GCF_017599305.1 - 35 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JAGFWR010000001.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	terpene	531,633	553,763	Low	isorenieratene	terpene
Region 1.2	PKS-like,indole	563,255	620,051	Low	paulomycin	other:other
Region 1.3	terpene	663,073	684,032
Region 1.4	NRPS	819,124	862,576
Region 1.5	lanthipeptide-class-i	1,004,925	1,029,536
Region 1.6	NRPS-like	1,045,846	1,073,671

NZ_JAGFWR010000011.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	NAGGN	18,760	33,554

NZ_JAGFWR010000013.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	terpene-precursor,NRPS-like	14,593	68,146	Low	CDA1b/CDA2a/CDA2b/CDA3a/CDA3b/CDA4a/CDA4b	NRPS:Type I

NZ_JAGFWR010000015.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	T1PKS,oligosaccharide,terpene,RRE-containing	1	144,374	High	lobosamide A/lobosamide B/lobosamide C	PKS

NZ_JAGFWR010000016.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	RiPP-like	8,526	19,344	Low	lymphostin/neolymphostinol B/lymphostinol/neolymphostin B	NRPS:Type I+PKS

NZ_JAGFWR010000002.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	terpene	1	18,999
Region 12.2	NI-siderophore	199,979	229,763	Low	FW0622	other:other
Region 12.3	RRE-containing	531,114	552,217
Region 12.4	NRPS,T1PKS,NRPS-like	641,400	707,075

NZ_JAGFWR010000021.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	terpene	17,719	38,756
Region 14.2	terpene-precursor	100,082	111,393

NZ_JAGFWR010000023.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	NRPS,PKS-like	1	34,081

NZ_JAGFWR010000028.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	NRPS	1	39,654

NZ_JAGFWR010000003.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	T2PKS	1	66,577	Low	frankiamicin	PKS
Region 23.2	T1PKS	162,363	246,912	Low	maduropeptin	PKS:Iterative type I
Region 23.3	NRPS,T1PKS	393,108	471,893

NZ_JAGFWR010000032.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	PKS-like,T1PKS	1	47,327

NZ_JAGFWR010000037.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 31.1	lanthipeptide-class-iii	1	18,736	High	SapB	ribosomal:RiPP:Lanthipeptide

NZ_JAGFWR010000004.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 34.1	linaridin	38,634	59,200	Low	legonaridin	ribosomal:RiPP
Region 34.2	PKS-like,NRPS,T1PKS	73,219	131,330	Low	rustmicin	PKS:Iterative type I
Region 34.3	NRPS,T1PKS,lanthipeptide-class-ii	364,796	403,823	Low	microsclerodermin M	NRPS:Type I+PKS:Type I

NZ_JAGFWR010000040.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 35.1	phenazine	18,426	29,488	Low	diastaphenazine/izumiphenazine C	other:other

NZ_JAGFWR010000046.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 41.1	T1PKS	1	9,182

NZ_JAGFWR010000047.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 42.1	NRPS-like	1	9,108	Low	indigoidine	saccharide

NZ_JAGFWR010000048.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 43.1	PKS-like,T1PKS	1	7,478

NZ_JAGFWR010000005.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 45.1	RiPP-like	237,763	249,697

NZ_JAGFWR010000054.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 50.1	T1PKS	1	2,984

NZ_JAGFWR010000006.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 56.1	T1PKS	80,116	161,865	Low	akaeolide	PKS
Region 56.2	NRPS	294,922	329,931

NZ_JAGFWR010000007.1 (Micromonospora antibiotica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 64.1	T3PKS	119,211	160,272	High	loseolamycin A1/loseolamycin A2	PKS

No secondary metabolite regions were found in these records:: NZ_JAGFWR010000010.1 (Micromonospora antibiotica); NZ_JAGFWR010000012.1 (Micromonospora antibiotica); NZ_JAGFWR010000014.1 (Micromonospora antibiotica); NZ_JAGFWR010000017.1 (Micromonospora antibiotica); NZ_JAGFWR010000018.1 (Micromonospora antibiotica); NZ_JAGFWR010000019.1 (Micromonospora antibiotica); NZ_JAGFWR010000020.1 (Micromonospora antibiotica); NZ_JAGFWR010000022.1 (Micromonospora antibiotica); NZ_JAGFWR010000024.1 (Micromonospora antibiotica); NZ_JAGFWR010000025.1 (Micromonospora antibiotica); NZ_JAGFWR010000026.1 (Micromonospora antibiotica); NZ_JAGFWR010000027.1 (Micromonospora antibiotica); NZ_JAGFWR010000029.1 (Micromonospora antibiotica); NZ_JAGFWR010000030.1 (Micromonospora antibiotica); NZ_JAGFWR010000031.1 (Micromonospora antibiotica); NZ_JAGFWR010000033.1 (Micromonospora antibiotica); NZ_JAGFWR010000034.1 (Micromonospora antibiotica); NZ_JAGFWR010000035.1 (Micromonospora antibiotica); NZ_JAGFWR010000036.1 (Micromonospora antibiotica); NZ_JAGFWR010000038.1 (Micromonospora antibiotica); NZ_JAGFWR010000039.1 (Micromonospora antibiotica); NZ_JAGFWR010000041.1 (Micromonospora antibiotica); NZ_JAGFWR010000042.1 (Micromonospora antibiotica); NZ_JAGFWR010000043.1 (Micromonospora antibiotica); NZ_JAGFWR010000044.1 (Micromonospora antibiotica); NZ_JAGFWR010000045.1 (Micromonospora antibiotica); NZ_JAGFWR010000049.1 (Micromonospora antibiotica); NZ_JAGFWR010000050.1 (Micromonospora antibiotica); NZ_JAGFWR010000051.1 (Micromonospora antibiotica); NZ_JAGFWR010000052.1 (Micromonospora antibiotica); NZ_JAGFWR010000053.1 (Micromonospora antibiotica); NZ_JAGFWR010000055.1 (Micromonospora antibiotica); NZ_JAGFWR010000056.1 (Micromonospora antibiotica); NZ_JAGFWR010000057.1 (Micromonospora antibiotica); NZ_JAGFWR010000058.1 (Micromonospora antibiotica); NZ_JAGFWR010000059.1 (Micromonospora antibiotica); NZ_JAGFWR010000060.1 (Micromonospora antibiotica); NZ_JAGFWR010000061.1 (Micromonospora antibiotica); NZ_JAGFWR010000062.1 (Micromonospora antibiotica); NZ_JAGFWR010000063.1 (Micromonospora antibiotica); NZ_JAGFWR010000064.1 (Micromonospora antibiotica); NZ_JAGFWR010000065.1 (Micromonospora antibiotica); NZ_JAGFWR010000066.1 (Micromonospora antibiotica); NZ_JAGFWR010000008.1 (Micromonospora antibiotica); NZ_JAGFWR010000009.1 (Micromonospora antibiotica)

Compact view

NZ_JAGFWR010000001.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 531,633 - 553,763 nt. (total: 22,131 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

JQN83_RS02555: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

JQN83_RS02575: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Hydrolases: deacetylase

JQN83_RS02540: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Lyases: hydratase

JQN83_RS02495: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

JQN83_RS02580: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: synthetase

JQN83_RS02560: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.55	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.52	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.52	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.52	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.52	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000648.3	0.49	terpene	carotenoid	Myxococcus xanthus
BGC0000645.3	0.47	terpene	carotenoid	Halobacillus halophilus DSM 2266

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.55	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.52	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.52	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.52	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.52	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000648.3	0.49	terpene	carotenoid	Myxococcus xanthus
BGC0000645.3	0.47	terpene	carotenoid	Halobacillus halophilus DSM 2266

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

JQN83_RS02560: PT_FPPS_like

Domain 1 (68 - 376): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

JQN83_RS02565: PT_phytoene_like

Domain 1 (5 - 290): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.54 out of 18.46

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (8):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.21 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.06 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.87 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.45 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.24 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.96 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.75 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
MexT	Global virulence regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JAGFWR010000001.1 - Region 2 - PKS-like,indole

Download region GenBank file

Download region SVG

Location: 563,255 - 620,051 nt. (total: 56,797 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)
indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

JQN83_RS02735: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

JQN83_RS02765: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

JQN83_RS02805: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JQN83_RS02820: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acyltransferase aminotransferase glycosyltransferase transferase

JQN83_RS02725: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

JQN83_RS02795: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

JQN83_RS02810: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

JQN83_RS02815: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase

JQN83_RS02825: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: dehydratase

JQN83_RS02915: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: isomerase

JQN83_RS02830: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

JQN83_RS02755: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQN83_RS02770: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002073.3	0.41	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002476.2	0.34	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0001870.3	0.28	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0002531.3	0.28	NRPS	cepaciachelin	Burkholderia ambifaria AMMD
BGC0002150.2	0.27	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.27	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002415.2	0.27	NRPS	vanchrobactin, trivanchrobactin, divanchrobactin	Vibrio campbellii
BGC0000947.5	0.27	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002685.2	0.27	NRPS	enterobactin	Rothia mucilaginosa ATCC 25296
BGC0002494.3	0.26	NRPS	vibriobactin	Vibrio cholerae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002493.3	0.60	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0002474.2	0.58	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0002073.3	0.58	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002476.2	0.55	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0001444.5	0.54	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0001294.5	0.54	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000451.5	0.52	NRPS	turnerbactin	Teredinibacter turnerae T7901
BGC0001850.4	0.50	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001302.5	0.49	other (other)	lomofungin	Streptomyces lomondensis
BGC0000410.5	0.49	NRPS	pseudomonine	Pseudomonas fluorescens

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.55 out of 23.43

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.57 out of 36.53

Confidence: medium

Additional weak hits (37):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.59 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.59 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.67 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.31 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.30 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.71 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.16 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.52 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.35 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.20 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.20 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.85 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.29 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 19.76 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.44 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.61 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.15 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.79 out of 28.14

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.28 out of 36.54

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.85 out of 26.12

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 24.97 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.82 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.77 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.17 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.19 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.37 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.70 out of 36.54

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.68 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.78 out of 31.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.45 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.04 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.04 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.03 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.52 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.88 out of 30.98

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

JQN83_RS02755: X

AMP-binding (6..376): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ANWANGAFNTSSVGISSAARNYFGAAEAGPLTFA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAGFWR010000001.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 663,073 - 684,032 nt. (total: 20,960 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: dehalogenase

JQN83_RS03165: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: cyclase

JQN83_RS03180: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

JQN83_RS03200: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.51	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001592.5	0.46	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000889.5	0.45	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0002690.2	0.37	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0001810.3	0.37	PKS	trehangelin	Polymorphospora rubra
BGC0001782.3	0.37	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0000682.3	0.34	terpene	terretonin	Aspergillus terreus NIH2624
BGC0000806.5	0.34	saccharide	phosphonoglycans	Glycomyces sp. NRRL B-16210
BGC0001708.3	0.32	PKS, terpene	novofumigatonin	Aspergillus novofumigatus IBT 16806
BGC0000207.5	0.32	PKS	chartreusin	Streptomyces chartreusis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.51	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001592.5	0.46	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000889.5	0.45	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0002690.2	0.37	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0001810.3	0.37	PKS	trehangelin	Polymorphospora rubra
BGC0001782.3	0.37	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0000682.3	0.34	terpene	terretonin	Aspergillus terreus NIH2624
BGC0000806.5	0.34	saccharide	phosphonoglycans	Glycomyces sp. NRRL B-16210
BGC0001708.3	0.32	PKS, terpene	novofumigatonin	Aspergillus novofumigatus IBT 16806
BGC0000207.5	0.32	PKS	chartreusin	Streptomyces chartreusis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

JQN83_RS03180: T1TS

Domain 1 (10 - 315): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (10):

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.13 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.62 out of 29.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.39 out of 25.88

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.03 out of 23.43

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.24 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.16 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.99 out of 36.53

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.37 out of 27.04

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.75 out of 29.65

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.60 out of 27.18

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

NZ_JAGFWR010000001.1 - Region 4 - NRPS

Download region GenBank file

Download region SVG

Location: 819,124 - 862,576 nt. (total: 43,453 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JQN83_RS03880: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

JQN83_RS03885: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: kinase

JQN83_RS03855: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: hydrolase

JQN83_RS03890: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: ligase

JQN83_RS03875: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 26.06 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.69 out of 30.11

Confidence: medium

Additional weak hits (9):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.23 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.11 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.65 out of 32.93

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.88 out of 25.88

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.99 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.03 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.73 out of 24.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 819123 - 862576:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS03875: X

AMP-binding (16..437): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HQVVHAMSWGLAGAIVGGSIHAWGMTEMSLGSVS
Nearest Stachelhaus code(s):: Ala DMGGFGCLIK (24% 8Å match)
Stachelhaus code match:: 60% (weak)

