ_CP045547.1 Lanthipeptides: GEV49_RS05730_lanthipeptideNZ_CP048397.1 Lanthipeptides: SSPS47_RS31455_lanthipeptideNZ_CP054939.1 Lanthipeptides: HUT14_RS29815_lanthipeptideNZ_CP094918.1 Lanthipeptides: MTR79_RS16715_lanthipeptideNZ_CP115936.1 Lanthipeptides: PET44_RS28650_lanthipeptideNZ_CP116355.1 Lanthipeptides: KPP03845_RS32700_lanthipeptideNZ_GG657756.1 Lanthipeptides: SSPG_RS05020_lanthipeptideNZ_GG657758.1 Lanthipeptides: SSRG_RS03855_lanthipeptideNZ_JAAALO010000001.1 Lanthipeptides: GVV04_RS02250_lanthipeptideNZ_JAAIFS010000001.1 Lanthipeptides: GUR47_RS02255_lanthipeptideNZ_JACHEM010000005.1 Lanthipeptides: HNQ79_RS11445_lanthipeptideNZ_JAFLQY010000003.1 Lanthipeptides: J0X20_RS29030_lanthipeptideNZ_JAINUL010000001.1 Lanthipeptides: K7B10_RS06210_lanthipeptideNZ_JANAVF010000017.1 Lanthipeptides: NLX94_RS31205_lanthipeptideNZ_KZ195574.1 Lanthipeptides: B9W62_RS05695_lanthipeptideNZ_LIVP01000027.1 Lanthipeptides: AMK15_RS28680_lanthipeptideNZ_LT629768.1 Lanthipeptides: BLU60_RS34110_lanthipeptideNZ_LWLD01000038.1 Lanthipeptides: A6A28_RS28600_lanthipeptideNZ_ML123038.1 Lanthipeptides: EES37_RS30340_lanthipeptideNZ_MQUH01000025.1 Lanthipeptides: BSZ07_RS33280_lanthipeptideNZ_NNBM01000002.1 Lanthipeptides: CG724_RS07855_lanthipeptideNZ_RAII01000001.1 Lanthipeptides: EBH12_RS10360_lanthipeptideNZ_RSEG01000006.1 Lanthipeptides: EIA57_RS12710_lanthipeptideNZ_SOAV01000001.1 Lanthipeptides: EV562_RS04520_lanthipeptideNZ_VIUV01000020.1 Lanthipeptides: FB570_RS34060_lanthipeptideNZ_WHZR01000001.1 Lanthipeptides: STPH1_RS04005_lanthipeptideNZ_WXVT01000001.1 Lanthipeptides: STPH2_RS03995_lanthipeptide

Lanthipeptides: APK71_RS25550_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLS+TTCN

5

ASLLLCGDSSLSITTCN

21

76.2%

NZ_BNCA01000002.1and 1 other:

NZ_CP049782.1 Lanthipeptides: G7Z12_RS34445_lanthipeptide

Lanthipeptides: IE314_RS02760_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLSV+TCN

5

ASLLLCGDSSLSVSTCN

21

76.2%

NZ_CP036455.1and 1 other:

NZ_JAEIOJ010000010.1 Lanthipeptides: IMZ35_RS23775_lanthipeptide

Lanthipeptides: EKD16_RS17975_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLS+TTCN

5

ASLLLCGDSSLSLTTCN

21

MIBiG 4.0 matches for KBX06_RS19680

45.5%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

1

ASLLLCGDSSLSVTTCN

17

SLL+C SSLSV C

5

VSLLVCEYSSLSVVLCT

21

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.87 out of 20.97

Confidence: medium

Additional weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.07 out of 30.22

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.69 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.37 out of 35.63

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

KBX06_RS19680 - Class III

Cleavage pHMM score: 6.40

RODEO score: 0

Monoisotopic mass: 1574.8 Da

Molecular weight: 1575.8 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1593.8 Da N = 1; 1611.8 Da N = 2; 1629.8 Da N = 3; 1647.9 Da N = 4

KBX06_RS19685 - Class III

Cleavage pHMM score: 8.00

RODEO score: 0

Monoisotopic mass: 1574.8 Da

Molecular weight: 1575.8 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1593.8 Da N = 1; 1611.8 Da N = 2; 1629.8 Da N = 3; 1647.9 Da N = 4

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_JAGPXN010000016.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 126,293 - 147,357 nt. (total: 21,065 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

KBX06_RS20820: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Ligases: synthetase

KBX06_RS20860: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.38	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.34	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.32	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.32	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.32	terpene	carotenoid	Streptomyces avermitilis
BGC0000644.3	0.31	terpene	carotenoid	Dietzia sp. CQ4
BGC0000643.3	0.31	terpene	carotenoid	Brevundimonas vesicularis
BGC0000648.3	0.31	terpene	carotenoid	Myxococcus xanthus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.38	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.34	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.32	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.32	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.32	terpene	carotenoid	Streptomyces avermitilis
BGC0000644.3	0.31	terpene	carotenoid	Dietzia sp. CQ4
BGC0000643.3	0.31	terpene	carotenoid	Brevundimonas vesicularis
BGC0000648.3	0.31	terpene	carotenoid	Myxococcus xanthus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

KBX06_RS20860: PT_FPPS_like

Domain 1 (49 - 349): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

Additional weak hits (9):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.67 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.14 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.72 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.25 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.78 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.19 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.69 out of 28.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.63 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.44 out of 26.85

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
OsdR	Development and stress management regulator

NZ_JAGPXN010000017.1 - Region 1 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 26,026 - 70,968 nt. (total: 44,943 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

KBX06_RS21050: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

KBX06_RS21070: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

KBX06_RS21095: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: deformylase hydrolase

KBX06_RS21045: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

KBX06_RS21100: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: ligase synthase

KBX06_RS21075: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS21085: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS21115: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS21120: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

KBX06_RS28530: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.83	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001443.5	0.75	NRPS, PKS	matlystatin A	Actinomadura atramentaria DSM 43919
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.68	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001443.5	0.72	NRPS, PKS	matlystatin A	Actinomadura atramentaria DSM 43919
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (7):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.89 out of 27.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.76 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.80 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.24 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.55 out of 35.63

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.47 out of 32.38

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.04 out of 25.88

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 26025 - 70968:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KBX06_RS21085: X

AMP-binding (24..418): X

nrpys: Piz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MWQAFDVSFQEGFLNTAGEVNHYGQSESAMVTSH
Nearest Stachelhaus code(s):: Piz DVQFNAHMVK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

KBX06_RS21115: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (19..412): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: FWDAFDASMWDPFVLVGGEVNNYGPTETTVIVTS
Nearest Stachelhaus code(s):: Ile DAWFLGNIIK (85% 8Å match); Leu DAWFLGNVVK (74% 8Å match); Leu or Ile DAWFLGNVVK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

KBX06_RS21120: mal

PKS_AT (520..811): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%; Ethylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 123.9
Methoxymalonyl-CoA: 84.7
Methylmalonyl-CoA: 78.0
inactive: 66.5
Ethylmalonyl-CoA: 57.2
Propionyl-CoA: 54.4
CHC-CoA: 44.7
Acetyl-CoA: 40.1
Benzoyl-CoA: 39.3
Isobutyryl-CoA: 39.2
2-Methylbutyryl-CoA: 38.2
trans-1,2-CPDA: 36.4
fatty_acid: 30.3
3-Methylbutyryl-CoA: 17.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein

NZ_JAGPXN010000018.1 - Region 1 - NRPS,betalactone,other

Download region GenBank file

Download region SVG

Location: 15,294 - 89,332 nt. (total: 74,039 nt) Show pHMM detection rules used

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
betalactone: (HMGL-like and AMP-binding)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

KBX06_RS21700: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

KBX06_RS21710: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

KBX06_RS21740: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: aminotransferase

KBX06_RS21715: aminotransferase

smcogs: SMCOG1019: aminotransferase

KBX06_RS21755: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: deaminase dehalogenase hydrolase peptidase

KBX06_RS21640: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

KBX06_RS21645: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

KBX06_RS21680: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

KBX06_RS21775: isochorismatase

smcogs: SMCOG1027: isochorismatase

Ligases: ligase synthase

KBX06_RS21660: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

KBX06_RS21670: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

KBX06_RS21695: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS21725: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS21730: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS21735: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

KBX06_RS21750: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS21765: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS21770: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	1.32	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	1.16	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	1.14	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	1.13	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	1.12	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.10	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.09	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	1.06	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	1.06	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	1.06	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.77	NRPS	enniatin	Fusarium equiseti
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.75	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

Additional weak hits (9):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.05 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.34 out of 30.22

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.45 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.14 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.78 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.21 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.04 out of 23.43

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 15293 - 89332:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser) + (NH2 - NMe-X) + (X - Leu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 21715 - 89332:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser) + (NH2 - NMe-X) + (X - Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KBX06_RS21695: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (25..426): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YFVTTDLGHTAPKIVVGGEVNHYGPTETTVGALT
Nearest Stachelhaus code(s):: Asp DLTKVGHVGK (82% 8Å match); Ser DLTKVGHVGK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