JQN83_RS34040: X

AMP-binding (98..490): X

nrpys: Asp, Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWCAFVGSVMTTKLMIGSEGNHYGMSE-TVGATW
Nearest Stachelhaus code(s):: Asp DATKMGHVGK (56% 8Å match); CysA DATKMGHVGK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CelR	Cellobiose uptake repressor

NZ_JAGFWR010000001.1 - Region 5 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1,004,925 - 1,029,536 nt. (total: 24,612 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

JQN83_RS04725: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

JQN83_RS04730: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Translocases: permease

JQN83_RS04700: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002316.2	0.47	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001289.5	0.46	ribosomal	penisin	Paenibacillus ehimensis
BGC0002306.2	0.45	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000514.5	0.40	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0002508.2	0.40	other (other)	8-azaguanine	Streptomyces pathocidini
BGC0001441.5	0.37	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0000604.4	0.36	ribosomal	GE2270A	Nonomuraea sp. WU8817
BGC0001155.5	0.35	ribosomal	GE2270	Planobispora rosea

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002316.2	0.47	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001289.5	0.46	ribosomal	penisin	Paenibacillus ehimensis
BGC0002306.2	0.45	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000514.5	0.40	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0002508.2	0.40	other (other)	8-azaguanine	Streptomyces pathocidini
BGC0001441.5	0.37	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0000604.4	0.36	ribosomal	GE2270A	Nonomuraea sp. WU8817
BGC0001155.5	0.35	ribosomal	GE2270	Planobispora rosea

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for JQN83_RS04725

JQN83_RS04720

Leader:

MNDTDTSEFALDVSLVDAGPTAG

Core:

GYATATDDGCGSGNTGSNACTTKCDGGN

Core with dehydrations:

GYADhbADhbDDGCysGDhaGNDhbGDhaNACysDhbDhbKCysDGGN

antiSMASH-DB 4.0 matches for JQN83_RS04720

100.0%

NZ_CP024087.1and 7 others:

NZ_CP024087.1 Lanthipeptides: CSH63_RS21430_lanthipeptideNZ_FMCV01000042.1 Lanthipeptides: GA0070215_RS27180_lanthipeptideNZ_FMCV01000042.1 Lanthipeptides: GA0070215_RS27180_lanthipeptideNZ_JAGFWR010000001.1 Lanthipeptides: JQN83_RS04720_lanthipeptideNZ_JAGFWR010000001.1 Lanthipeptides: JQN83_RS04720_lanthipeptideNZ_LT598496.1 Lanthipeptides: GA0070620_RS18735_lanthipeptideNZ_LT598496.1 Lanthipeptides: GA0070620_RS18735_lanthipeptide

Lanthipeptides: CSH63_RS21430_lanthipeptide

1

GYATATDDGCGSGNTGSNACTTKCDGGN

28

GYATATDDGCGSGNTGSNACTTKCDGGN

1

GYATATDDGCGSGNTGSNACTTKCDGGN

28

75.0%

NZ_AP023438.1and 1 other:

NZ_AP023438.1 Lanthipeptides: IGA62_RS12300_lanthipeptide

Lanthipeptides: IGA62_RS12300_lanthipeptide

1

GYATATDDGCGSGNTGSNACTTK

23

GYAT TDDGCGSGNTGSNACT K

3

GYATNTDDGCGSGNTGSNACTGK

25

67.9%

NZ_BBVA01000012.1and 7 others:

NZ_BBVA01000012.1 Lanthipeptides: A4R25_RS30875_lanthipeptideNZ_CP084582.1 Lanthipeptides: LF814_RS03375_lanthipeptideNZ_CP084582.1 Lanthipeptides: LF814_RS03375_lanthipeptideNZ_CP118233.1 Lanthipeptides: PVK74_RS24320_lanthipeptideNZ_CP118233.1 Lanthipeptides: PVK74_RS24320_lanthipeptideNZ_KK037233.1 Lanthipeptides: MCBG_RS31715_lanthipeptideNZ_KK037233.1 Lanthipeptides: MCBG_RS31715_lanthipeptide

Lanthipeptides: A4R25_RS30875_lanthipeptide

1

GYATATDDGCGSGNTGSNACT

21

GYAT+TDDGCGSGNTGSNAC+

3

GYATSTDDGCGSGNTGSNACS

23

with 52 more sequence matches

Only the first 10 are displayed here.

42.9%

NZ_BBVA01000002.1and 9 others:

NZ_BBXD01000026.1 Lanthipeptides: AW272_RS36470_lanthipeptideNZ_CP030865.1 Lanthipeptides: MicB006_RS27820_lanthipeptideNZ_FMCS01000017.1 Lanthipeptides: GA0070214_RS30700_lanthipeptideNZ_JAGPXW010000015.1 Lanthipeptides: KBX71_RS18490_lanthipeptideNZ_JALJRJ010000030.1 Lanthipeptides: OC439_RS27920_lanthipeptideNZ_KB913036.1 Lanthipeptides: A39M_RS1000000128430_lanthipeptideNZ_LT594324.1 Lanthipeptides: GA0070621_RS04875_lanthipeptideNZ_LT607410.1 Lanthipeptides: GA0074696_RS20405_lanthipeptideNZ_LT607753.1 Lanthipeptides: GA0070614_RS02740_lanthipeptide

Lanthipeptides: A4R25_RS30565_lanthipeptide

6

TDDGCGSGNTGSNACTT

22

TDDGCGS T ACTT

3

TDDGCGSTCT---ACTT

16

42.9%

NZ_CP031264.1and 1 other:

NZ_CP031264.1 Lanthipeptides: C7M71_RS08475_lanthipeptide

Lanthipeptides: C7M71_RS08475_lanthipeptide

6

TDDGCGSGNTGSNACTTKCD

25

T DGCGS +GS ACT+ D

1

TSDGCGSSCSGS-ACTSFTD

19

42.9%

NZ_CP119145.1and 1 other:

NZ_CP119145.1 Lanthipeptides: PZB75_RS00285_lanthipeptide

Lanthipeptides: PZB75_RS00285_lanthipeptide

5

ATDDGCGSGNTGSNACTTKC

24

TDDGCGS T +AC+T C

5

MTDDGCGS--TCQSACSTTC

22

42.9%

NZ_KI912225.1and 1 other:

NZ_KI912225.1 Lanthipeptides: SACPADRAFT_RS26660_lanthipeptide

Lanthipeptides: SACPADRAFT_RS26660_lanthipeptide

5

ATDDGCGSGNTGSNACTTKC

24

TDDGCGS T +ACT C

5

PTDDGCGS--TCESACTPTC

22

41.9%

NZ_LWLC01000028.1:

Lanthipeptides: A6A25_RS26255_lanthipeptide

6

TDDGCGSGNTGSNACTTKC-DGG

27

TDDGCG T +AC+ C DGG

11

TDDGCG--QTCESACSNSCTDGG

31

39.3%

NC_007777.1and 1 other:

NC_007777.1 Lanthipeptides: FRANCCI3_RS09160_lanthipeptide

Lanthipeptides: FRANCCI3_RS09160_lanthipeptide

2

YATATDDGCGSGNTGSNACTTKCDG

26

TDDGCG+ T +AC C G

5

LIRMTDDGCGT--TCQSACPNTCPG

27

39.3%

NC_007777.1and 1 other:

NC_007777.1 Lanthipeptides: FRANCCI3_RS10225_lanthipeptide

Lanthipeptides: FRANCCI3_RS10225_lanthipeptide

5

ATDDGCGSGNTGSNACTTKC

24

TDDGCG+ T AC+T C

5

MTDDGCGT--TCETACSTTC

22

39.3%

NZ_AP026073.1and 17 others:

NZ_BBOK01000007.1 Lanthipeptides: APK71_RS35805_lanthipeptideNZ_BBUY01000020.1 Lanthipeptides: AZE13_RS34600_lanthipeptideNZ_BMUN01000013.1 Lanthipeptides: IE238_RS22260_lanthipeptideNZ_BMVR01000012.1 Lanthipeptides: IE274_RS28010_lanthipeptideNZ_CP009754.1 Lanthipeptides: NI25_RS06465_lanthipeptideNZ_CP015588.1 Lanthipeptides: A7J05_RS07195_lanthipeptideNZ_CP023697.1 Lanthipeptides: CP972_RS03610_lanthipeptideNZ_CP029192.1 Lanthipeptides: DEJ48_RS36690_lanthipeptideNZ_CP029192.1 Lanthipeptides: DEJ48_RS36690_lanthipeptideNZ_CP031194.1 Lanthipeptides: DVK44_RS04655_lanthipeptideNZ_CP039123.1 Lanthipeptides: E5N77_RS29900_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS35785_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS35780_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS03985_lanthipeptideNZ_CP116257.1 Lanthipeptides: BJ961_RS11895_lanthipeptideNZ_JACHCX010000001.1 Lanthipeptides: HDC93_RS03090_lanthipeptideNZ_ML123127.1 Lanthipeptides: EES47_RS19530_lanthipeptide

Lanthipeptides: HEK616_RS04845_lanthipeptide

6

TDDGCGSGNTGSNACTT

22

TDDGCGS T S+ C T

4

TDDGCGS--TCSSPCAT

18

39.3%

NZ_BBNO01000004.1:

Lanthipeptides: TU31_RS36875_lanthipeptide

2

YATATDDGCGSGNTGSNACTTK

23

TDDGCGS + +AC TK

2

LIVLTDDGCGS--SCPSACATK

21

39.3%

NZ_BMMN01000001.1and 1 other:

NZ_BMMN01000001.1 Lanthipeptides: IEY80_RS02165_lanthipeptide

Lanthipeptides: IEY80_RS02165_lanthipeptide

5

ATDDGCGSGNTGSNACTTKC

24

TDDGCG+ T +AC+T C

5

MTDDGCGT--TCQSACSTTC

22

MIBiG 4.0 matches for JQN83_RS04720

14.3%

BGC0002110.3 (QKV49894.1):

Lanthipeptide: birimositide

17

SNACTTKC

24

+ CT+KC

19

TTKCTSKC

26

8.1%

BGC0001229.4 (SBI_06989):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

20

CTTKC

24

CT++C

33

CTSRC

37

Lanthipeptide(s) for JQN83_RS04735

JQN83_RS04720

Leader:

MNDTDTSEFALDVSLVDAGPTAG

Core:

GYATATDDGCGSGNTGSNACTTKCDGGN

Core with dehydrations:

GYADhbADhbDDGCysGDhaGNDhbGDhaNACysDhbDhbKCysDGGN

antiSMASH-DB 4.0 matches for JQN83_RS04720

100.0%

NZ_CP024087.1and 7 others:

NZ_CP024087.1 Lanthipeptides: CSH63_RS21430_lanthipeptideNZ_FMCV01000042.1 Lanthipeptides: GA0070215_RS27180_lanthipeptideNZ_FMCV01000042.1 Lanthipeptides: GA0070215_RS27180_lanthipeptideNZ_JAGFWR010000001.1 Lanthipeptides: JQN83_RS04720_lanthipeptideNZ_JAGFWR010000001.1 Lanthipeptides: JQN83_RS04720_lanthipeptideNZ_LT598496.1 Lanthipeptides: GA0070620_RS18735_lanthipeptideNZ_LT598496.1 Lanthipeptides: GA0070620_RS18735_lanthipeptide

Lanthipeptides: CSH63_RS21430_lanthipeptide

1

GYATATDDGCGSGNTGSNACTTKCDGGN

28

GYATATDDGCGSGNTGSNACTTKCDGGN

1

GYATATDDGCGSGNTGSNACTTKCDGGN

28

75.0%

NZ_AP023438.1and 1 other:

NZ_AP023438.1 Lanthipeptides: IGA62_RS12300_lanthipeptide

Lanthipeptides: IGA62_RS12300_lanthipeptide

1

GYATATDDGCGSGNTGSNACTTK

23

GYAT TDDGCGSGNTGSNACT K

3

GYATNTDDGCGSGNTGSNACTGK

25

67.9%

NZ_BBVA01000012.1and 7 others:

NZ_BBVA01000012.1 Lanthipeptides: A4R25_RS30875_lanthipeptideNZ_CP084582.1 Lanthipeptides: LF814_RS03375_lanthipeptideNZ_CP084582.1 Lanthipeptides: LF814_RS03375_lanthipeptideNZ_CP118233.1 Lanthipeptides: PVK74_RS24320_lanthipeptideNZ_CP118233.1 Lanthipeptides: PVK74_RS24320_lanthipeptideNZ_KK037233.1 Lanthipeptides: MCBG_RS31715_lanthipeptideNZ_KK037233.1 Lanthipeptides: MCBG_RS31715_lanthipeptide

Lanthipeptides: A4R25_RS30875_lanthipeptide

1

GYATATDDGCGSGNTGSNACT

21

GYAT+TDDGCGSGNTGSNAC+

3

GYATSTDDGCGSGNTGSNACS

23

with 52 more sequence matches

Only the first 10 are displayed here.