KBX06_RS21725: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (517..916): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWAAFDVSLDERDFVSGVEFNLYGPTEVSVSCTA
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

KBX06_RS21730: NH2 - X

CAL_domain (48..471): NH2

minowa: NH2

Prediction, score:

NH2: 163.2
fatty_acid: 34.7
AHBA: 11.8
shikimic_acid: 0.1
Acetyl-CoA: -1.3

AMP-binding (1144..1538): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWITFFDSGGELVAHSSGEVDLYGSSEISADVTL
Nearest Stachelhaus code(s):: bAla VDGVVSFADK (65% 8Å match); me-bAla GDAVFSLADK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

KBX06_RS21770: X - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (33..424): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWRFFDASVWDATLGAGGQVNLYGPTEATVLAMA
Nearest Stachelhaus code(s):: Leu or Phe DAWTIGGVCK (59% 8Å match); OH-Orn DAQEGGLVDK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1135..1519): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDAAVWEPFVLTGGDVNHYGPTEATVVATA
Nearest Stachelhaus code(s):: Leu DAWFLGHVVK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAGPXN010000018.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 110,354 - 131,604 nt. (total: 21,251 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

KBX06_RS21910: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Translocases: transporter

KBX06_RS22005: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001725.3	0.40	other (other)	oxetanocin A	Bacillus megaterium
BGC0001456.3	0.37	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.36	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000538.3	0.36	ribosomal	nisin Z	Lactococcus lactis
BGC0000633.3	0.35	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.35	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000535.4	0.35	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0002425.3	0.35	ribosomal	stlassin	Streptomyces sp.
BGC0000916.5	0.35	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0002716.2	0.35	NRPS	gamexpeptide A, gamexpeptide B, gamexpeptide E, luminmide B, luminmide D, luminmide E, luminmide F, luminmide G	Photorhabdus laumondii subsp. laumondii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001725.3	0.40	other (other)	oxetanocin A	Bacillus megaterium
BGC0001456.3	0.37	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.36	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000538.3	0.36	ribosomal	nisin Z	Lactococcus lactis
BGC0000633.3	0.35	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.35	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000535.4	0.35	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0002425.3	0.35	ribosomal	stlassin	Streptomyces sp.
BGC0000916.5	0.35	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0002716.2	0.35	NRPS	gamexpeptide A, gamexpeptide B, gamexpeptide E, luminmide B, luminmide D, luminmide E, luminmide F, luminmide G	Photorhabdus laumondii subsp. laumondii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

KBX06_RS21965: Lycopene_cycl

Domain 1 (10 - 379): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.29 out of 23.79

Confidence: medium

Additional weak hits (10):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.70 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.21 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.15 out of 21.55

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.77 out of 25.88

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.77 out of 25.88

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.53 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.61 out of 28.14

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.15 out of 30.22

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JAGPXN010000019.1 - Region 1 - NRPS-like,lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1 - 42,408 nt. (total: 42,408 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

KBX06_RS22190: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

KBX06_RS22195: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: methyltransferase

KBX06_RS22170: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

KBX06_RS22050: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.53	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002346.3	0.41	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001210.5	0.39	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000495.5	0.37	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0000503.5	0.36	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001229.4	0.36	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000554.4	0.34	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000525.5	0.33	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0002698.2	0.33	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000520.5	0.32	ribosomal	lacticin 3147 A1, lacticin 3147 A2	Lactococcus lactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.63	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001229.4	0.55	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0002346.3	0.54	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001210.5	0.53	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000520.5	0.51	ribosomal	lacticin 3147 A1, lacticin 3147 A2	Lactococcus lactis
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000495.5	0.50	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0000503.5	0.49	ribosomal	cinnamycin	Streptomyces cinnamoneus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for KBX06_RS22050

KBX06_RS22045

Leader:

MSAAVIVKSWKDAELRESTIDHPAGTGFGELSVEELREDRTIYAA

Core:

SSGWVCTLTIECGTVVCACR

Core with dehydrations:

DhaDhaGWVCysDhbLDhbIECysGDhbVVCysACysR

antiSMASH-DB 4.0 matches for KBX06_RS22045

100.0%

NZ_JAGPXN010000019.1:

Lanthipeptides: KBX06_RS22045_lanthipeptide

1

SSGWVCTLTIECGTVVCACR

20

SSGWVCTLTIECGTVVCACR

1

SSGWVCTLTIECGTVVCACR

20

95.0%

NZ_KB895893.1and 1 other:

NZ_KB900614.1 Lanthipeptides: SALPAC6_RS0114155_lanthipeptide

Lanthipeptides: C569_RS0129325_lanthipeptide

1

SSGWVCTLTIECGTVVCACR

20

SSGWVCTLTIECGTVVCAC+

1

SSGWVCTLTIECGTVVCACQ

20

90.5%

NZ_CP015515.1and 1 other:

NZ_PSUO01000011.1 Lanthipeptides: C5C18_RS08595_lanthipeptide

Lanthipeptides: A6122_RS12855_lanthipeptide

1

SSGWVCTLTIECGTVVCACR

20

SSGW+CTLTIECGTVVCACR

2

SSGWMCTLTIECGTVVCACR

21

with 107 more sequence matches

Only the first 10 are displayed here.

90.0%

NZ_CP036455.1:

Lanthipeptides: EKD16_RS25235_lanthipeptide

1

SSGWVCTLTIECGTVVCACR

20

SSGWVCTLTIECGT+VCAC+

1

SSGWVCTLTIECGTLVCACQ

20

90.0%

NZ_JAODUN010000003.1:

Lanthipeptides: BXY51_RS10560_lanthipeptide

1

SSGWVCTLTIECGTVVCAC

19

SSGWVCTLTIECGT+VCAC

1

SSGWVCTLTIECGTLVCAC

19

81.0%

NC_009480.1and 10 others:

NZ_CP033724.1 Lanthipeptides: EFE39_RS10220_lanthipeptideNZ_CP047051.1 Lanthipeptides: GRD74_RS10365_lanthipeptideNZ_CP047054.1 Lanthipeptides: GRD61_RS10460_lanthipeptideNZ_CP053860.1 Lanthipeptides: DQP62_RS10825_lanthipeptideNZ_CP076352.1 Lanthipeptides: KN218_RS09900_lanthipeptideNZ_CP085137.1 Lanthipeptides: LHJ48_RS10290_lanthipeptideNZ_CP085140.1 Lanthipeptides: LHJ47_RS10305_lanthipeptideNZ_CP095274.1 Lanthipeptides: MU580_RS10460_lanthipeptideNZ_PSTW01000024.1 Lanthipeptides: C5C03_RS09675_lanthipeptideNZ_SISU01000002.1 Lanthipeptides: EOG37_RS09890_lanthipeptide

Lanthipeptides: CMM_RS10575_lanthipeptide

1

SSGWVCTLTIECGTVVCACR

20

SSGW+CTLTIECGT++CACR

2

SSGWLCTLTIECGTIICACR

21

81.0%

NZ_AUBN01000022.1:

Lanthipeptides: G448_RS16025_lanthipeptide

1

SSGWVCTLTIECGTVVCACR

20

SSGW CTLTIECGT +CACR

2

SSGWFCTLTIECGTFICACR

21

81.0%

NZ_CP028130.1:

Lanthipeptides: C7V51_RS14690_lanthipeptide

1

SSGWVCTLTIECGTVVCACR

20

SSGW+CTLTIECGT++CACR

2

SSGWMCTLTIECGTIICACR

21

81.0%

NZ_CP061274.1and 1 other:

NZ_JADKRR010000001.1 Lanthipeptides: ITJ40_RS10085_lanthipeptide

Lanthipeptides: H9X71_RS09850_lanthipeptide

1

SSGWVCTLTIECGTVVCACR

20

SSGW+CTLTIECGT +CACR

2

SSGWLCTLTIECGTFICACR

21

45.5%

NZ_CP034669.1:

Lanthipeptides: EJ065_RS32040_lanthipeptide

1

SSGWVCTLTIECG

13

S G+VCTLT ECG

9

SCGYVCTLTTECG

21

40.0%

NZ_CP022413.2and 1 other:

NZ_JAQEYW010000009.1 Lanthipeptides: PG422_RS09400_lanthipeptide

Lanthipeptides: CGC63_RS01420_lanthipeptide

2

SGWVCTLTIECGTV

15

SG VCT+++ECG++

1

SGVVCTISVECGSI

14

40.0%

NZ_FOHE01000012.1and 1 other:

NZ_FOHE01000012.1 Lanthipeptides: BMX40_RS20540_lanthipeptide

Lanthipeptides: BMX40_RS20545_lanthipeptide

2

SGWVCTLTIECGTVVCAC

19

GW T+TI TV C

1

QGWTWTVTIFLSTVSNHC

18

40.0%

NZ_JALMDK010000017.1:

Lanthipeptides: allorf_059288_059443_lanthipeptide

1

SSGWVCTLTIEC

12

S G++CTLT EC

2

SGGYICTLTWEC

13

MIBiG 4.0 matches for KBX06_RS22045

26.7%

BGC0002110.3 (QKV49893.1):

Lanthipeptide: birimositide

1

SSGWVCTLTIEC

12

+ GW CTLT EC

15

NGGW-CTLTKEC

25

25.0%

BGC0000517.4 (BAB04173.1):

Lanthipeptide: haloduracin β or haloduracin α

1

SSGWVCTLTIEC

12

+ G CTLT+EC

12

NKGAYCTLTVEC

23

12.8%

BGC0001229.4 (SBI_06990):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

6

CTLTIEC

12

CTL+ EC

28

CTLSKEC

34

allorf_013482_013628

Leader:

MHVGLAVRNDQVADAMVPWA

Core:

CRSRCCRTRSSRPTACRVGCASWPTETR

Core with dehydrations:

CysRDhaRCysCysRDhbRDhaDhaRPDhbACysRVGCysADhaWPDhbEDhbR

antiSMASH-DB 4.0 matches for allorf_013482_013628

100.0%

NZ_JAGPXN010000019.1:

Lanthipeptides: allorf_013482_013628_lanthipeptide

1

CRSRCCRTRSSRPTACRVGCASWPTETR

28

CRSRCCRTRSSRPTACRVGCASWPTETR

1

CRSRCCRTRSSRPTACRVGCASWPTETR

28

32.1%

NZ_KK211141.1:

Lanthipeptides: allorf_073725_073880_lanthipeptide

3

SRCCRTRSSRPTACRVGCASWP

24

R C + P AC G SWP

3

PRPCLFHYAMPPACVRGHPSWP

24

30.0%

NZ_FNPT01000003.1:

Lanthipeptides: allorf_246742_246903_lanthipeptide

3

SRCCRTRSSRPTACRVGCASW

23

S C R +PT VG A W

8

SPCLDVRHEKPTNDGVGAAVW

28

with 4 more sequence matches

28.6%

NZ_KB900379.1:

Lanthipeptides: allorf_23102_23224_lanthipeptide

2

RSRCCRTRSSRPTACR

17

+S C TRSS AC+

4

QSNSCNTRSSISIACK

19

26.7%

NZ_CP013140.1:

Lanthipeptides: allorf_2669938_2670054_lanthipeptide

3

SRCCRTRSSRPTACRVGCA

21

S C R +PT VG A

8

SACLNVRHEKPTDDGVGAA

26

19.6%

NZ_JAGGRJ010000031.1:

Lanthipeptides: allorf_023069_023305_lanthipeptide

1

CRSRCCRTRSSRPTACRVGCASWPTE

26

C++R R TA VG W T

7

CKARMPRIHRYSVTAVHVGFGGWITN

32

14.3%

NZ_CP031598.1:

Lanthipeptides: allorf_1753918_1754139_lanthipeptide

7

RTRSSRPTACRVGCASWPTE

26

R+ +SRP A AS+P E

9

RSTASRPFALAAANASFPEE

28

MIBiG 4.0 matches for allorf_013482_013628

11.8%

BGC0002120.3 (NQE92413.1):

Lanthipeptide: nocathioamide A

3

SRCCRTRSSRPTA

15

S SSRP A

25

SSMFDDESSRPAA

37

allorf_013625_013804

Leader:

MSALTAASRELFGNPGA

Core:

PSGDVAWPLTHPVAAVLQRTLNAQGIWKPPARRYLCCGLRLR

Core with dehydrations:

PDhaGDVAWPLDhbHPVAAVLQRDhbLNAQGIWKPPARRYLCysCysGLRLR

antiSMASH-DB 4.0 matches for allorf_013625_013804

100.0%

NZ_JAGPXN010000019.1:

Lanthipeptides: allorf_013625_013804_lanthipeptide

1

PSGDVAWPLTHPVAAVLQRTLNAQGIWKPPARRYLCCGLRLR

42

PSGDVAWPLTHPVAAVLQRTLNAQGIWKPPARRYLCCGLRLR

1

PSGDVAWPLTHPVAAVLQRTLNAQGIWKPPARRYLCCGLRLR

42

21.4%

NZ_LR134504.1:

Lanthipeptides: EL293_RS07215_lanthipeptide

15

AVLQRTLNAQGIWKPPARRYLCCGLR

40

A ++R QGI K P + C L+

8

ARIERIAKDQGIPKDPDSDCVTCRLQ

33

16.7%

NC_009727.1and 1 other:

NC_011527.1 Lanthipeptides: CBUG_RS03735_lanthipeptide

Lanthipeptides: CBUD_RS06820_lanthipeptide

1

PSGDVAWPLTHP

12

P G++A+PLT P

10

PKGNLAFPLTVP

21

with 2 more sequence matches

16.7%

NZ_JALASB010000016.1and 3 others:

NZ_JALASR010000012.1 Lanthipeptides: allorf_118471_118596_lanthipeptideNZ_JALAUW010000005.1 Lanthipeptides: allorf_020440_020565_lanthipeptideNZ_JALAXQ010000010.1 Lanthipeptides: allorf_19390_19515_lanthipeptide

Lanthipeptides: allorf_020355_020480_lanthipeptide

27

WKPPARRYLCCGLRL

41

+ PP +LCCG L

10

YGPPLSIFLCCGYIL

24

11.9%

NZ_CP046058.1:

Lanthipeptides: allorf_1388818_1388973_lanthipeptide

10

THPVAAVLQRTLNAQGIW

27

+H V + ++ QG+W

3

SHYVCKYMSSSVFGQGVW

20

allorf_013918_014070

Leader:

MPCARKSSRRRRSRAG

Core:

QDSCSTTCSTTRRSVIGPSMPCGNCANAAATGHR

Core with dehydrations:

QDDhaCysDhaDhbDhbCysDhaDhbDhbRRDhaVIGPDhaMPCysGNCysANAAADhbGHR

antiSMASH-DB 4.0 matches for allorf_013918_014070

100.0%

NZ_JAGPXN010000019.1:

Lanthipeptides: allorf_013918_014070_lanthipeptide

1

QDSCSTTCSTTRRSVIGPSMPCGNCANAAATGHR

34

QDSCSTTCSTTRRSVIGPSMPCGNCANAAATGHR

1

QDSCSTTCSTTRRSVIGPSMPCGNCANAAATGHR

34

23.9%

NZ_SDLS01000001.1:

Lanthipeptides: allorf_657215_657439_lanthipeptide

15

VIGPSMPCGNCANAAATGHR

34

VIGP+ P G C AAT R

7

VIGPA-PSGRCHIGAATALR

25

17.6%

NZ_CP023702.1:

Lanthipeptides: allorf_5080754_5080945_lanthipeptide

11

TRRSVIGPSMPC

22

RRS +GP P

5

VRRSALGPGGPL

16

with 1 more sequence matches

12.1%

NZ_CP098485.1:

Lanthipeptides: allorf_6386562_6386786_lanthipeptide

12

RRSVIGPSMPCGN

24

RRS IGP+ CG

13

RRSPIGPAGGCGE

25

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.69 out of 36.53

Confidence: medium

Additional weak hits (8):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.69 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.33 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.44 out of 30.22

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.13 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.73 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

KBX06_RS22045 - Class II

Cleavage pHMM score: 1.50

RODEO score: 0

Monoisotopic mass: 1996.9 Da

Molecular weight: 1998.4 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 2016.4 Da N = 1

allorf_013482_013628 - Class II

Cleavage pHMM score: -6.10

RODEO score: 0

Monoisotopic mass: 3041.5 Da

Molecular weight: 3043.5 Da

Number of bridges: 5

Alternative weights: (assuming N unmodified Ser/Thr residues); 3061.5 Da N = 1; 3079.5 Da N = 2; 3097.5 Da N = 3

allorf_013625_013804 - Class II

Cleavage pHMM score: -5.40

RODEO score: 0

Monoisotopic mass: 4625.5 Da

Molecular weight: 4628.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4646.4 Da N = 1

allorf_013918_014070 - Class II

Cleavage pHMM score: -6.80

RODEO score: 0

Monoisotopic mass: 3259.5 Da

Molecular weight: 3261.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3279.6 Da N = 1; 3297.6 Da N = 2; 3315.7 Da N = 3; 3333.7 Da N = 4; 3351.7 Da N = 5; 3369.7 Da N = 6

Predicted core structure(s)

For candidate cluster 1, location 0 - 42408:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KBX06_RS22120: X

AMP-binding (14..372): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NAILYGLSVV-SAGTQAGGYVMYGQTEATARMAY
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_JAGPXN010000002.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 39,792 - 60,796 nt. (total: 21,005 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KBX06_RS05090: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase

KBX06_RS05070: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

KBX06_RS05095: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000889.5	0.43	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.43	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0002493.3	0.38	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0001547.3	0.37	terpene	citreohybridonol	Aspergillus stellatus
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000906.3	0.36	other (other)	heme D1	Heliophilum fasciatum
BGC0000905.5	0.36	other (other)	heme D1	Heliobacillus mobilis
BGC0001444.5	0.34	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0000682.3	0.34	terpene	terretonin	Aspergillus terreus NIH2624
BGC0000869.5	0.32	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000889.5	0.43	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.43	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0002493.3	0.38	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0001547.3	0.37	terpene	citreohybridonol	Aspergillus stellatus
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000906.3	0.36	other (other)	heme D1	Heliophilum fasciatum
BGC0000905.5	0.36	other (other)	heme D1	Heliobacillus mobilis
BGC0001444.5	0.34	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0000682.3	0.34	terpene	terretonin	Aspergillus terreus NIH2624
BGC0000869.5	0.32	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

KBX06_RS05070: T1TS

Domain 1 (10 - 316): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

Additional weak hits (9):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.82 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.43 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.27 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.71 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.73 out of 19.26

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.34 out of 32.74

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor

NZ_JAGPXN010000021.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 50,041 - 72,199 nt. (total: 22,159 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

KBX06_RS23545: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

KBX06_RS23560: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

KBX06_RS23580: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: deacetylase hydrolase

KBX06_RS23565: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

KBX06_RS23595: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Lyases: hydratase

KBX06_RS23555: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: synthetase

KBX06_RS23575: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.55	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.54	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.52	terpene	carotenoid	Streptomyces avermitilis
BGC0000649.3	0.52	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.52	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000640.3	0.51	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000648.3	0.49	terpene	carotenoid	Myxococcus xanthus
BGC0000650.3	0.48	terpene	carotenoid	Algoriphagus sp. KK10202C

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.55	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.54	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.52	terpene	carotenoid	Streptomyces avermitilis
BGC0000649.3	0.52	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.52	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000640.3	0.51	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000648.3	0.49	terpene	carotenoid	Myxococcus xanthus
BGC0000650.3	0.48	terpene	carotenoid	Algoriphagus sp. KK10202C

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

KBX06_RS23570: PT_phytoene_like

Domain 1 (5 - 288): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

KBX06_RS23575: PT_FPPS_like

Domain 1 (68 - 376): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.25 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.67 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.99 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_JAGPXN010000022.1 - Region 1 - NRPS,T1PKS,thioamide-NRP

Download region GenBank file

Download region SVG

Location: 16,291 - 113,224 nt. (total: 96,934 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
thioamide-NRP: (ATP-grasp and AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC))
T1PKS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

KBX06_RS24045: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

KBX06_RS24120: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

KBX06_RS24165: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

KBX06_RS24175: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

KBX06_RS28560: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase acylase acyltransferase glycosyltransferase

KBX06_RS24055: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

KBX06_RS24125: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

KBX06_RS24160: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

KBX06_RS24210: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: dehalogenase esterase phosphatase

KBX06_RS24040: thioesterase

smcogs: SMCOG1004: thioesterase

KBX06_RS24180: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

KBX06_RS24190: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: decarboxylase dehydratase

KBX06_RS23990: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

KBX06_RS24100: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

KBX06_RS23980: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

KBX06_RS24025: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

KBX06_RS24035: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS24050: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS24060: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS24090: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

KBX06_RS24185: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	1.54	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	1.53	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.53	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.52	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	1.50	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	1.49	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	1.47	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	1.42	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	1.38	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	1.34	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002286.3	0.76	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.76	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001249.5	0.74	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.10 out of 23.79

Confidence: medium

Additional weak hits (5):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.82 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.29 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.41 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.87 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 16290 - 113224:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (X) + (X) + (Val - X) + (mal) + (emal - Gly - Me-mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KBX06_RS24035: X - X

AMP-binding (467..859): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SGQSWDAFSLEGQLFTGGEANGYGPAESMGFSTT
Nearest Stachelhaus code(s):: Val DALWLGGTFK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1565..1957): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SGQSWDAFSLEGQLFTGGEANGYGPAESMGFSTT
Nearest Stachelhaus code(s):: Val DALWLGGTFK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

KBX06_RS24050: X

AMP-binding (24..419): X

nrpys: Gln, Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LELAFDASVQQRDILVGGEVNLYGPTECTVDATA
Nearest Stachelhaus code(s):: Gln or Glu DAQDLGVVDK (79% 8Å match); Ile DAQDLGVVDK (79% 8Å match); Gln DAQDLGVVDK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

KBX06_RS24055: X

AMP-binding (1031..1414): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GGTA---FTAAAALVTTGNLTAHGATEAGPWALL
Nearest Stachelhaus code(s):: Ala DVATVTAIWK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

KBX06_RS24060: Gln - Val - X

Search NORINE for peptide: strict or relaxed

AMP-binding (38..403): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FGAAFDASVEEVDLVIGGELNTYGPTEATVVATV
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (94% 8Å match); Gln or Tyr DAESVGTVVK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1540..1938): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: TGQAWDAFALEGWLVTGGEVHGYGPVESMIFTNC
Nearest Stachelhaus code(s):: bOH-Val DALWLGGTFK (62% 8Å match); Val DALWIGGVFK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2598..2994): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDSSTYEVYFWTGGDVHSYGPTEVTFASHH
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

KBX06_RS24160: mal

PKS_AT (23..333): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 150.3
inactive: 92.7
Methoxymalonyl-CoA: 63.5
Methylmalonyl-CoA: 49.9
Propionyl-CoA: 40.5
2-Methylbutyryl-CoA: 20.6
Ethylmalonyl-CoA: 19.3
Isobutyryl-CoA: 16.7
CHC-CoA: 16.4
Acetyl-CoA: 11.6
Benzoyl-CoA: 10.7
3-Methylbutyryl-CoA: 8.3
trans-1,2-CPDA: 0.7
fatty_acid: 0.0

KBX06_RS24185: emal - Gly - mmal

Search NORINE for peptide: strict or relaxed

PKS_AT (582..883): emal

ATSignature: Methylmalonyl-CoA, Ethylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 195.8
Methylmalonyl-CoA: 175.5
Methoxymalonyl-CoA: 145.1
2-Methylbutyryl-CoA: 121.6
trans-1,2-CPDA: 115.1
Propionyl-CoA: 106.9
Malonyl-CoA: 98.0
CHC-CoA: 89.3
Isobutyryl-CoA: 87.7
Benzoyl-CoA: 66.8
Acetyl-CoA: 56.3
fatty_acid: 39.1
3-Methylbutyryl-CoA: 14.5
inactive: 13.9

AMP-binding (1535..1918): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDISTLEWQCLVGGELNMYGPTETTVWSTT
Nearest Stachelhaus code(s):: Gly DILQLGMVWK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

PKS_AT (2638..2934): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Malonyl-CoA: 87.5%; Methoxymalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 164.1
Ethylmalonyl-CoA: 146.8
Methoxymalonyl-CoA: 135.2
trans-1,2-CPDA: 97.3
Malonyl-CoA: 95.5
2-Methylbutyryl-CoA: 95.0
Propionyl-CoA: 90.7
CHC-CoA: 82.2
Isobutyryl-CoA: 80.3
Benzoyl-CoA: 64.4
fatty_acid: 48.9
Acetyl-CoA: 41.9
3-Methylbutyryl-CoA: 37.3
inactive: 22.6

KBX06_RS24220: mmal - mal - mmal

PKS_AT (605..890): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA, 2-Methylbutyryl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%; Methylmalonyl-CoA: 58.3%; 2-Methylbutyryl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 96.3
Methoxymalonyl-CoA: 74.5
Isobutyryl-CoA: 67.5
Ethylmalonyl-CoA: 62.6
Malonyl-CoA: 49.7
2-Methylbutyryl-CoA: 48.7
Propionyl-CoA: 40.2
Benzoyl-CoA: 37.8
3-Methylbutyryl-CoA: 33.4
trans-1,2-CPDA: 23.3
fatty_acid: 14.0
CHC-CoA: 12.4
Acetyl-CoA: 9.1
inactive: 0.0

PKS_AT (1022..1322): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; 2-Methylbutyryl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.7
inactive: 97.1
Methoxymalonyl-CoA: 74.8
Methylmalonyl-CoA: 68.7
Ethylmalonyl-CoA: 35.1
Isobutyryl-CoA: 32.4
Propionyl-CoA: 29.8
fatty_acid: 26.9
Acetyl-CoA: 25.8
Benzoyl-CoA: 22.6
CHC-CoA: 22.2
trans-1,2-CPDA: 18.4
2-Methylbutyryl-CoA: 17.6
3-Methylbutyryl-CoA: 10.9