42.9%

NZ_BBVA01000002.1and 9 others:

NZ_BBXD01000026.1 Lanthipeptides: AW272_RS36470_lanthipeptideNZ_CP030865.1 Lanthipeptides: MicB006_RS27820_lanthipeptideNZ_FMCS01000017.1 Lanthipeptides: GA0070214_RS30700_lanthipeptideNZ_JAGPXW010000015.1 Lanthipeptides: KBX71_RS18490_lanthipeptideNZ_JALJRJ010000030.1 Lanthipeptides: OC439_RS27920_lanthipeptideNZ_KB913036.1 Lanthipeptides: A39M_RS1000000128430_lanthipeptideNZ_LT594324.1 Lanthipeptides: GA0070621_RS04875_lanthipeptideNZ_LT607410.1 Lanthipeptides: GA0074696_RS20405_lanthipeptideNZ_LT607753.1 Lanthipeptides: GA0070614_RS02740_lanthipeptide

Lanthipeptides: A4R25_RS30565_lanthipeptide

6

TDDGCGSGNTGSNACTT

22

TDDGCGS T ACTT

3

TDDGCGSTCT---ACTT

16

42.9%

NZ_CP031264.1and 1 other:

NZ_CP031264.1 Lanthipeptides: C7M71_RS08475_lanthipeptide

Lanthipeptides: C7M71_RS08475_lanthipeptide

6

TDDGCGSGNTGSNACTTKCD

25

T DGCGS +GS ACT+ D

1

TSDGCGSSCSGS-ACTSFTD

19

42.9%

NZ_CP119145.1and 1 other:

NZ_CP119145.1 Lanthipeptides: PZB75_RS00285_lanthipeptide

Lanthipeptides: PZB75_RS00285_lanthipeptide

5

ATDDGCGSGNTGSNACTTKC

24

TDDGCGS T +AC+T C

5

MTDDGCGS--TCQSACSTTC

22

42.9%

NZ_KI912225.1and 1 other:

NZ_KI912225.1 Lanthipeptides: SACPADRAFT_RS26660_lanthipeptide

Lanthipeptides: SACPADRAFT_RS26660_lanthipeptide

5

ATDDGCGSGNTGSNACTTKC

24

TDDGCGS T +ACT C

5

PTDDGCGS--TCESACTPTC

22

41.9%

NZ_LWLC01000028.1:

Lanthipeptides: A6A25_RS26255_lanthipeptide

6

TDDGCGSGNTGSNACTTKC-DGG

27

TDDGCG T +AC+ C DGG

11

TDDGCG--QTCESACSNSCTDGG

31

39.3%

NC_007777.1and 1 other:

NC_007777.1 Lanthipeptides: FRANCCI3_RS09160_lanthipeptide

Lanthipeptides: FRANCCI3_RS09160_lanthipeptide

2

YATATDDGCGSGNTGSNACTTKCDG

26

TDDGCG+ T +AC C G

5

LIRMTDDGCGT--TCQSACPNTCPG

27

39.3%

NC_007777.1and 1 other:

NC_007777.1 Lanthipeptides: FRANCCI3_RS10225_lanthipeptide

Lanthipeptides: FRANCCI3_RS10225_lanthipeptide

5

ATDDGCGSGNTGSNACTTKC

24

TDDGCG+ T AC+T C

5

MTDDGCGT--TCETACSTTC

22

39.3%

NZ_AP026073.1and 17 others:

NZ_BBOK01000007.1 Lanthipeptides: APK71_RS35805_lanthipeptideNZ_BBUY01000020.1 Lanthipeptides: AZE13_RS34600_lanthipeptideNZ_BMUN01000013.1 Lanthipeptides: IE238_RS22260_lanthipeptideNZ_BMVR01000012.1 Lanthipeptides: IE274_RS28010_lanthipeptideNZ_CP009754.1 Lanthipeptides: NI25_RS06465_lanthipeptideNZ_CP015588.1 Lanthipeptides: A7J05_RS07195_lanthipeptideNZ_CP023697.1 Lanthipeptides: CP972_RS03610_lanthipeptideNZ_CP029192.1 Lanthipeptides: DEJ48_RS36690_lanthipeptideNZ_CP029192.1 Lanthipeptides: DEJ48_RS36690_lanthipeptideNZ_CP031194.1 Lanthipeptides: DVK44_RS04655_lanthipeptideNZ_CP039123.1 Lanthipeptides: E5N77_RS29900_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS35785_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS35780_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS03985_lanthipeptideNZ_CP116257.1 Lanthipeptides: BJ961_RS11895_lanthipeptideNZ_JACHCX010000001.1 Lanthipeptides: HDC93_RS03090_lanthipeptideNZ_ML123127.1 Lanthipeptides: EES47_RS19530_lanthipeptide

Lanthipeptides: HEK616_RS04845_lanthipeptide

6

TDDGCGSGNTGSNACTT

22

TDDGCGS T S+ C T

4

TDDGCGS--TCSSPCAT

18

39.3%

NZ_BBNO01000004.1:

Lanthipeptides: TU31_RS36875_lanthipeptide

2

YATATDDGCGSGNTGSNACTTK

23

TDDGCGS + +AC TK

2

LIVLTDDGCGS--SCPSACATK

21

39.3%

NZ_BMMN01000001.1and 1 other:

NZ_BMMN01000001.1 Lanthipeptides: IEY80_RS02165_lanthipeptide

Lanthipeptides: IEY80_RS02165_lanthipeptide

5

ATDDGCGSGNTGSNACTTKC

24

TDDGCG+ T +AC+T C

5

MTDDGCGT--TCQSACSTTC

22

MIBiG 4.0 matches for JQN83_RS04720

14.3%

BGC0002110.3 (QKV49894.1):

Lanthipeptide: birimositide

17

SNACTTKC

24

+ CT+KC

19

TTKCTSKC

26

8.1%

BGC0001229.4 (SBI_06989):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

20

CTTKC

24

CT++C

33

CTSRC

37

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.10 out of 20.01

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

JQN83_RS04720 - Class I

Cleavage pHMM score: -4.20

RODEO score: 14

Monoisotopic mass: 2471.0 Da

Molecular weight: 2472.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2490.5 Da N = 1; 2508.5 Da N = 2; 2526.5 Da N = 3; 2544.6 Da N = 4

JQN83_RS04720 - Class I

Cleavage pHMM score: -4.20

RODEO score: 14

Monoisotopic mass: 2471.0 Da

Molecular weight: 2472.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2490.5 Da N = 1; 2508.5 Da N = 2; 2526.5 Da N = 3; 2544.6 Da N = 4

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 150 - 236; Score: 45.6

TFBS definitions

Regulator	Description

NZ_JAGFWR010000001.1 - Region 6 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1,045,846 - 1,073,671 nt. (total: 27,826 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

JQN83_RS04905: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

JQN83_RS04930: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Ligases: ligase

JQN83_RS04915: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQN83_RS04920: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQN83_RS04925: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001250.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001250.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

Additional weak hits (10):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.60 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.24 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.79 out of 20.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.18 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.03 out of 21.55

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.19 out of 27.04

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.89 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.54 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.39 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 8, location 1045845 - 1073671:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Phe) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS04920: X

AMP-binding (11..384): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TNLFFPLGTNATFLGTTGDVNTYSSTEAAPARTT
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

JQN83_RS04925: Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (8..389): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAADGWIFELVLLSVGSVNGYGPTEATVASTL
Nearest Stachelhaus code(s):: Phe DAFVLAGVAK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_JAGFWR010000011.1 - Region 1 - NAGGN

Download region GenBank file

Download region SVG

Location: 18,760 - 33,554 nt. (total: 14,795 nt) Show pHMM detection rules used

NAGGN: ((TIGR03104 or cds(GATase_7 and Asn_synthase)) and TIGR03103 and (TIGR03106 or Peptidase_M42))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: sulfhydrylase

JQN83_RS19210: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: amidase hydrolase

JQN83_RS19205: amidase

smcogs: SMCOG1105: amidase

JQN83_RS19225: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001880.3	0.45	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000846.5	0.42	other (other)	tabtoxin	Pseudomonas syringae
BGC0000885.3	0.40	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001374.5	0.36	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000815.4	0.34	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0000254.5	0.33	PKS	oxytetracycline	Streptomyces rimosus
BGC0001739.3	0.33	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0000937.5	0.32	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001610.5	0.32	other (other)	gougerotin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001395.5	0.32	other (other)	teichomycin A1	Actinoplanes teichomyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001880.3	0.45	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000846.5	0.42	other (other)	tabtoxin	Pseudomonas syringae
BGC0000885.3	0.40	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001374.5	0.36	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000815.4	0.34	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0000254.5	0.33	PKS	oxytetracycline	Streptomyces rimosus
BGC0001739.3	0.33	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0000937.5	0.32	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001610.5	0.32	other (other)	gougerotin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001395.5	0.32	other (other)	teichomycin A1	Actinoplanes teichomyceticus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.61 out of 20.01

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.27 out of 32.74

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.29 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.95 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_JAGFWR010000013.1 - Region 1 - NRPS-like,terpene-precursor

Download region GenBank file

Download region SVG

Location: 14,593 - 68,146 nt. (total: 53,554 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxidoreductase oxygenase

JQN83_RS20885: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

JQN83_RS20975: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

JQN83_RS21025: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

JQN83_RS21035: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

JQN83_RS21045: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

Transferases: aminotransferase

JQN83_RS21030: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: deacetylase

JQN83_RS21005: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Lyases: dehydratase

JQN83_RS20990: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthetase

JQN83_RS20925: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

JQN83_RS21000: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQN83_RS21050: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

JQN83_RS20955: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.28	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002164.2	0.27	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.26	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.26	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001166.5	0.26	NRPS	HC-toxin	Alternaria jesenskae
BGC0000357.5	0.26	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.26	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.26	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.25	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000907.5	0.18	other (other)	lincomycin	Streptomyces lincolnensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000343.5	0.47	NRPS	enterobactin	Pseudomonas sp. J465

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

JQN83_RS20925: PT_FPPS_like

Domain 1 (43 - 349): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.48 out of 23.79

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.98 out of 27.55

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (20):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.51 out of 28.14

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.58 out of 27.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.54 out of 21.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.79 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.23 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.06 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.80 out of 21.55

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.63 out of 27.04

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.24 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.06 out of 31.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.22 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.90 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.93 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 14592 - 68146:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 26361 - 68146:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS20995: X

AMP-binding (68..322): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IKHV-DVHAACLLCLTTGENFMYGSQEACPAVTR
Nearest Stachelhaus code(s):: Gln DVALLGSITK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

JQN83_RS21000: X

AMP-binding (8..411): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LYRTHTGGMAGLLFRVASGLNVYALTECAPCLGQ
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

JQN83_RS21050: X

AMP-binding (13..425): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YHVFFDPSVFDAFSIFIGEENVYGPTELTVSCAE
Nearest Stachelhaus code(s):: Ile DGFFLGVVYK (53% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CatR	H2O2-responsive repressor
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism

NZ_JAGFWR010000015.1 - Region 1 - RRE-containing,T1PKS,oligosaccharide,terpene

Download region GenBank file

Download region SVG

Location: 1 - 144,374 nt. (total: 144,374 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

JQN83_RS22305: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

JQN83_RS22340: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

JQN83_RS22350: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

JQN83_RS22355: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

JQN83_RS22380: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

JQN83_RS22475: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JQN83_RS22505: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

JQN83_RS33270: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase acylase aminotransferase carboxylase formyltransferase glycosyltransferase methyltransferase

JQN83_RS22265: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

JQN83_RS22330: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

JQN83_RS22345: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

JQN83_RS22360: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

JQN83_RS22385: aminotransferase

smcogs: SMCOG1019: aminotransferase

JQN83_RS22400: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

JQN83_RS22420: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

JQN83_RS22525: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

JQN83_RS22530: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: dehalogenase esterase hydrolase

JQN83_RS22275: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

JQN83_RS22495: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

JQN83_RS22570: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase synthetase

JQN83_RS22255: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

JQN83_RS22315: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

JQN83_RS22335: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQN83_RS22365: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

JQN83_RS22395: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

JQN83_RS22415: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQN83_RS22480: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

JQN83_RS22485: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

JQN83_RS22490: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

JQN83_RS22515: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQN83_RS22520: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQN83_RS22550: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	1.08	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001303.5	0.90	PKS	lobosamide A, lobosamide B, lobosamide C	Micromonospora sp. RL09-050-HVF-A
BGC0000142.3	0.90	PKS	salinilactam	Salinispora tropica CNB-440
BGC0001273.3	0.85	PKS	asperlactone	Aspergillus ochraceus
BGC0000844.5	0.73	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002347.3	0.70	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0002031.3	0.70	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0002127.3	0.67	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0002007.2	0.63	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000142.3	0.81	PKS	salinilactam	Salinispora tropica CNB-440
BGC0001303.5	0.77	PKS	lobosamide A, lobosamide B, lobosamide C	Micromonospora sp. RL09-050-HVF-A
BGC0001276.3	0.75	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

JQN83_RS22365: PT_FPPS_like

Domain 1 (44 - 334): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

JQN83_RS22375: T2TS

Domain 1 (311 - 549): Type 2 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.06 out of 23.79

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

Additional weak hits (35):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.08 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.36 out of 21.55

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.71 out of 25.31

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.90 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.41 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.12 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.08 out of 18.57

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.04 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.01 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.92 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.03 out of 20.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.98 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.81 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.40 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.69 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.69 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.56 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.70 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.28 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.84 out of 23.43

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.27 out of 31.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.56 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.87 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.83 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.90 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.51 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.30 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 144374:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (ccmal) + (ohmal - ohmal) + (ccmal - Me-ccmal - Me-ccmal - ccmal) + (Me-ohmal) + (ccmal - ccmal - ccmal)
Non-colinear ordering:: JQN83_RS22255 + JQN83_RS22475 + JQN83_RS22480 + JQN83_RS22550 + JQN83_RS22485 + JQN83_RS22490

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 28394:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 39471 - 144374:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (ohmal - ohmal) + (ccmal - Me-ccmal - Me-ccmal - ccmal) + (Me-ohmal) + (ccmal - ccmal - ccmal)
Non-colinear ordering:: JQN83_RS22475 + JQN83_RS22480 + JQN83_RS22550 + JQN83_RS22485 + JQN83_RS22490

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS22255: mal

PKS_AT (1471..1770): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 208.3
inactive: 117.2
Methoxymalonyl-CoA: 72.5
Methylmalonyl-CoA: 57.7
Propionyl-CoA: 43.8
Isobutyryl-CoA: 36.3
2-Methylbutyryl-CoA: 23.6
Acetyl-CoA: 20.1
fatty_acid: 16.0
CHC-CoA: 14.2
Ethylmalonyl-CoA: 13.2
Benzoyl-CoA: 10.9
3-Methylbutyryl-CoA: 8.3
trans-1,2-CPDA: 0.6

JQN83_RS22415: X

AMP-binding (47..440): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAVLHTAGIITQFGFNTGD-----------AYTR
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

JQN83_RS22475: mal

PKS_AT (559..836): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 186.0
inactive: 74.6
Methoxymalonyl-CoA: 55.0
Methylmalonyl-CoA: 51.2
Propionyl-CoA: 21.6
Isobutyryl-CoA: 20.5
Acetyl-CoA: 15.5
Benzoyl-CoA: 15.0
CHC-CoA: 14.4
2-Methylbutyryl-CoA: 8.1
Ethylmalonyl-CoA: 1.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

JQN83_RS22480: mal - mal

PKS_AT (541..817): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 184.3
inactive: 72.2
Methoxymalonyl-CoA: 52.1
Methylmalonyl-CoA: 46.4
Propionyl-CoA: 19.9
Isobutyryl-CoA: 19.5
CHC-CoA: 15.6
Benzoyl-CoA: 14.9
Acetyl-CoA: 14.8
2-Methylbutyryl-CoA: 7.9
Ethylmalonyl-CoA: 5.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (1983..2259): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 182.0
inactive: 74.2
Methoxymalonyl-CoA: 50.4
Methylmalonyl-CoA: 44.6
Propionyl-CoA: 21.0
CHC-CoA: 15.5
Acetyl-CoA: 15.5
Isobutyryl-CoA: 14.4
Benzoyl-CoA: 14.4
2-Methylbutyryl-CoA: 7.1
Ethylmalonyl-CoA: 6.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

JQN83_RS22485: mmal

PKS_AT (547..845): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 204.3
Ethylmalonyl-CoA: 196.6
Methoxymalonyl-CoA: 167.8
2-Methylbutyryl-CoA: 136.4
trans-1,2-CPDA: 126.6
Propionyl-CoA: 107.1
Malonyl-CoA: 91.8
CHC-CoA: 91.7
Isobutyryl-CoA: 89.5
Acetyl-CoA: 71.7
Benzoyl-CoA: 66.8
3-Methylbutyryl-CoA: 44.0
fatty_acid: 41.3
inactive: 35.8

JQN83_RS22490: mal - mal - mal

PKS_AT (553..832): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 183.2
inactive: 75.8
Methoxymalonyl-CoA: 50.5
Methylmalonyl-CoA: 44.6
Propionyl-CoA: 22.2
Acetyl-CoA: 15.6
CHC-CoA: 14.7
Benzoyl-CoA: 14.1
Isobutyryl-CoA: 13.8
Ethylmalonyl-CoA: 7.2
2-Methylbutyryl-CoA: 6.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2250..2527): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 182.8
inactive: 75.3
Methoxymalonyl-CoA: 51.8
Methylmalonyl-CoA: 46.6
Propionyl-CoA: 22.0
Acetyl-CoA: 15.5
CHC-CoA: 14.4
Benzoyl-CoA: 14.4
Isobutyryl-CoA: 14.3
2-Methylbutyryl-CoA: 5.7
Ethylmalonyl-CoA: 0.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3932..4208): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 181.8
inactive: 73.9
Methoxymalonyl-CoA: 49.5
Methylmalonyl-CoA: 43.8
Propionyl-CoA: 19.0
Acetyl-CoA: 15.2
Benzoyl-CoA: 14.1
Isobutyryl-CoA: 13.6
CHC-CoA: 13.5
2-Methylbutyryl-CoA: 7.5
Ethylmalonyl-CoA: 4.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

JQN83_RS22515: X

AMP-binding (23..431): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FGMSFDFSLLDLNGLYSGEVNCFGSSE-SIAASF
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (44% 8Å match)
Stachelhaus code match:: 60% (weak)

JQN83_RS22520: X

AMP-binding (17..421): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YVLFFDCAMFDCFSFFAGEENIYGPTELTVTITG
Nearest Stachelhaus code(s):: Ala DCFFFALITK (85% 8Å match); bMe-Asp DCFFFALITK (79% 8Å match)
Stachelhaus code match:: 80% (moderate)

JQN83_RS22525: mal

PKS_AT (33..279): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 8.4
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

JQN83_RS22550: mal - mmal - mmal - mal

PKS_AT (660..958): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.5
inactive: 132.1
Methoxymalonyl-CoA: 81.1
Methylmalonyl-CoA: 69.0
Isobutyryl-CoA: 46.3
Propionyl-CoA: 39.0
Ethylmalonyl-CoA: 34.1
2-Methylbutyryl-CoA: 24.3
Acetyl-CoA: 18.3
Benzoyl-CoA: 17.5
trans-1,2-CPDA: 9.0
fatty_acid: 7.4
CHC-CoA: 5.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (2394..2692): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 205.8
Ethylmalonyl-CoA: 198.8
Methoxymalonyl-CoA: 169.7
2-Methylbutyryl-CoA: 154.3
trans-1,2-CPDA: 121.2
Propionyl-CoA: 110.9
Malonyl-CoA: 90.6
CHC-CoA: 89.9
Isobutyryl-CoA: 76.1
Acetyl-CoA: 39.5
Benzoyl-CoA: 38.9
3-Methylbutyryl-CoA: 38.5
fatty_acid: 29.2
inactive: 25.5

PKS_AT (4106..4404): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 211.8
Ethylmalonyl-CoA: 205.8
Methoxymalonyl-CoA: 172.9
2-Methylbutyryl-CoA: 158.7
trans-1,2-CPDA: 123.5
Propionyl-CoA: 110.5
Malonyl-CoA: 98.2
CHC-CoA: 88.3
Isobutyryl-CoA: 87.4
Benzoyl-CoA: 50.7
Acetyl-CoA: 43.6
3-Methylbutyryl-CoA: 40.0
fatty_acid: 28.0
inactive: 20.5

PKS_AT (5808..6106): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 218.5
inactive: 117.4
Methoxymalonyl-CoA: 63.8
Methylmalonyl-CoA: 53.5
Isobutyryl-CoA: 31.5
Propionyl-CoA: 23.1
Acetyl-CoA: 22.3
Ethylmalonyl-CoA: 21.2
Benzoyl-CoA: 18.8
trans-1,2-CPDA: 6.7
CHC-CoA: 5.9
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -0.5

Link to PARAS substrate predictor

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 18 - 85; Score: 29.3

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAGFWR010000016.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 8,526 - 19,344 nt. (total: 10,819 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JQN83_RS22695: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

JQN83_RS22670: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001007.5	0.44	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001006.5	0.42	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0002425.3	0.33	ribosomal	stlassin	Streptomyces sp.
BGC0000188.5	0.30	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000847.4	0.28	other (non-nrp beta-lactam)	thienamycin	Streptomyces cattleya
BGC0002657.2	0.28	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0000297.5	0.26	NRPS, PKS, saccharide	aeruginoside 126B, aeruginoside 126A	Planktothrix agardhii NIVA-CYA 126
BGC0001127.5	0.25	NRPS	jagaricin	Janthinobacterium agaricidamnosum
BGC0000225.5	0.24	PKS	frenolicin B	Streptomyces roseofulvus
BGC0002435.3	0.24	other (other)	coformycin, aristeromycin	Micromonospora haikouensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001007.5	0.44	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001006.5	0.42	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0002425.3	0.33	ribosomal	stlassin	Streptomyces sp.
BGC0000188.5	0.30	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000847.4	0.28	other (non-nrp beta-lactam)	thienamycin	Streptomyces cattleya
BGC0002657.2	0.28	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0000297.5	0.26	NRPS, PKS, saccharide	aeruginoside 126B, aeruginoside 126A	Planktothrix agardhii NIVA-CYA 126
BGC0001127.5	0.25	NRPS	jagaricin	Janthinobacterium agaricidamnosum
BGC0000225.5	0.24	PKS	frenolicin B	Streptomyces roseofulvus
BGC0002435.3	0.24	other (other)	coformycin, aristeromycin	Micromonospora haikouensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 24.54 out of 29.65

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (6):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.31 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.23 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.46 out of 24.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.45 out of 26.85

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
LexA variant 1	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAGFWR010000002.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 18,999 nt. (total: 18,999 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

JQN83_RS04975: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

JQN83_RS05010: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JQN83_RS05025: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Hydrolases: hydrolase

JQN83_RS05030: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.43	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000189.4	0.42	PKS	3-(2'-hydroxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-hydroxy-3'-oxo-4'-methylhexyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylhexyl)-indole	Xenorhabdus bovienii SS-2004
BGC0002128.3	0.41	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001725.3	0.40	other (other)	oxetanocin A	Bacillus megaterium
BGC0000234.5	0.40	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002493.3	0.40	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002561.3	0.40	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0002665.2	0.39	ribosomal	3-thiaglutamate	Pseudomonas syringae pv. maculicola str. ES4326

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.43	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000189.4	0.42	PKS	3-(2'-hydroxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-hydroxy-3'-oxo-4'-methylhexyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylhexyl)-indole	Xenorhabdus bovienii SS-2004
BGC0002128.3	0.41	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001725.3	0.40	other (other)	oxetanocin A	Bacillus megaterium
BGC0000234.5	0.40	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002493.3	0.40	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002561.3	0.40	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0002665.2	0.39	ribosomal	3-thiaglutamate	Pseudomonas syringae pv. maculicola str. ES4326

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

JQN83_RS04985: Lycopene_cycl

Domain 1 (10 - 380): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.44 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.05 out of 30.25

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

NZ_JAGFWR010000002.1 - Region 2 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 199,979 - 229,763 nt. (total: 29,785 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

JQN83_RS05910: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

JQN83_RS05940: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: glucosidase

JQN83_RS05850: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Lyases: decarboxylase

JQN83_RS05915: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.77	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.74	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.73	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.73	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.63	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002073.3	0.58	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.77	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.74	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.73	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.73	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.63	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002073.3	0.58	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.99 out of 20.97

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 26.97 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.50 out of 30.11

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.90 out of 36.53

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (10):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.33 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.75 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.01 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.95 out of 20.01

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.45 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.70 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.24 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.29 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.84 out of 29.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAGFWR010000002.1 - Region 3 - RRE-containing

Download region GenBank file

Download region SVG

Location: 531,114 - 552,217 nt. (total: 21,104 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

JQN83_RS07335: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

JQN83_RS07340: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: deacetylase

JQN83_RS07370: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Isomerases: mutase