PKS_AT (2542..2829): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 166.0
Ethylmalonyl-CoA: 150.2
Methoxymalonyl-CoA: 137.3
2-Methylbutyryl-CoA: 101.3
Malonyl-CoA: 100.2
Propionyl-CoA: 99.5
trans-1,2-CPDA: 87.7
CHC-CoA: 63.7
Isobutyryl-CoA: 63.5
Benzoyl-CoA: 59.9
fatty_acid: 43.1
inactive: 33.9
Acetyl-CoA: 32.9
3-Methylbutyryl-CoA: 17.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JAGPXN010000024.1 - Region 1 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 41,184 - 90,383 nt. (total: 49,200 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

KBX06_RS24860: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

KBX06_RS24900: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

KBX06_RS28580: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: glycosyltransferase methyltransferase

KBX06_RS24880: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

KBX06_RS24920: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase

KBX06_RS24930: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

KBX06_RS24840: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

KBX06_RS24890: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS24895: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS24905: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS24910: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS24925: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS24940: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.61	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.58	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.57	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002164.2	0.56	NRPS	peramine	Epichloe festucae
BGC0001641.4	0.56	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.56	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001166.5	0.56	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.74	NRPS	enniatin	Fusarium equiseti
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.71	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.90 out of 20.97

Confidence: medium

Additional weak hits (7):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.97 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.95 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.72 out of 30.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.75 out of 27.04

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.10 out of 31.73

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 41183 - 90383:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Orn) + (Asp) + (Pro) + (NMe-Asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KBX06_RS24890: His

Search NORINE for peptide: strict or relaxed

AMP-binding (26..402): His

nrpys: His

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SARSFDSSVAGWLLIVAGEYNEYGPTEGTVWTMV
Nearest Stachelhaus code(s):: His DSALIAEVWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

KBX06_RS24895: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (470..879): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TAWAFDGFLGERDFIVGSDVNCYGLTEATVDSTY
Nearest Stachelhaus code(s):: Orn DVGEIGSVDK (65% 8Å match); Glu DAKDIGVVDK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

KBX06_RS24910: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (34..436): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWLSFDFSATNLRVVVGGEYNHYGPTETVIGRCF
Nearest Stachelhaus code(s):: Asp DLTKVGHIGK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

KBX06_RS24925: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (6..408): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWQSFDASFQESFMLTAGEVNQYGPSETHIVTSI
Nearest Stachelhaus code(s):: Pro DVQFMAQVVK (74% 8Å match)
Stachelhaus code match:: 70% (weak)

KBX06_RS24940: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (505..908): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLAVTSAKLILGGEVNEYGPTETAVACTA
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A

NZ_JAGPXN010000027.1 - Region 1 - 2dos,NI-siderophore,NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 67,757 nt. (total: 67,757 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
2dos: ((DOIS or DHQ_synthase or ValA or salQ) and DegT_DnrJ_EryC1 and (LipV or ADSI-DH or cds(ADH_N and ADH_zinc_N)))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

KBX06_RS25680: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

KBX06_RS25725: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

KBX06_RS25770: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

KBX06_RS25790: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase methyltransferase

KBX06_RS25720: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

KBX06_RS25775: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase hydrolase protease

KBX06_RS25645: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

KBX06_RS25730: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

KBX06_RS25780: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: decarboxylase

KBX06_RS25675: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: ligase synthase

KBX06_RS25735: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS25740: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS25745: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

KBX06_RS25755: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

KBX06_RS25765: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

KBX06_RS25785: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	2.12	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	2.03	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	1.99	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.96	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	1.93	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	1.90	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	1.88	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	1.84	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	1.76	NRPS	AbT1	Aureobasidium pullulans
BGC0001135.5	1.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.77	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002305.2	0.74	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.53 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.56 out of 30.11

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

Additional weak hits (14):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.42 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.93 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.98 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.36 out of 21.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.84 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.10 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.50 out of 31.73

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.69 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.56 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.30 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.30 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.25 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.56 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 67757:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Ile - X) + (AHBA - ccmal - Me-redmal) + (ccmal) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 1384 - 67757:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Ile - X) + (AHBA - ccmal - Me-redmal) + (ccmal) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KBX06_RS25735: X

AMP-binding (228..617): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWMCFDVALGETFCTLAGELNAYGPAEASVACTW
Nearest Stachelhaus code(s):: Gly DVGYLIAVAK (59% 8Å match); Hty DLGFTGAVCK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

KBX06_RS25740: X

AMP-binding (228..617): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWMCFDVALGETFCTLAGELNAYGPAEASVACTW
Nearest Stachelhaus code(s):: Gly DVGYLIAVAK (59% 8Å match); Hty DLGFTGAVCK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

KBX06_RS25745: Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (225..614): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWMAFDAAFGEAFGIFGGEVNAYGPAEIAVACTW
Nearest Stachelhaus code(s):: Ile DAGFIGAVFK (50% 8Å match)
Stachelhaus code match:: 90% (moderate)

KBX06_RS25765: AHBA - mal - mmal

CAL_domain (35..442): AHBA

minowa: AHBA

Prediction, score:

AHBA: 388.5
shikimic_acid: 263.0
Acetyl-CoA: 8.6
fatty_acid: 0.0
NH2: 0.0

PKS_AT (1668..1966): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.0
inactive: 117.3
Methoxymalonyl-CoA: 57.9
Methylmalonyl-CoA: 41.9
Propionyl-CoA: 31.3
Acetyl-CoA: 21.5
Ethylmalonyl-CoA: 19.2
2-Methylbutyryl-CoA: 17.5
Benzoyl-CoA: 13.6
Isobutyryl-CoA: 10.8
fatty_acid: 7.9
trans-1,2-CPDA: 7.4
CHC-CoA: 2.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (3397..3693): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 223.1
Ethylmalonyl-CoA: 214.4
Methoxymalonyl-CoA: 183.3
2-Methylbutyryl-CoA: 149.6
trans-1,2-CPDA: 130.1
Malonyl-CoA: 126.0
Propionyl-CoA: 107.7
CHC-CoA: 98.5
Isobutyryl-CoA: 84.0
Benzoyl-CoA: 70.5
Acetyl-CoA: 66.4
inactive: 42.3
fatty_acid: 37.8
3-Methylbutyryl-CoA: 19.4

KBX06_RS25785: mal

PKS_AT (589..888): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 204.7
inactive: 101.1
Methoxymalonyl-CoA: 54.0
Methylmalonyl-CoA: 44.3
Propionyl-CoA: 29.5
Acetyl-CoA: 25.1
fatty_acid: 21.8
Ethylmalonyl-CoA: 19.1
Isobutyryl-CoA: 17.8
Benzoyl-CoA: 12.8
CHC-CoA: 7.9
trans-1,2-CPDA: 7.6
2-Methylbutyryl-CoA: 1.2
3-Methylbutyryl-CoA: 0.0

KBX06_RS25790: mal

PKS_AT (567..860): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 202.7
inactive: 103.2
Methoxymalonyl-CoA: 76.6
Methylmalonyl-CoA: 73.8
Isobutyryl-CoA: 43.8
Ethylmalonyl-CoA: 34.3
Propionyl-CoA: 31.1
Benzoyl-CoA: 28.5
Acetyl-CoA: 23.8
CHC-CoA: 20.2
2-Methylbutyryl-CoA: 20.1
3-Methylbutyryl-CoA: 15.3
trans-1,2-CPDA: 8.9
fatty_acid: 8.7

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor

NZ_JAGPXN010000028.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 6,445 - 52,267 nt. (total: 45,823 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

KBX06_RS25840: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

KBX06_RS25910: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

KBX06_RS25920: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

KBX06_RS25925: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

KBX06_RS25985: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: glycosyltransferase

KBX06_RS25820: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Lyases: dehydratase

KBX06_RS25880: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.66	PKS	esperamicin	Actinomadura verrucosospora
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000107.3	0.56	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002192.3	0.55	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.55	PKS	ACT-Toxin II	Alternaria alternata
BGC0002043.3	0.55	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0001164.3	0.54	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000660.5	0.52	terpene	albaflavenone	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.66	PKS	esperamicin	Actinomadura verrucosospora
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000107.3	0.56	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002192.3	0.55	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.55	PKS	ACT-Toxin II	Alternaria alternata
BGC0002043.3	0.55	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0001164.3	0.54	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000660.5	0.52	terpene	albaflavenone	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (14):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.07 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.45 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.20 out of 32.74

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.93 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.06 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.54 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.68 out of 29.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.34 out of 35.63

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.19 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.16 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

KBX06_RS25910: mal

PKS_AT (617..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 81.1
Methoxymalonyl-CoA: 55.4
Methylmalonyl-CoA: 48.1
inactive: 40.9
Isobutyryl-CoA: 31.7
Ethylmalonyl-CoA: 25.7
Propionyl-CoA: 21.1
Benzoyl-CoA: 15.5
fatty_acid: 14.7
Acetyl-CoA: 8.5
2-Methylbutyryl-CoA: 7.2
trans-1,2-CPDA: 6.7
3-Methylbutyryl-CoA: 5.5
CHC-CoA: 5.3