JQN83_RS07325: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000585.5	0.47	ribosomal	microcin C7	Escherichia coli
BGC0002332.2	0.39	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001521.3	0.36	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001909.3	0.36	PKS	strobilurin A	Strobilurus tenacellus
BGC0001591.4	0.35	other (other)	fatty acid enol ester, N-tetradecanoyl tyrosine	uncultured bacterium CSLC2
BGC0000843.5	0.35	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0002362.3	0.34	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0000709.5	0.33	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0000813.3	0.33	other (other)	K-252a	Nonomuraea longicatena
BGC0001556.5	0.33	NRPS, PKS	combamide	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000585.5	0.47	ribosomal	microcin C7	Escherichia coli
BGC0002332.2	0.39	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001521.3	0.36	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001909.3	0.36	PKS	strobilurin A	Strobilurus tenacellus
BGC0001591.4	0.35	other (other)	fatty acid enol ester, N-tetradecanoyl tyrosine	uncultured bacterium CSLC2
BGC0000843.5	0.35	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0002362.3	0.34	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0000709.5	0.33	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0000813.3	0.33	other (other)	K-252a	Nonomuraea longicatena
BGC0001556.5	0.33	NRPS, PKS	combamide	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

Additional weak hits (4):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.81 out of 30.98

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 0 - 93; Score: 57.4

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAGFWR010000002.1 - Region 4 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 641,400 - 707,075 nt. (total: 65,676 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

JQN83_RS07945: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Transferases: methyltransferase

JQN83_RS07975: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: esterase hydrolase

JQN83_RS07960: thioesterase

smcogs: SMCOG1004: thioesterase

JQN83_RS08040: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase

JQN83_RS07895: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase synthase

JQN83_RS07930: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQN83_RS07935: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQN83_RS07950: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

JQN83_RS07955: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQN83_RS07965: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	1.25	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	1.22	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.18	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	1.14	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002286.3	1.14	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.12	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	1.12	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	1.10	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	1.10	NRPS	enniatin	Fusarium equiseti
BGC0001825.4	1.09	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.53 out of 23.79

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.64 out of 26.33

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.78 out of 28.19

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.68 out of 30.12

Confidence: medium

Additional weak hits (19):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.71 out of 23.43

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.94 out of 21.55

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.33 out of 20.01

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.90 out of 23.43

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.45 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 26.85

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.78 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.67 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.20 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.15 out of 30.22

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.30 out of 27.55

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.33 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.45 out of 30.25

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 641399 - 707075:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (ccmal) + (Asn) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 641399 - 700331:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (ccmal) + (Asn) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 663556 - 707075:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (ccmal) + (Asn) + (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS07930: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (495..907): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAIDVSA
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

JQN83_RS07935: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (454..861): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTGGKVVIGGEVNEYGPTEATVGCVA
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (88% 8Å match); OH-Asn or Asn DLTKVGEVGK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

JQN83_RS07950: mal

PKS_AT (542..826): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 178.1
inactive: 119.8
Methoxymalonyl-CoA: 70.4
Methylmalonyl-CoA: 62.9
Isobutyryl-CoA: 46.6
Propionyl-CoA: 41.5
Ethylmalonyl-CoA: 37.7
Benzoyl-CoA: 33.0
Acetyl-CoA: 28.2
fatty_acid: 25.8
CHC-CoA: 25.6
2-Methylbutyryl-CoA: 22.4
trans-1,2-CPDA: 12.0
3-Methylbutyryl-CoA: 7.5

JQN83_RS07955: X

AMP-binding (26..410): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FGCAFDAASIDVFILCGGELNGYGPTETTVLAVS
Nearest Stachelhaus code(s):: Phe DAIVLGGVCK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

JQN83_RS07965: X

AMP-binding (9..396): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VNQAVDAAIPDPHSLLGGEVNGYGATEMTFAARY
Nearest Stachelhaus code(s):: Leu or Val DAIALGGCAK (38% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
ZuR variant 1	Zinc-responsive repressor

NZ_JAGFWR010000021.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 17,719 - 38,756 nt. (total: 21,038 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

JQN83_RS25480: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

JQN83_RS25560: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase

JQN83_RS25540: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: cyclase

JQN83_RS25525: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

JQN83_RS25530: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002193.2	0.56	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.49	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001592.5	0.43	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000889.5	0.43	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000595.3	0.42	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002193.2	0.56	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.49	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001592.5	0.43	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000889.5	0.43	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000595.3	0.42	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

JQN83_RS25525: T1TS

Domain 1 (4 - 344): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.03 out of 36.53

Confidence: medium

Additional weak hits (5):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.04 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.29 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.26 out of 27.18

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.28 out of 26.85

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor
MexT	Global virulence regulator

NZ_JAGFWR010000021.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 100,082 - 111,393 nt. (total: 11,312 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JQN83_RS25885: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Ligases: synthetase

JQN83_RS25905: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000664.5	0.42	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.40	terpene	isorenieratene	Streptomyces argillaceus
BGC0000648.3	0.40	terpene	carotenoid	Myxococcus xanthus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0000644.3	0.39	terpene	carotenoid	Dietzia sp. CQ4
BGC0000646.5	0.38	terpene	β-carotein	uncultured bacterium
BGC0002309.2	0.38	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000664.5	0.42	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.40	terpene	isorenieratene	Streptomyces argillaceus
BGC0000648.3	0.40	terpene	carotenoid	Myxococcus xanthus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0000644.3	0.39	terpene	carotenoid	Dietzia sp. CQ4
BGC0000646.5	0.38	terpene	β-carotein	uncultured bacterium
BGC0002309.2	0.38	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

JQN83_RS25905: PT_FPPS_like

Domain 1 (45 - 352): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Terpene

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

NZ_JAGFWR010000023.1 - Region 1 - NRPS,PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 34,081 nt. (total: 34,081 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

JQN83_RS26330: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

JQN83_RS26375: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

JQN83_RS26455: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: esterase hydrolase

JQN83_RS26360: thioesterase

smcogs: SMCOG1004: thioesterase

JQN83_RS26395: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

JQN83_RS26400: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

JQN83_RS26340: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

JQN83_RS26370: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.58	NRPS	dimethylcoprogen	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (16):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.34 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.88 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.34 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.09 out of 27.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.02 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.27 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.81 out of 39.62

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.08 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.88 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.66 out of 35.63

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.76 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.64 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.01 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 34081:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 23982:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS26370: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (455..844): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LHFTFDISALELQALSGGEHNVYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_JAGFWR010000028.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 39,654 nt. (total: 39,654 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

JQN83_RS28540: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: dehalogenase

JQN83_RS28430: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

JQN83_RS28545: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase

JQN83_RS28460: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQN83_RS28505: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQN83_RS28520: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.11 out of 25.31

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (8):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.17 out of 29.51

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 22.66 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.72 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.35 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.93 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.38 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.39 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.27 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 39654:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS28460: X

AMP-binding (480..879): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YPFAFDLCQAETGAFTGGEVNGYGPTEAAIGVTL
Nearest Stachelhaus code(s):: Z-ahmohOrn DVDGGGGIGK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

JQN83_RS28505: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (10..424): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWASFDFSVLDSSSIWCGDTNLYGPTETTVASSY
Nearest Stachelhaus code(s):: Val DALFVGLVAK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

JQN83_RS28520: X

AMP-binding (22..458): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NAILHDMGIGCATAIVGAELPAYGLAENTLVATG
Nearest Stachelhaus code(s):: Pca DMGVLGCLMK (74% 8Å match); Phe or Trp DVLSIGAVVK (44% 8Å match); Leu DALLIGAVVK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CatR	H2O2-responsive repressor

NZ_JAGFWR010000003.1 - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 1 - 66,577 nt. (total: 66,577 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

JQN83_RS08245: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JQN83_RS08280: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase

JQN83_RS08265: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase

JQN83_RS08275: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: cyclase

JQN83_RS08385: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

JQN83_RS08395: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Ligases: ligase synthase

JQN83_RS08290: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQN83_RS08310: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

JQN83_RS08335: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

JQN83_RS08340: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQN83_RS08350: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

JQN83_RS08365: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQN83_RS08370: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

JQN83_RS08375: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.61	PKS	spore pigment	Streptomyces avermitilis
BGC0001513.3	0.60	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000275.4	0.58	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001825.4	0.58	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000215.5	0.57	PKS	curamycin	Streptomyces cyaneus
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.61	PKS	spore pigment	Streptomyces avermitilis
BGC0001513.3	0.60	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000275.4	0.58	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001825.4	0.58	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000215.5	0.57	PKS	curamycin	Streptomyces cyaneus
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.89 out of 25.31

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.38 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (10):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.79 out of 30.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.15 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.23 out of 27.04

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.04 out of 23.43

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.97 out of 28.14

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.41 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.75 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.43 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

JQN83_RS08290: X

AMP-binding (21..428): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDFS--LASGQTFVNVGAGRIVYGLSEAVVICAQ
Nearest Stachelhaus code(s):: Hty DLGFTGCVTK (35% 8Å match); 3Me-Glu or Glu DLGKTGVVNK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

JQN83_RS08340: X

AMP-binding (48..432): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AHLLHTATVLMQFMFNTGD-----------VFTR
Nearest Stachelhaus code(s):: Trp GALFFAAGVK (24% 8Å match)
Stachelhaus code match:: 60% (weak)

JQN83_RS08365: X

AMP-binding (39..374): X

nrpys: Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ERYPH---VLGGVLTTGGEGNMYGMTEVGVIGTD
Nearest Stachelhaus code(s):: Phe DALVMGAVIK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 0 to 66577
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)

JQN83_RS08245: KR (Score: 37.7; E-value: 4e-12)
JQN83_RS08335: CLF (Score: 277.5; E-value: 3.9e-85)
JQN83_RS08370: CLF (Score: 487.2; E-value: 8.4e-149)
JQN83_RS08375: KS (Score: 703.2; E-value: 2.4e-214)
JQN83_RS08380: CYC C5-C18 (Score: 205.2; E-value: 6.9e-64)
JQN83_RS08385: CYC C9-C14 (Score: 238.4; E-value: 5.9e-74)
JQN83_RS08395: CYC C4-C21/C2-C23|C2-C19 (Score: 110.1; E-value: 1.2e-34)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAGFWR010000003.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 162,363 - 246,912 nt. (total: 84,550 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase synthase

JQN83_RS09030: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

JQN83_RS09095: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

JQN83_RS09100: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

JQN83_RS09150: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

JQN83_RS09225: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

JQN83_RS09275: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

JQN83_RS09285: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JQN83_RS09305: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

JQN83_RS09315: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

JQN83_RS09340: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase acyltransferase aminotransferase glycosyltransferase transferase

JQN83_RS09005: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

JQN83_RS09050: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

JQN83_RS09110: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

JQN83_RS09160: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

JQN83_RS09190: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

JQN83_RS09195: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

JQN83_RS09250: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

JQN83_RS09265: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: dehalogenase hydrolase synthase

JQN83_RS09030: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

JQN83_RS09165: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

JQN83_RS09270: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

JQN83_RS09290: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

JQN83_RS09310: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase

JQN83_RS09255: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.52	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.52	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.52	PKS	ACT-Toxin II	Alternaria alternata
BGC0000056.3	0.50	PKS	esperamicin	Actinomadura verrucosospora
BGC0000107.3	0.49	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002000.4	0.36	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0001275.3	0.34	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.34	PKS	asperlactone	Aspergillus ochraceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.77	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.67	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.67	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000056.3	0.66	PKS	esperamicin	Actinomadura verrucosospora
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000037.4	0.63	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.71 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.41 out of 20.97

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.42 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.07 out of 23.79

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.41 out of 23.43

Confidence: medium

Additional weak hits (30):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.04 out of 30.22

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.88 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.18 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.71 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.14 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.49 out of 19.26

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.00 out of 20.97

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.08 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.80 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.85 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.41 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.57 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.58 out of 35.63

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.20 out of 30.11

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.35 out of 20.01

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.69 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.89 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.73 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.57 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.46 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.25 out of 26.85

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.81 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.55 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 162362 - 246912:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 201578 - 246912:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS09110: mal

PKS_AT (619..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 60.4
inactive: 33.3
Methoxymalonyl-CoA: 33.0
Methylmalonyl-CoA: 28.6
Propionyl-CoA: 27.0
Isobutyryl-CoA: 16.7
CHC-CoA: 12.7
fatty_acid: 9.3
Ethylmalonyl-CoA: 5.6
2-Methylbutyryl-CoA: 4.6
trans-1,2-CPDA: 4.2
Acetyl-CoA: 3.5
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

JQN83_RS09250: mmal

PKS_AT (543..836): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Methylmalonyl-CoA: 75.0%; Propionyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 124.1
Methoxymalonyl-CoA: 96.5
Ethylmalonyl-CoA: 93.5
Malonyl-CoA: 70.6
trans-1,2-CPDA: 63.3
Propionyl-CoA: 57.6
2-Methylbutyryl-CoA: 52.7
CHC-CoA: 49.1
Isobutyryl-CoA: 42.1
Benzoyl-CoA: 37.4
Acetyl-CoA: 26.3
fatty_acid: 24.5
inactive: 22.0
3-Methylbutyryl-CoA: 18.5

JQN83_RS09255: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (41..454): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: MRALYPMAGPGGSLQVAGSQQVYGMAEGLLCLTR
Nearest Stachelhaus code(s):: Hpa TWPSQGVLCK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism

NZ_JAGFWR010000003.1 - Region 3 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 393,108 - 471,893 nt. (total: 78,786 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JQN83_RS09995: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

JQN83_RS10030: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JQN83_RS10055: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

JQN83_RS10050: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

JQN83_RS10060: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase phosphatase

JQN83_RS10070: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

JQN83_RS10100: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Ligases: ligase synthase

JQN83_RS09945: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQN83_RS09950: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQN83_RS09955: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQN83_RS09960: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQN83_RS10000: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.38	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.38	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.38	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.37	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001876.2	0.37	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328
BGC0000342.4	0.36	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.36	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.36	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.35	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.34	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001050.5	0.68	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.61 out of 23.43

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.88 out of 29.72

Confidence: medium

Additional weak hits (26):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.38 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.93 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.13 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.82 out of 30.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.55 out of 25.88

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.17 out of 26.85

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.04 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.11 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.07 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.59 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.31 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.53 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.54 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.70 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.43 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.19 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.68 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.69 out of 23.43

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.33 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 393107 - 471893:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (mal) + (Gly) + (Asp)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 393107 - 443644:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly) + (Asp)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 430041 - 471893:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Me-mal)
Non-colinear ordering:: JQN83_RS10050 + JQN83_RS10060 + JQN83_RS10065

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS09950: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (536..929): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGVQFDFAVTVLKIILGGEFNHYGPTEATVGVAT
Nearest Stachelhaus code(s):: Asp DLTKIGHVGK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

JQN83_RS09955: X

AMP-binding (19..403): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GHHFTNAGQTMNFVGSTAAVNYYTSTEAAPAQTT
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

JQN83_RS09960: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (454..850): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LGVTFDISTVELQAVTGGEINGYGPTEATVYATM
Nearest Stachelhaus code(s):: Ala DIVQLGLVYK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

JQN83_RS10050: mal

PKS_AT (1218..1510): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 60.3
Methoxymalonyl-CoA: 29.0
inactive: 21.9
Methylmalonyl-CoA: 20.1
Propionyl-CoA: 12.9
trans-1,2-CPDA: 9.0
fatty_acid: 7.8
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

JQN83_RS10060: mmal

PKS_AT (632..832): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 9.1
Malonyl-CoA: 3.6
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
NtrC	Nitrogen regulatory protein C
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JAGFWR010000032.1 - Region 1 - PKS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 47,327 nt. (total: 47,327 nt) Show pHMM detection rules used

Region on contig edge.

PKS-like: (t2pks2 or ksIII)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

JQN83_RS29920: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JQN83_RS29940: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

JQN83_RS29965: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acylase glycosyltransferase methyltransferase

JQN83_RS29945: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

JQN83_RS29950: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

JQN83_RS29960: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

JQN83_RS29980: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

JQN83_RS30005: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: synthase

JQN83_RS29970: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002191.2	0.57	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.56	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919
BGC0002175.3	0.53	PKS	YWA1	Aspergillus oryzae RIB40

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

Additional weak hits (14):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.61 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.30 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.04 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.72 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.05 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.79 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.82 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.22 out of 32.74

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.52 out of 26.85

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.24 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.71 out of 36.53

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.61 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 47327:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 39984:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 859 - 47327:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS29980: mmal

PKS_AT (552..847): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 75.0%; Malonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 148.8
Methoxymalonyl-CoA: 117.4
Ethylmalonyl-CoA: 116.9
Isobutyryl-CoA: 102.0
Malonyl-CoA: 85.1
Benzoyl-CoA: 81.0
2-Methylbutyryl-CoA: 72.4
Propionyl-CoA: 69.4
Acetyl-CoA: 65.4
trans-1,2-CPDA: 65.2
CHC-CoA: 45.1
inactive: 40.3
3-Methylbutyryl-CoA: 33.2
fatty_acid: 31.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAGFWR010000037.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 1 - 18,736 nt. (total: 18,736 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.77	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.65	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.65	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.61	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.53	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.52	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000546.3	0.49	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0002111.3	0.48	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.77	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.65	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.65	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.61	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.53	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.52	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000546.3	0.49	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0002111.3	0.48	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for JQN83_RS31380

JQN83_RS31370

Leader:

MALLDLQAMELPATERTGGGSQ

JQN83_RS31375

Leader:

MALLDLQGMELPAAERTGGGSR

Shared core:

ASLLLCGDSSLSVTTCN

Core with dehydrations:

ADhaLLLCysGDDhaDhaLDhaVDhbDhbCysN

antiSMASH-DB 4.0 matches for JQN83_RS31370

100.0%

NC_015434.1and 117 others:

NC_018750.1 Lanthipeptides: SVEN_RS32110_lanthipeptideNC_018750.1 Lanthipeptides: SVEN_RS32110_lanthipeptideNZ_BBNO01000003.1 Lanthipeptides: TU31_RS37940_lanthipeptideNZ_BMSV01000002.1 Lanthipeptides: IE106_RS06150_lanthipeptideNZ_BMTO01000007.1 Lanthipeptides: IE136_RS15615_lanthipeptideNZ_BMTP01000009.1 Lanthipeptides: IE109_RS18470_lanthipeptideNZ_BMTU01000009.1 Lanthipeptides: IE118_RS22890_lanthipeptideNZ_BMUN01000001.1 Lanthipeptides: IE238_RS00740_lanthipeptideNZ_CP007699.2 Lanthipeptides: T261_RS39185_lanthipeptideNZ_CP009754.1 Lanthipeptides: NI25_RS05015_lanthipeptideNZ_CP015866.1 Lanthipeptides: Spa2297_RS27800_lanthipeptideNZ_CP017157.1 Lanthipeptides: SL103_RS15895_lanthipeptideNZ_CP019457.1 Lanthipeptides: BXT88_RS03410_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS35355_lanthipeptideNZ_CP019779.1 Lanthipeptides: STRMOE7_RS03775_lanthipeptideNZ_CP020042.1 Lanthipeptides: B4U46_RS32710_lanthipeptideNZ_CP023202.1 Lanthipeptides: SXIN_RS23100_lanthipeptideNZ_CP023691.1 Lanthipeptides: CP981_RS03050_lanthipeptideNZ_CP023692.1 Lanthipeptides: CP980_RS04735_lanthipeptideNZ_CP023700.1 Lanthipeptides: CP969_RS04700_lanthipeptideNZ_CP027299.1 Lanthipeptides: C1N79_RS34970_lanthipeptideNZ_CP028158.1 Lanthipeptides: C6361_RS04660_lanthipeptideNZ_CP028159.1 Lanthipeptides: C6W10_RS01185_lanthipeptideNZ_CP029042.1 Lanthipeptides: DDE74_RS03525_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029541.1 Lanthipeptides: DKG71_RS05245_lanthipeptideNZ_CP034279.1 Lanthipeptides: EIZ62_RS28660_lanthipeptideNZ_CP034353.1 Lanthipeptides: D1J63_RS04900_lanthipeptideNZ_CP039123.1 Lanthipeptides: E5N77_RS35250_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS09720_lanthipeptideNZ_CP045309.1 Lanthipeptides: GCE86_RS12520_lanthipeptideNZ_CP046104.1 Lanthipeptides: GKC29_RS19975_lanthipeptideNZ_CP046905.1 Lanthipeptides: GPZ77_RS32930_lanthipeptideNZ_CP047140.1 Lanthipeptides: GLX30_RS11420_lanthipeptideNZ_CP050976.1 Lanthipeptides: HEP86_RS04470_lanthipeptideNZ_CP054920.1 Lanthipeptides: HUT15_RS04615_lanthipeptideNZ_CP059322.1 Lanthipeptides: H1D33_RS20095_lanthipeptideNZ_CP059322.1 Lanthipeptides: H1D33_RS20090_lanthipeptideNZ_CP060825.1 Lanthipeptides: IAG43_RS32355_lanthipeptideNZ_CP074111.1 Lanthipeptides: KE639_RS31630_lanthipeptideNZ_CP084681.1 Lanthipeptides: KI385_RS00885_lanthipeptideNZ_CP085300.1 Lanthipeptides: LJA35_RS05220_lanthipeptideNZ_CP086217.1 Lanthipeptides: LJ741_RS03435_lanthipeptideNZ_CP092183.1 Lanthipeptides: COUCH_RS09775_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS09690_lanthipeptideNZ_CP098437.1 Lanthipeptides: NCG97_RS34740_lanthipeptideNZ_CP099468.1 Lanthipeptides: NFX46_RS16770_lanthipeptideNZ_CP101137.1 Lanthipeptides: M6G08_RS24535_lanthipeptideNZ_CP102332.1 Lanthipeptides: NRO40_RS01140_lanthipeptideNZ_CP102609.1 Lanthipeptides: NUT86_RS03980_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33560_lanthipeptideNZ_CP114202.1 Lanthipeptides: STRLI_RS35870_lanthipeptideNZ_CP114203.1 Lanthipeptides: STRNI_RS37360_lanthipeptideNZ_CP114205.1 Lanthipeptides: STRTU_RS33380_lanthipeptideNZ_FMCR01000005.1 Lanthipeptides: GA0070561_RS23835_lanthipeptideNZ_FMCS01000001.1 Lanthipeptides: GA0070214_RS02345_lanthipeptideNZ_FMCU01000002.1 Lanthipeptides: GA0070216_RS07020_lanthipeptideNZ_FMCU01000002.1 Lanthipeptides: GA0070216_RS07015_lanthipeptideNZ_FMCU01000002.1 Lanthipeptides: GA0070216_RS07010_lanthipeptideNZ_FMDM01000002.1 Lanthipeptides: GA0070213_RS04970_lanthipeptideNZ_FNHI01000003.1 Lanthipeptides: BLT82_RS06465_lanthipeptideNZ_HF570108.1 Lanthipeptides: MILUP08_RS22425_lanthipeptideNZ_JACHJE010000006.1 Lanthipeptides: FHS32_RS15850_lanthipeptideNZ_JACHJI010000005.1 Lanthipeptides: FHS37_RS15430_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACWAA010000001.1 Lanthipeptides: ICA23_RS00800_lanthipeptideNZ_JADMLH010000003.1 Lanthipeptides: IT780_RS09875_lanthipeptideNZ_JADMLH010000003.1 Lanthipeptides: IT780_RS09870_lanthipeptideNZ_JAFEJA010000002.1 Lanthipeptides: JE024_RS34830_lanthipeptideNZ_JAFEUO010000005.1 Lanthipeptides: JQN84_RS18770_lanthipeptideNZ_JAFEUO010000005.1 Lanthipeptides: JQN84_RS18765_lanthipeptideNZ_JAGFWR010000037.1 Lanthipeptides: JQN83_RS31375_lanthipeptideNZ_JAGFWR010000037.1 Lanthipeptides: JQN83_RS31370_lanthipeptideNZ_JAGGOI010000031.1 Lanthipeptides: J7E87_RS22160_lanthipeptideNZ_JAGPXN010000015.1 Lanthipeptides: KBX06_RS19685_lanthipeptideNZ_JAGPXN010000015.1 Lanthipeptides: KBX06_RS19680_lanthipeptideNZ_JAGPXW010000002.1 Lanthipeptides: KBX71_RS04195_lanthipeptideNZ_JAGPXX010000007.1 Lanthipeptides: KBZ10_RS10785_lanthipeptideNZ_JAGPYC010000033.1 Lanthipeptides: KBZ00_RS31440_lanthipeptideNZ_JAHLXF010000022.1 Lanthipeptides: KQY13_RS30555_lanthipeptideNZ_JAIHBQ010000001.1 Lanthipeptides: K4902_RS04515_lanthipeptideNZ_JAJJMU010000026.1 Lanthipeptides: LOC25_RS31275_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAPKNL010000004.1 Lanthipeptides: OSI21_RS07750_lanthipeptideNZ_JAPNLM010000003.1 Lanthipeptides: OTB16_RS07305_lanthipeptideNZ_JH993790.1 Lanthipeptides: STRVIR_RS0131905_lanthipeptideNZ_KN039948.1 Lanthipeptides: FM21_RS29525_lanthipeptideNZ_LIPF01000004.1 Lanthipeptides: AMK11_RS16660_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVX01000004.1 Lanthipeptides: AMK29_RS15650_lanthipeptideNZ_LIWB01000010.1 Lanthipeptides: AMK33_RS24360_lanthipeptideNZ_LIYH01000004.1 Lanthipeptides: AMK26_RS17765_lanthipeptideNZ_LT607409.1 Lanthipeptides: GA0070612_RS21605_lanthipeptideNZ_LT607733.1 Lanthipeptides: GA0070610_RS13855_lanthipeptideNZ_LT607733.1 Lanthipeptides: GA0070610_RS13850_lanthipeptideNZ_LT607752.1 Lanthipeptides: GA0070623_RS04340_lanthipeptideNZ_LT607752.1 Lanthipeptides: GA0070623_RS04335_lanthipeptideNZ_LT607752.1 Lanthipeptides: GA0070623_RS04330_lanthipeptideNZ_MPOH02000012.1 Lanthipeptides: BM536_RS17150_lanthipeptideNZ_NBCN01000003.1 Lanthipeptides: BKD26_RS06570_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_QGGR01000008.1 Lanthipeptides: BC793_RS19230_lanthipeptideNZ_RAIF01000032.1 Lanthipeptides: EBH09_RS35480_lanthipeptideNZ_RBAK01000011.1 Lanthipeptides: D7223_RS24620_lanthipeptideNZ_SOPG01000008.1 Lanthipeptides: E0I08_RS17090_lanthipeptide