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_JAGPXN010000003.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 142,591 - 163,673 nt. (total: 21,083 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KBX06_RS07340: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Ligases: synthetase

KBX06_RS07320: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.45	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.44	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.43	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001456.3	0.43	terpene	isorenieratene	Streptomyces argillaceus
BGC0000645.3	0.42	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000648.3	0.40	terpene	carotenoid	Myxococcus xanthus
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.45	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.44	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.43	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001456.3	0.43	terpene	isorenieratene	Streptomyces argillaceus
BGC0000645.3	0.42	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000648.3	0.40	terpene	carotenoid	Myxococcus xanthus
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

KBX06_RS07320: PT_FPPS_like

Domain 1 (44 - 352): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.98 out of 26.85

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 24.31 out of 29.65

Confidence: medium

Additional weak hits (10):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.23 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.77 out of 21.55

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.41 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.25 out of 33.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.63 out of 29.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.93 out of 27.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.70 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.82 out of 24.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.59 out of 39.62

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
LexA variant 1	Repressor of DNA damage response
RutR	Regulator of the pyrimidine and purine metabolism

NZ_JAGPXN010000003.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 223,351 - 244,304 nt. (total: 20,954 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KBX06_RS07670: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase

KBX06_RS07690: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: cyclase

KBX06_RS07700: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

KBX06_RS07695: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.49	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002687.2	0.41	NRPS, PKS	Massiliachelin	Massilia sp. NR 4-1
BGC0002496.3	0.41	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001779.5	0.41	ribosomal	siamycin	Streptomyces nodosus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.49	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002687.2	0.41	NRPS, PKS	Massiliachelin	Massilia sp. NR 4-1
BGC0002496.3	0.41	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001779.5	0.41	ribosomal	siamycin	Streptomyces nodosus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

KBX06_RS07700: T1TS

Domain 1 (3 - 316): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 17.94 out of 23.79

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.62 out of 36.53

Confidence: medium

Additional weak hits (2):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.53 out of 29.38

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.45 out of 23.43

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism

NZ_JAGPXN010000032.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 32,011 nt. (total: 32,011 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KBX06_RS26610: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

KBX06_RS26615: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0000041.3	0.59	PKS	oronofacic acid	Pseudomonas syringae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0000041.3	0.59	PKS	oronofacic acid	Pseudomonas syringae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.33 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 32011:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (redmal - pk - ccmal - ohmal) + (ohmal)
Non-colinear ordering:: KBX06_RS26615 + KBX06_RS26610

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KBX06_RS26610: mal - mal

PKS_AT (572..875): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 220.2
inactive: 112.9
Methoxymalonyl-CoA: 62.2
Methylmalonyl-CoA: 57.8
Propionyl-CoA: 34.2
Benzoyl-CoA: 28.9
Ethylmalonyl-CoA: 27.7
2-Methylbutyryl-CoA: 25.3
Isobutyryl-CoA: 24.0
Acetyl-CoA: 18.3
fatty_acid: 14.3
CHC-CoA: 13.0
trans-1,2-CPDA: 10.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (2125..2424): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.4
inactive: 107.2
Methoxymalonyl-CoA: 64.7
Methylmalonyl-CoA: 56.0
Propionyl-CoA: 33.4
Isobutyryl-CoA: 25.1
Acetyl-CoA: 24.4
Ethylmalonyl-CoA: 23.2
2-Methylbutyryl-CoA: 16.8
Benzoyl-CoA: 15.4
fatty_acid: 10.6
CHC-CoA: 8.3
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

KBX06_RS26615: mal - pk - mal - mal

PKS_AT (572..869): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.8
inactive: 104.8
Methoxymalonyl-CoA: 64.2
Methylmalonyl-CoA: 56.0
Propionyl-CoA: 38.2
Ethylmalonyl-CoA: 27.3
Isobutyryl-CoA: 24.0
Benzoyl-CoA: 20.2
2-Methylbutyryl-CoA: 16.4
Acetyl-CoA: 16.3
fatty_acid: 10.7
CHC-CoA: 8.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2643..2940): pk

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 204.7
Methylmalonyl-CoA: 199.5
Methoxymalonyl-CoA: 163.3
2-Methylbutyryl-CoA: 134.2
trans-1,2-CPDA: 117.8
Propionyl-CoA: 109.3
CHC-CoA: 101.8
Malonyl-CoA: 98.6
Isobutyryl-CoA: 88.3
Benzoyl-CoA: 67.8
Acetyl-CoA: 45.7
3-Methylbutyryl-CoA: 36.4
fatty_acid: 23.4
inactive: 21.0

PKS_AT (4714..5016): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 221.8
inactive: 109.1
Methoxymalonyl-CoA: 63.5
Methylmalonyl-CoA: 58.4
Propionyl-CoA: 38.6
Isobutyryl-CoA: 28.9
Ethylmalonyl-CoA: 21.3
Acetyl-CoA: 17.0
Benzoyl-CoA: 15.3
2-Methylbutyryl-CoA: 14.2
fatty_acid: 11.9
CHC-CoA: 7.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (6465..6764): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.7
inactive: 111.5
Methoxymalonyl-CoA: 70.4
Methylmalonyl-CoA: 58.5
Propionyl-CoA: 34.1
Isobutyryl-CoA: 31.3
Ethylmalonyl-CoA: 28.8
Acetyl-CoA: 26.1
Benzoyl-CoA: 20.6
2-Methylbutyryl-CoA: 18.1
fatty_acid: 10.7
CHC-CoA: 5.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_JAGPXN010000038.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 15,081 nt. (total: 15,081 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

KBX06_RS27035: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000353.5	0.53	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000112.5	0.51	PKS	neocarzinostatin	Streptomyces carzinostaticus subsp. neocarzinostaticus
BGC0000043.5	0.50	PKS	curacin A	Moorea producens 19L
BGC0000122.5	0.50	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000041.3	0.47	PKS	oronofacic acid	Pseudomonas syringae
BGC0001544.3	0.46	NRPS, PKS	chlorflavonin	Aspergillus campestris IBT 28561
BGC0001298.4	0.45	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus
BGC0001235.4	0.44	NRPS, PKS	antalid	Polyangium spumosum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000353.5	0.53	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000112.5	0.51	PKS	neocarzinostatin	Streptomyces carzinostaticus subsp. neocarzinostaticus
BGC0000043.5	0.50	PKS	curacin A	Moorea producens 19L
BGC0000122.5	0.50	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000041.3	0.47	PKS	oronofacic acid	Pseudomonas syringae
BGC0001544.3	0.46	NRPS, PKS	chlorflavonin	Aspergillus campestris IBT 28561
BGC0001298.4	0.45	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus
BGC0001235.4	0.44	NRPS, PKS	antalid	Polyangium spumosum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 15081:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KBX06_RS27035: mal - mal

PKS_AT (1496..1791): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 218.6
inactive: 110.9
Methoxymalonyl-CoA: 66.8
Methylmalonyl-CoA: 59.7
Propionyl-CoA: 36.1
Isobutyryl-CoA: 28.9
Acetyl-CoA: 27.6
2-Methylbutyryl-CoA: 14.5
fatty_acid: 11.3
CHC-CoA: 8.2
Benzoyl-CoA: 0.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -3.4

PKS_AT (3238..3536): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.4
inactive: 107.2
Methoxymalonyl-CoA: 64.7
Methylmalonyl-CoA: 56.0
Propionyl-CoA: 33.4
Isobutyryl-CoA: 25.1
Acetyl-CoA: 24.4
Ethylmalonyl-CoA: 23.2
2-Methylbutyryl-CoA: 16.8
Benzoyl-CoA: 15.4
fatty_acid: 10.6
CHC-CoA: 8.3
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

NZ_JAGPXN010000004.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 108,516 nt. (total: 108,516 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase acetyltransferase glycosyltransferase

KBX06_RS07965: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

KBX06_RS08000: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

KBX06_RS08025: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: hydrolase

KBX06_RS08035: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: ligase synthase

KBX06_RS07945: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

KBX06_RS07950: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

KBX06_RS07955: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

KBX06_RS07960: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

KBX06_RS07970: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

KBX06_RS07975: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

KBX06_RS07980: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

KBX06_RS08015: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS08030: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS28325: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000018.5	0.69	PKS	angolamycin	Streptomyces eurythermus
BGC0002520.2	0.68	PKS	quinolidomicin A	Micromonospora sp.
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002175.3	0.64	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000018.5	0.69	PKS	angolamycin	Streptomyces eurythermus
BGC0002520.2	0.68	PKS	quinolidomicin A	Micromonospora sp.
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002175.3	0.64	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (39):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.49 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.32 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.62 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.94 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.51 out of 21.55

Confidence: weak

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 17.94 out of 23.05

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.58 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 11.98 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.10 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.85 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.36 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.36 out of 26.85