Lanthipeptides: VAB18032_RS17930_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLSVTTCN

1

ASLLLCGDSSLSVTTCN

17

94.1%

NZ_BBOL01000008.1and 7 others:

NZ_BBOL01000008.1 Lanthipeptides: LPU61_RS25375_lanthipeptideNZ_CP058322.1 Lanthipeptides: HXZ27_RS14120_lanthipeptideNZ_CP058322.1 Lanthipeptides: HXZ27_RS14115_lanthipeptideNZ_FMCT01000009.1 Lanthipeptides: GA0070563_RS21095_lanthipeptideNZ_FMCT01000009.1 Lanthipeptides: GA0070563_RS21090_lanthipeptideNZ_FMCW01000007.1 Lanthipeptides: GA0070558_RS08825_lanthipeptideNZ_FMCW01000007.1 Lanthipeptides: GA0070558_RS08820_lanthipeptide

Lanthipeptides: LPU61_RS25380_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDS LSVTTCN

1

ASLLLCGDSGLSVTTCN

17

94.1%

NZ_BMQY01000002.1and 1 other:

NZ_PGGW01000069.1 Lanthipeptides: CUT44_RS29865_lanthipeptide

Lanthipeptides: IEY99_RS07885_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLSVTTC+

1

ASLLLCGDSSLSVTTCD

17

with 47 more sequence matches

Only the first 10 are displayed here.

88.2%

NZ_CP045309.1and 1 other:

NZ_LT607410.1 Lanthipeptides: GA0074696_RS16340_lanthipeptide

Lanthipeptides: GCE86_RS12515_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLS+TTC

1

ASLLLCGDSSLSITTCK

17

88.2%

NZ_CP118615.1:

Lanthipeptides: PVK37_RS22580_lanthipeptide

2

SLLLCGDSSLSVTTCN

17

SLLLCGDSSLS+TTCN

1

SLLLCGDSSLSLTTCN

16

88.2%

NZ_FMCS01000001.1:

Lanthipeptides: GA0070214_RS02340_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLS+TTC

1

ASLLLCGDSSLSLTTCK

17

88.2%

NZ_LT607410.1:

Lanthipeptides: GA0074696_RS16335_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLS+TTC+

1

ASLLLCGDSSLSITTCH

17

84.2%

NZ_BMXJ01000002.1and 3 others:

NZ_CP099837.1 Lanthipeptides: NE857_RS18075_lanthipeptideNZ_KI911536.1 Lanthipeptides: B042_RS0117070_lanthipeptideNZ_VWVU01000023.1 Lanthipeptides: FYX01_RS21045_lanthipeptide

Lanthipeptides: IE195_RS04480_lanthipeptide

1

ASLLLCGDSSLSVTTC

16

ASLLLCGDSSLSVTTC

4

ASLLLCGDSSLSVTTC

19

80.0%

NZ_CP077658.1and 1 other:

NZ_JACHJG010000001.1 Lanthipeptides: FHS38_RS02665_lanthipeptide

Lanthipeptides: KQY30_RS33045_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLSV TCN

4

ASLLLCGDSSLSVVTCN

20

77.8%

NZ_CP086120.1:

Lanthipeptides: test1122_RS04940_lanthipeptide

1

ASLLLCGDSSLSVTTC

16

ASLLLCGDSS+S+TTC

3

ASLLLCGDSSVSLTTC

18

76.2%

NZ_BBOK01000011.1and 50 others:

NZ_BEWD01000001.1 Lanthipeptides: Sru02f_RS01660_lanthipeptideNZ_BMSL01000016.1 Lanthipeptides: IE215_RS23330_lanthipeptideNZ_BMUC01000023.1 Lanthipeptides: IE172_RS32210_lanthipeptideNZ_BMVE01000003.1 Lanthipeptides: IE248_RS10435_lanthipeptideNZ_BMVL01000005.1 Lanthipeptides: IE257_RS16230_lanthipeptideNZ_BMVQ01000005.1 Lanthipeptides: IE283_RS17035_lanthipeptideNZ_BMWI01000025.1 Lanthipeptides: IE253_RS33945_lanthipeptideNZ_CM002280.1 Lanthipeptides: M877_RS44575_lanthipeptideNZ_CP011664.1 Lanthipeptides: M444_RS30240_lanthipeptideNZ_CP012382.1 Lanthipeptides: SAM23877_RS30085_lanthipeptideNZ_CP012949.1 Lanthipeptides: SAM40697_RS29010_lanthipeptideNZ_CP018047.1 Lanthipeptides: BBN63_RS03065_lanthipeptideNZ_CP020039.1 Lanthipeptides: B4U39_RS34445_lanthipeptideNZ_CP020555.1 Lanthipeptides: B6R96_RS03515_lanthipeptideNZ_CP023701.1 Lanthipeptides: CP968_RS29065_lanthipeptideNZ_CP024087.1 Lanthipeptides: CSH63_RS05810_lanthipeptideNZ_CP029189.1 Lanthipeptides: DEJ51_RS31910_lanthipeptideNZ_CP030286.1 Lanthipeptides: DRB89_RS16930_lanthipeptideNZ_CP033581.1 Lanthipeptides: EES41_RS31595_lanthipeptideNZ_CP034350.1 Lanthipeptides: D1J60_RS32970_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS34495_lanthipeptideNZ_CP043638.1 Lanthipeptides: F1D59_RS34930_lanthipeptideNZ_CP043959.1 Lanthipeptides: F3L20_RS19105_lanthipeptideNZ_CP045547.1 Lanthipeptides: GEV49_RS05730_lanthipeptideNZ_CP048397.1 Lanthipeptides: SSPS47_RS31455_lanthipeptideNZ_CP054939.1 Lanthipeptides: HUT14_RS29815_lanthipeptideNZ_CP094918.1 Lanthipeptides: MTR79_RS16715_lanthipeptideNZ_CP115936.1 Lanthipeptides: PET44_RS28650_lanthipeptideNZ_CP116355.1 Lanthipeptides: KPP03845_RS32700_lanthipeptideNZ_GG657756.1 Lanthipeptides: SSPG_RS05020_lanthipeptideNZ_GG657758.1 Lanthipeptides: SSRG_RS03855_lanthipeptideNZ_JAAALO010000001.1 Lanthipeptides: GVV04_RS02250_lanthipeptideNZ_JAAIFS010000001.1 Lanthipeptides: GUR47_RS02255_lanthipeptideNZ_JACHEM010000005.1 Lanthipeptides: HNQ79_RS11445_lanthipeptideNZ_JAFLQY010000003.1 Lanthipeptides: J0X20_RS29030_lanthipeptideNZ_JAINUL010000001.1 Lanthipeptides: K7B10_RS06210_lanthipeptideNZ_JANAVF010000017.1 Lanthipeptides: NLX94_RS31205_lanthipeptideNZ_KZ195574.1 Lanthipeptides: B9W62_RS05695_lanthipeptideNZ_LIVP01000027.1 Lanthipeptides: AMK15_RS28680_lanthipeptideNZ_LT629768.1 Lanthipeptides: BLU60_RS34110_lanthipeptideNZ_LWLD01000038.1 Lanthipeptides: A6A28_RS28600_lanthipeptideNZ_ML123038.1 Lanthipeptides: EES37_RS30340_lanthipeptideNZ_MQUH01000025.1 Lanthipeptides: BSZ07_RS33280_lanthipeptideNZ_NNBM01000002.1 Lanthipeptides: CG724_RS07855_lanthipeptideNZ_RAII01000001.1 Lanthipeptides: EBH12_RS10360_lanthipeptideNZ_RSEG01000006.1 Lanthipeptides: EIA57_RS12710_lanthipeptideNZ_SOAV01000001.1 Lanthipeptides: EV562_RS04520_lanthipeptideNZ_VIUV01000020.1 Lanthipeptides: FB570_RS34060_lanthipeptideNZ_WHZR01000001.1 Lanthipeptides: STPH1_RS04005_lanthipeptideNZ_WXVT01000001.1 Lanthipeptides: STPH2_RS03995_lanthipeptide

Lanthipeptides: APK71_RS25550_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLS+TTCN

5

ASLLLCGDSSLSITTCN

21

76.2%

NZ_BNCA01000002.1and 1 other:

NZ_CP049782.1 Lanthipeptides: G7Z12_RS34445_lanthipeptide

Lanthipeptides: IE314_RS02760_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLSV+TCN

5

ASLLLCGDSSLSVSTCN

21

76.2%

NZ_CP036455.1and 1 other:

NZ_JAEIOJ010000010.1 Lanthipeptides: IMZ35_RS23775_lanthipeptide

Lanthipeptides: EKD16_RS17975_lanthipeptide

1

ASLLLCGDSSLSVTTCN

17

ASLLLCGDSSLS+TTCN

5

ASLLLCGDSSLSLTTCN

21

MIBiG 4.0 matches for JQN83_RS31370

45.5%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

1

ASLLLCGDSSLSVTTCN

17

SLL+C SSLSV C

5

VSLLVCEYSSLSVVLCT

21

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.89 out of 29.51

Confidence: medium

Additional weak hits (3):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.33 out of 30.97

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 25.75

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

JQN83_RS31370 - Class III

Cleavage pHMM score: 14.40

RODEO score: 0

Monoisotopic mass: 1574.8 Da

Molecular weight: 1575.8 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1593.8 Da N = 1; 1611.8 Da N = 2; 1629.8 Da N = 3; 1647.9 Da N = 4

JQN83_RS31375 - Class III

Cleavage pHMM score: 14.20

RODEO score: 0

Monoisotopic mass: 1574.8 Da

Molecular weight: 1575.8 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1593.8 Da N = 1; 1611.8 Da N = 2; 1629.8 Da N = 3; 1647.9 Da N = 4

TFBS definitions

Regulator	Description
DosR	Hypoxia stress response regulator

NZ_JAGFWR010000004.1 - Region 1 - linaridin

Download region GenBank file

Download region SVG

Location: 38,634 - 59,200 nt. (total: 20,567 nt) Show pHMM detection rules used

linaridin: (cypemycin or cypI)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JQN83_RS10300: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

JQN83_RS10315: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

JQN83_RS10325: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: dehalogenase

JQN83_RS10335: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001735.5	0.53	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0001188.3	0.48	ribosomal	legonaridin	Streptomyces sp. CT34
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002496.3	0.41	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000500.5	0.40	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001862.4	0.40	ribosomal	pallidocin	Aeribacillus pallidus
BGC0001407.5	0.39	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000709.5	0.39	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001735.5	0.53	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0001188.3	0.48	ribosomal	legonaridin	Streptomyces sp. CT34
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002496.3	0.41	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000500.5	0.40	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001862.4	0.40	ribosomal	pallidocin	Aeribacillus pallidus
BGC0001407.5	0.39	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000709.5	0.39	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.70 out of 26.85

Confidence: medium

Additional weak hits (16):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.34 out of 32.74

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.48 out of 25.88

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.53 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.52 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.03 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.30 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.22 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.22 out of 36.53

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.81 out of 18.57

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.45 out of 36.53

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.74 out of 28.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.89 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.73 out of 24.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_JAGFWR010000004.1 - Region 2 - NRPS,PKS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 73,219 - 131,330 nt. (total: 58,112 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

JQN83_RS10485: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

JQN83_RS10495: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

JQN83_RS10505: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acylase transferase

JQN83_RS10470: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

JQN83_RS10535: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: phosphatase

JQN83_RS10510: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Ligases: ligase synthase