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.09 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.36 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.89 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.53 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.17 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.38 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.93 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.79 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.29 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.76 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.15 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.98 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.55 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.15 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.66 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.27 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.36 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.66 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.05 out of 19.26

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.67 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 14.55 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.59 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.96 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.78 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.90 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.38 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 108516:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal) + (ohmal) + (ccmal - Me-ohmal - ohmal) + (ohmal - Me-redmal) + (ohmal - Me-ohmal - Me-ohmal) + (ccmal - Me-ccmal) + (Me-ohmal) + (Me-ohmal - ohmal) + (ohmal)
Non-colinear ordering:: KBX06_RS07945 + KBX06_RS07950 + KBX06_RS07955 + KBX06_RS07960 + KBX06_RS07965 + KBX06_RS07970 + KBX06_RS07975 + KBX06_RS07980 + KBX06_RS28325

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

KBX06_RS07945: mal

PKS_AT (1274..1573): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 222.1
inactive: 110.4
Methoxymalonyl-CoA: 66.0
Methylmalonyl-CoA: 54.3
Propionyl-CoA: 36.0
Isobutyryl-CoA: 22.8
Acetyl-CoA: 18.6
2-Methylbutyryl-CoA: 18.6
Benzoyl-CoA: 17.2
trans-1,2-CPDA: 13.0
fatty_acid: 9.7
CHC-CoA: 9.7
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -2.5

KBX06_RS07950: mal

PKS_AT (587..890): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 212.7
inactive: 108.6
Methoxymalonyl-CoA: 68.2
Methylmalonyl-CoA: 51.3
Propionyl-CoA: 38.7
Ethylmalonyl-CoA: 21.1
Acetyl-CoA: 20.6
Isobutyryl-CoA: 20.0
Benzoyl-CoA: 14.8
2-Methylbutyryl-CoA: 14.1
CHC-CoA: 13.2
trans-1,2-CPDA: 11.5
fatty_acid: 10.9
3-Methylbutyryl-CoA: 0.0

KBX06_RS07955: mal - mmal - mal

PKS_AT (571..867): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 226.4
inactive: 112.5
Methoxymalonyl-CoA: 69.2
Methylmalonyl-CoA: 64.5
Ethylmalonyl-CoA: 36.3
Propionyl-CoA: 28.7
Isobutyryl-CoA: 25.7
Benzoyl-CoA: 21.4
fatty_acid: 16.3
Acetyl-CoA: 15.7
CHC-CoA: 15.6
2-Methylbutyryl-CoA: 9.1
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2349..2554): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 57.3
Methoxymalonyl-CoA: 50.5
Ethylmalonyl-CoA: 43.3
2-Methylbutyryl-CoA: 40.2
trans-1,2-CPDA: 37.2
CHC-CoA: 32.9
Propionyl-CoA: 30.6
Malonyl-CoA: 20.3
Isobutyryl-CoA: 20.2
Benzoyl-CoA: 9.4
Acetyl-CoA: 7.3
fatty_acid: 3.2
inactive: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3809..4102): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 209.9
inactive: 105.7
Methoxymalonyl-CoA: 60.1
Methylmalonyl-CoA: 49.0
Propionyl-CoA: 24.2
Benzoyl-CoA: 21.0
fatty_acid: 13.5
Acetyl-CoA: 13.3
Ethylmalonyl-CoA: 12.6
trans-1,2-CPDA: 11.9
Isobutyryl-CoA: 11.8
2-Methylbutyryl-CoA: 8.7
CHC-CoA: 3.7
3-Methylbutyryl-CoA: 0.0

KBX06_RS07960: mal - mmal

PKS_AT (563..870): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.0
inactive: 106.6
Methoxymalonyl-CoA: 54.8
Methylmalonyl-CoA: 48.9
Propionyl-CoA: 25.1
Isobutyryl-CoA: 21.1
Acetyl-CoA: 15.2
Benzoyl-CoA: 12.4
Ethylmalonyl-CoA: 7.2
fatty_acid: 6.2
CHC-CoA: 3.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (2119..2414): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 161.8
Methoxymalonyl-CoA: 137.9
Ethylmalonyl-CoA: 136.0
Propionyl-CoA: 111.7
2-Methylbutyryl-CoA: 106.8
trans-1,2-CPDA: 97.7
Malonyl-CoA: 94.5
CHC-CoA: 64.3
Isobutyryl-CoA: 42.5
Acetyl-CoA: 30.9
fatty_acid: 29.4
inactive: 28.8
Benzoyl-CoA: 23.7
3-Methylbutyryl-CoA: 21.8

KBX06_RS07965: mal - mmal - mmal

PKS_AT (571..861): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 218.6
inactive: 103.6
Methoxymalonyl-CoA: 68.4
Methylmalonyl-CoA: 56.0
Propionyl-CoA: 32.9
Isobutyryl-CoA: 23.7
Ethylmalonyl-CoA: 21.9
Acetyl-CoA: 19.9
Benzoyl-CoA: 18.5
2-Methylbutyryl-CoA: 11.6
fatty_acid: 10.7
CHC-CoA: 8.3
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2077..2377): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.2
Ethylmalonyl-CoA: 201.1
Methoxymalonyl-CoA: 169.8
2-Methylbutyryl-CoA: 120.2
trans-1,2-CPDA: 117.8
Propionyl-CoA: 101.9
Malonyl-CoA: 97.3
Isobutyryl-CoA: 77.0
CHC-CoA: 75.0
Benzoyl-CoA: 69.3
3-Methylbutyryl-CoA: 47.2
Acetyl-CoA: 44.9
inactive: 35.3
fatty_acid: 33.6

PKS_AT (3641..3936): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 161.8
Methoxymalonyl-CoA: 137.9
Ethylmalonyl-CoA: 136.0
Propionyl-CoA: 111.7
2-Methylbutyryl-CoA: 106.8
trans-1,2-CPDA: 97.7
Malonyl-CoA: 94.5
CHC-CoA: 64.3
Isobutyryl-CoA: 42.5
Acetyl-CoA: 30.9
fatty_acid: 29.4
inactive: 28.8
Benzoyl-CoA: 23.7
3-Methylbutyryl-CoA: 21.8

KBX06_RS07970: mal - mmal

PKS_AT (568..858): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.8
inactive: 110.6
Methoxymalonyl-CoA: 62.5
Methylmalonyl-CoA: 49.9
Propionyl-CoA: 33.3
Isobutyryl-CoA: 26.1
Benzoyl-CoA: 25.0
2-Methylbutyryl-CoA: 21.0
Ethylmalonyl-CoA: 19.9
Acetyl-CoA: 16.6
fatty_acid: 9.3
CHC-CoA: 8.0
trans-1,2-CPDA: 4.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (2347..2642): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 166.9
Ethylmalonyl-CoA: 141.4
Methoxymalonyl-CoA: 141.2
Propionyl-CoA: 118.0
2-Methylbutyryl-CoA: 116.6
trans-1,2-CPDA: 102.6
Malonyl-CoA: 98.4
CHC-CoA: 68.9
Isobutyryl-CoA: 58.0
fatty_acid: 34.3
Acetyl-CoA: 33.6
inactive: 28.6
3-Methylbutyryl-CoA: 27.2
Benzoyl-CoA: 25.5

KBX06_RS07975: mmal

PKS_AT (583..878): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 176.0
Methoxymalonyl-CoA: 149.7
Ethylmalonyl-CoA: 149.3
2-Methylbutyryl-CoA: 131.0
Propionyl-CoA: 122.0
Malonyl-CoA: 108.0
trans-1,2-CPDA: 101.3
CHC-CoA: 85.7
Isobutyryl-CoA: 61.0
fatty_acid: 45.8
3-Methylbutyryl-CoA: 44.2
Acetyl-CoA: 43.9
inactive: 35.8
Benzoyl-CoA: 33.4

KBX06_RS07980: mmal - mal

PKS_AT (570..865): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 168.6
Methoxymalonyl-CoA: 143.9
Ethylmalonyl-CoA: 141.1
2-Methylbutyryl-CoA: 120.3
Propionyl-CoA: 111.3
Malonyl-CoA: 97.3
trans-1,2-CPDA: 88.6
CHC-CoA: 69.7
Isobutyryl-CoA: 49.7
fatty_acid: 37.7
Acetyl-CoA: 35.1
Benzoyl-CoA: 30.0
3-Methylbutyryl-CoA: 30.0
inactive: 28.4

PKS_AT (2078..2383): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 195.3
inactive: 86.5
Methoxymalonyl-CoA: 84.0
Methylmalonyl-CoA: 79.5
Isobutyryl-CoA: 53.6
Propionyl-CoA: 46.1
Ethylmalonyl-CoA: 44.7
Acetyl-CoA: 33.9
CHC-CoA: 26.5
2-Methylbutyryl-CoA: 24.7
trans-1,2-CPDA: 19.0
fatty_acid: 15.2
Benzoyl-CoA: 12.9
3-Methylbutyryl-CoA: 8.7

KBX06_RS28325: mal

PKS_AT (570..866): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.0
inactive: 107.8
Methoxymalonyl-CoA: 61.3
Methylmalonyl-CoA: 49.1
Propionyl-CoA: 30.4
Acetyl-CoA: 25.7
Ethylmalonyl-CoA: 22.4
Benzoyl-CoA: 19.1
CHC-CoA: 17.8
2-Methylbutyryl-CoA: 17.0
Isobutyryl-CoA: 15.1
trans-1,2-CPDA: 10.0
fatty_acid: 8.8
3-Methylbutyryl-CoA: 0.0

KBX06_RS08015: X

AMP-binding (27..361): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLLTYGLVVG-GYLISADAVQAYGTTETLIALTG
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

KBX06_RS08030: X

AMP-binding (12..378): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: CGLH---LVLGGFGVSGSAVERYGMTETLITVST
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
MexT	Global virulence regulator

NZ_JAGPXN010000041.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1 - 9,315 nt. (total: 9,315 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

KBX06_RS27140: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

KBX06_RS27145: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.50	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.46	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000514.5	0.37	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0002120.3	0.37	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000796.3	0.25	saccharide	S-layer glycan	Paenibacillus alvei

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.50	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.46	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000514.5	0.37	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0002120.3	0.37	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000796.3	0.25	saccharide	S-layer glycan	Paenibacillus alvei

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.88 out of 30.25

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 148 - 241; Score: 66.7

TFBS definitions

Regulator	Description

NZ_JAGPXN010000046.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 5,813 nt. (total: 5,813 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

KBX06_RS27270: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002171.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002749.2	0.52	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000043.5	0.50	PKS	curacin A	Moorea producens 19L
BGC0000013.3	0.50	PKS	alternariol	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002171.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002749.2	0.52	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000043.5	0.50	PKS	curacin A	Moorea producens 19L
BGC0000013.3	0.50	PKS	alternariol	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

KBX06_RS27270: mal

PKS_AT (1335..1630): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 205.2
inactive: 96.5
Methoxymalonyl-CoA: 52.7
Methylmalonyl-CoA: 39.5
Propionyl-CoA: 26.7
fatty_acid: 21.0
Acetyl-CoA: 19.3
Ethylmalonyl-CoA: 17.1
Benzoyl-CoA: 13.1
Isobutyryl-CoA: 10.7
CHC-CoA: 7.5
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

NZ_JAGPXN010000005.1 - Region 1 - RiPP-like,terpene

Download region GenBank file

Download region SVG

Location: 166,902 - 192,576 nt. (total: 25,675 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

KBX06_RS09615: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

KBX06_RS09665: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

KBX06_RS09635: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: hydratase

KBX06_RS09640: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

KBX06_RS09680: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001007.5	0.31	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001006.5	0.28	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0000894.4	0.24	other (other)	citrinin	Monascus aurantiacus
BGC0001910.4	0.20	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.20	terpene	raimonol	Streptomyces anulatus
BGC0002425.3	0.20	ribosomal	stlassin	Streptomyces sp.
BGC0002805.2	0.18	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0000188.5	0.18	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0002697.3	0.18	NRPS, PKS	clipibicyclene, azabicyclene B, azabicyclene C, azabicyclene D	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001197.5	0.17	PKS	frankiamicin	Frankia sp. EAN1pec

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001910.4	0.53	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.53	terpene	raimonol	Streptomyces anulatus
BGC0001197.5	0.49	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001483.4	0.47	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001006.5	0.46	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0001007.5	0.46	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001605.3	0.44	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000286.3	0.44	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0002013.4	0.43	ribosomal	curacozole	Streptomyces curacoi
BGC0002825.2	0.42	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

KBX06_RS09605: T2TS

Domain 1 (24 - 523): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.03 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.43 out of 26.85

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_JAGPXN010000058.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 1,425 nt. (total: 1,425 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

KBX06_RS27415: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.56	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002171.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002749.2	0.46	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000353.5	0.44	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000041.3	0.44	PKS	oronofacic acid	Pseudomonas syringae
BGC0000043.5	0.44	PKS	curacin A	Moorea producens 19L
BGC0000122.5	0.44	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0001606.3	0.42	PKS	gibepyrone-A	Fusarium fujikuroi IMI 58289

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.56	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002171.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002749.2	0.46	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000353.5	0.44	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000041.3	0.44	PKS	oronofacic acid	Pseudomonas syringae
BGC0000043.5	0.44	PKS	curacin A	Moorea producens 19L
BGC0000122.5	0.44	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0001606.3	0.42	PKS	gibepyrone-A	Fusarium fujikuroi IMI 58289

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

KBX06_RS27415: mal

PKS_AT (272..474): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 131.0
inactive: 56.9
Methoxymalonyl-CoA: 40.1
Methylmalonyl-CoA: 30.5
Acetyl-CoA: 18.1
fatty_acid: 13.0
Propionyl-CoA: 13.0
Ethylmalonyl-CoA: 12.5
Benzoyl-CoA: 11.7
Isobutyryl-CoA: 9.9
CHC-CoA: 8.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

NZ_JAGPXN010000009.1 - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 98,619 - 171,137 nt. (total: 72,519 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

KBX06_RS14385: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

KBX06_RS14570: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

KBX06_RS14600: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: PPTase aminotransferase carboxylase glycosyltransferase kinase transferase

KBX06_RS14360: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

KBX06_RS14370: aminotransferase

smcogs: SMCOG1019: aminotransferase

KBX06_RS14490: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

KBX06_RS14525: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

KBX06_RS14535: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

KBX06_RS14610: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase protease

KBX06_RS14340: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

KBX06_RS14380: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: cyclase

KBX06_RS14520: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

KBX06_RS14540: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

KBX06_RS14550: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Ligases: ligase synthase

KBX06_RS14395: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS14435: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

KBX06_RS14460: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

KBX06_RS14465: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS14475: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

KBX06_RS14495: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

KBX06_RS14505: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

KBX06_RS14510: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.60	PKS	spore pigment	Streptomyces avermitilis
BGC0000234.5	0.59	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000261.5	0.59	PKS	R1128	Streptomyces sp. R1128
BGC0001513.3	0.59	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000215.5	0.57	PKS	curamycin	Streptomyces cyaneus
BGC0000275.4	0.57	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0001197.5	0.56	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001512.5	0.55	PKS	BE-24566B	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.60	PKS	spore pigment	Streptomyces avermitilis
BGC0000234.5	0.59	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000261.5	0.59	PKS	R1128	Streptomyces sp. R1128
BGC0001513.3	0.59	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000215.5	0.57	PKS	curamycin	Streptomyces cyaneus
BGC0000275.4	0.57	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0001197.5	0.56	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001512.5	0.55	PKS	BE-24566B	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 26.06 out of 30.22

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (25):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.37 out of 30.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.13 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.56 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 14.79 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.96 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 15.94 out of 26.12

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 19.88 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 11.89 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.84 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.18 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.74 out of 26.33

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 18.83 out of 27.04

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.61 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.62 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 25.75

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.04 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.39 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.19 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.70 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.18 out of 27.04

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

KBX06_RS14395: X

AMP-binding (21..415): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGFS--LASGQTFLNVGAGRIVYGLSEAVVVTAL
Nearest Stachelhaus code(s):: Hph or Hty DLGFTGCVNK (41% 8Å match); Hty DLGFTGCVTK (38% 8Å match); 3Me-Glu or Glu DLGKTGVVNK (26% 8Å match)
Stachelhaus code match:: 60% (weak)

KBX06_RS14465: X

AMP-binding (47..432): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AHLLHTATVLMQFGFNTGD-----------VVTR
Nearest Stachelhaus code(s):: Trp GALFFAAGVK (21% 8Å match)
Stachelhaus code match:: 60% (weak)

KBX06_RS14495: X

AMP-binding (38..372): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ERYPLGLVGGLGLGTTGGEGNMYGMTEVGVIGTD
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 98618 to 171137
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)

KBX06_RS14460: CLF (Score: 255.9; E-value: 1.4e-78)
KBX06_RS14505: CLF (Score: 486.5; E-value: 1.3e-148)
KBX06_RS14510: KS (Score: 700.4; E-value: 1.7e-213)
KBX06_RS14515: CYC C5-C18 (Score: 207.3; E-value: 1.5e-64)
KBX06_RS14520: CYC C9-C14 (Score: 246.1; E-value: 2.4e-76)
KBX06_RS14540: CYC C4-C21/C2-C23|C2-C19 (Score: 126.9; E-value: 6.8e-40)
KBX06_RS14550: CYC C4-C21/C2-C23|C2-C19 (Score: 121.2; E-value: 3.9e-38)
KBX06_RS14555: OXY (Score: 23.2; E-value: 7.2e-08)
KBX06_RS14610: GT (Score: 119.0; E-value: 7.4e-37)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
ClgR	Caseinolytic protease gene regulator