JQN83_RS10475: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

JQN83_RS10480: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

JQN83_RS10540: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	1.04	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	1.03	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.92	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.92	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.91	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.90	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.87	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.86	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.84	PKS	FR901512	fungal sp. No.14919
BGC0000065.5	0.82	PKS	rustmicin	Streptomyces galbus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.68	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.61	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.71 out of 26.33

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.31 out of 18.57

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.49 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (21):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.65 out of 32.93

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.32 out of 20.01

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.67 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.18 out of 18.57

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.62 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.00 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.50 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.63 out of 26.06

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.39 out of 23.43

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.30 out of 26.85

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.87 out of 32.93

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.01 out of 27.55

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.01 out of 32.93

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.68 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.17 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.92 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.77 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 73218 - 131330:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mxmal) + (NH2 - Me-mal)
Non-colinear ordering:: JQN83_RS10470 + JQN83_RS10540

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 73218 - 114238:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mxmal) + (NH2 - Me-mal)
Non-colinear ordering:: JQN83_RS10470 + JQN83_RS10540

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 85261 - 131330:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mxmal) + (NH2 - Me-mal)
Non-colinear ordering:: JQN83_RS10470 + JQN83_RS10540

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS10470: mxmal

PKS_AT (15..292): mxmal

ATSignature: (unknown)

No matches above 50%

minowa: Methoxymalonyl-CoA

Prediction, score:

Methoxymalonyl-CoA: 28.3
Methylmalonyl-CoA: 20.8
Malonyl-CoA: 17.1
Propionyl-CoA: 5.8
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

JQN83_RS10540: NH2 - mmal

CAL_domain (36..458): NH2

minowa: NH2

Prediction, score:

NH2: 122.3
Acetyl-CoA: 42.7
fatty_acid: 29.7
AHBA: -3.6
shikimic_acid: -4.0

PKS_AT (1154..1449): mmal

ATSignature: Ethylmalonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 70.8%; Methylmalonyl-CoA: 70.8%; Malonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 139.1
Methoxymalonyl-CoA: 118.0
Ethylmalonyl-CoA: 113.3
Malonyl-CoA: 93.2
2-Methylbutyryl-CoA: 76.2
Propionyl-CoA: 73.9
Isobutyryl-CoA: 69.1
CHC-CoA: 63.8
trans-1,2-CPDA: 59.6
Acetyl-CoA: 49.6
Benzoyl-CoA: 42.5
fatty_acid: 37.6
3-Methylbutyryl-CoA: 20.7
inactive: 16.4

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAGFWR010000004.1 - Region 3 - NRPS,T1PKS,lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 364,796 - 403,823 nt. (total: 39,028 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: esterase

JQN83_RS11755: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase

JQN83_RS11790: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: ligase synthase

JQN83_RS11775: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQN83_RS11780: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.90	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.90	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.89	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.89	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.88	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.88	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.87	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.85	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001257.3	0.85	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.85	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for JQN83_RS11790

allorf_403155_403262

Leader:

MTAAGERGGRRGGLELRHTAAG

Core:

TITALCGRRLSTH

Core with dehydrations:

DhbIDhbALCysGRRLDhaDhbH

antiSMASH-DB 4.0 matches for allorf_403155_403262

100.0%

NZ_JAGFWR010000004.1:

Lanthipeptides: allorf_403155_403262_lanthipeptide

1

TITALCGRRLSTH

13

TITALCGRRLSTH

1

TITALCGRRLSTH

13

allorf_403225_403389

Leader:

MGSRRAPQVRVVSARRNQIGAELVVGEDIMGA

Core:

NLGICCGHVLISAYSNVGRTAR

Core with dehydrations:

NLGICysCysGHVLIDhaAYDhaNVGRDhbAR

antiSMASH-DB 4.0 matches for allorf_403225_403389

100.0%

NZ_JAGFWR010000004.1:

Lanthipeptides: allorf_403225_403389_lanthipeptide

1

NLGICCGHVLISAYSNVGRTAR

22

NLGICCGHVLISAYSNVGRTAR

1

NLGICCGHVLISAYSNVGRTAR

22

allorf_403554_403718

Leader:

MGAARIGGG

Core:

NGRAQVPSSTSHHDAMLRTPVASQSVCRIRRAANLDDAPIEVKGC

Core with dehydrations:

NGRAQVPDhaDhaDhbDhaHHDAMLRDhbPVADhaQDhaVCysRIRRAANLDDAPIEVKGCys

antiSMASH-DB 4.0 matches for allorf_403554_403718

100.0%

NZ_JAGFWR010000004.1:

Lanthipeptides: allorf_403554_403718_lanthipeptide

1

NGRAQVPSSTSHHDAMLRTPVASQSVCRIRRAANLDDAPIEVKGC

45

NGRAQVPSSTSHHDAMLRTPVASQSVCRIRRAANLDDAPIEVKGC

1

NGRAQVPSSTSHHDAMLRTPVASQSVCRIRRAANLDDAPIEVKGC

45

17.8%

NZ_CP011130.1and 3 others:

NZ_CP023465.1 Lanthipeptides: allorf_4132106_4132282_lanthipeptideNZ_CP094357.1 Lanthipeptides: allorf_4140933_4141109_lanthipeptideNZ_KQ061217.1 Lanthipeptides: allorf_2978721_2978897_lanthipeptide

Lanthipeptides: allorf_4090286_4090462_lanthipeptide

7

PSSTSHHDA

15

PSSTSHH A

1

PSSTSHHHA

9

17.8%

NZ_CP047935.1:

Lanthipeptides: allorf_0499838_0500005_lanthipeptide

1

NGRAQVPSSTSHHDAMLRTPVASQ

24

N P++T HH A T + Q

7

NDSGNRPANTEHHTAFHATYIYEQ

30

with 2 more sequence matches

15.4%

NZ_JABDRV010000001.1and 1 other:

NZ_JAEDVW010000007.1 Lanthipeptides: allorf_22564_22716_lanthipeptide

Lanthipeptides: allorf_0223350_0223580_lanthipeptide

27

CRIRRAANLDDAPIEVKG

44

CR+RR A+ AP G

26

CRVRRTAHASKAPSSPHG

43

13.3%

NZ_CP096658.1:

Lanthipeptides: allorf_3198246_3198419_lanthipeptide

21

VASQSVCRIRRAAN

34

V+SQS+C ++ A

11

VSSQSICSLKGTAT

24

MIBiG 4.0 matches for allorf_403554_403718

8.9%

BGC0002130.3 (QKI29070.1):

Lanthipeptide: cacaoidin

27

CRIRRAANLDDAPIEVKGC

45

C I + + + GC

5

CTIYASVSASISATASWGC

23

allorf_403616_403708

Leader:

MTSIGASSRFA

Core:

ARRIRQTDCEATGVRSIAS

Core with dehydrations:

ARRIRQDhbDCysEADhbGVRDhaIADha

antiSMASH-DB 4.0 matches for allorf_403616_403708

100.0%

NZ_JAGFWR010000004.1:

Lanthipeptides: allorf_403616_403708_lanthipeptide

1

ARRIRQTDCEATGVRSIAS

19

ARRIRQTDCEATGVRSIAS

1

ARRIRQTDCEATGVRSIAS

19

10.6%

NZ_AP026714.1and 3 others:

NZ_KZ845958.1 Lanthipeptides: allorf_1543253_1543444_lanthipeptideNZ_NGMP01000002.1 Lanthipeptides: allorf_000672_000863_lanthipeptideNZ_NGMV01000001.1 Lanthipeptides: allorf_1658195_1658386_lanthipeptide

Lanthipeptides: allorf_1208948_1209139_lanthipeptide

4

IRQTDCE

10

IR++DCE

41

IRESDCE

47

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.51 out of 23.79

Confidence: medium

Additional weak hits (7):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.86 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.53 out of 31.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.14 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.27 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

allorf_403155_403262 - Class II

Cleavage pHMM score: -2.90

RODEO score: 0

Monoisotopic mass: 1355.8 Da

Molecular weight: 1356.6 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1374.6 Da N = 1; 1392.6 Da N = 2; 1410.6 Da N = 3

allorf_403225_403389 - Class II

Cleavage pHMM score: -2.80

RODEO score: 0

Monoisotopic mass: 2249.2 Da

Molecular weight: 2250.6 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2268.6 Da N = 1

allorf_403554_403718 - Class II

Cleavage pHMM score: -5.00

RODEO score: 0

Monoisotopic mass: 4687.4 Da

Molecular weight: 4690.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4708.3 Da N = 1; 4726.3 Da N = 2; 4744.3 Da N = 3; 4762.3 Da N = 4; 4780.3 Da N = 5

allorf_403616_403708 - Class II

Cleavage pHMM score: -6.30

RODEO score: 0

Monoisotopic mass: 2017.1 Da

Molecular weight: 2018.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2036.3 Da N = 1; 2054.3 Da N = 2; 2072.3 Da N = 3

Predicted core structure(s)

For candidate cluster 5, location 364795 - 403823:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS11775: X - X

AMP-binding (37..427): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FANAFDVSVAETEVPLGGEINNYGPTETTVTATM
Nearest Stachelhaus code(s):: Asn DVAMAGMVTK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1078..1499): X

nrpys: Glu, Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWYSHDPVLRDVHSATGGDVALYGATETPQAMAW
Nearest Stachelhaus code(s):: Asp DPRHLALLAK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

JQN83_RS11780: mal

PKS_AT (535..817): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 168.9
inactive: 96.4
Methoxymalonyl-CoA: 71.2
Methylmalonyl-CoA: 67.5
Ethylmalonyl-CoA: 47.6
Propionyl-CoA: 40.5
2-Methylbutyryl-CoA: 31.3
Benzoyl-CoA: 29.4
Isobutyryl-CoA: 25.6
trans-1,2-CPDA: 24.8
CHC-CoA: 22.0
fatty_acid: 18.1
Acetyl-CoA: 14.7
3-Methylbutyryl-CoA: 10.9

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JAGFWR010000040.1 - Region 1 - phenazine

Download region GenBank file

Download region SVG

Location: 18,426 - 29,488 nt. (total: 11,063 nt) Show pHMM detection rules used

Region on contig edge.

phenazine: phzB

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

JQN83_RS31905: isochorismatase

smcogs: SMCOG1027: isochorismatase

JQN83_RS31925: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Isomerases: isomerase

JQN83_RS31910: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002561.3	0.52	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0000936.5	0.51	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1
BGC0002439.3	0.48	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0001868.4	0.48	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001080.5	0.45	other (phenazine)	endophenazine A, endophenazine B	Streptomyces anulatus
BGC0001221.5	0.45	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0000885.3	0.45	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000343.5	0.43	NRPS	enterobactin	Pseudomonas sp. J465
BGC0000846.5	0.43	other (other)	tabtoxin	Pseudomonas syringae
BGC0001302.5	0.41	other (other)	lomofungin	Streptomyces lomondensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002561.3	0.52	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0000936.5	0.51	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1
BGC0002439.3	0.48	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0001868.4	0.48	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001080.5	0.45	other (phenazine)	endophenazine A, endophenazine B	Streptomyces anulatus
BGC0001221.5	0.45	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0000885.3	0.45	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000343.5	0.43	NRPS	enterobactin	Pseudomonas sp. J465
BGC0000846.5	0.43	other (other)	tabtoxin	Pseudomonas syringae
BGC0001302.5	0.41	other (other)	lomofungin	Streptomyces lomondensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 19.26

Confidence: medium

Additional weak hits (2):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.20 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_JAGFWR010000046.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 9,182 nt. (total: 9,182 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JQN83_RS32350: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

JQN83_RS32355: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

JQN83_RS32360: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.67	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.67	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000041.3	0.63	PKS	oronofacic acid	Pseudomonas syringae
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.67	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.67	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000041.3	0.63	PKS	oronofacic acid	Pseudomonas syringae
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 9182:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (mal)
Non-colinear ordering:: JQN83_RS32360 + JQN83_RS32355

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS32355: mal

PKS_AT (569..870): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 195.2
inactive: 104.8
Methoxymalonyl-CoA: 77.2
Methylmalonyl-CoA: 63.2
Isobutyryl-CoA: 32.4
Ethylmalonyl-CoA: 27.0
Acetyl-CoA: 26.5
Propionyl-CoA: 23.5
fatty_acid: 22.4
Benzoyl-CoA: 18.2
trans-1,2-CPDA: 15.0
2-Methylbutyryl-CoA: 14.3
3-Methylbutyryl-CoA: 13.9
CHC-CoA: 5.7

JQN83_RS32360: mmal

PKS_AT (525..821): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 204.2
Ethylmalonyl-CoA: 195.6
Methoxymalonyl-CoA: 170.1
2-Methylbutyryl-CoA: 169.5
Propionyl-CoA: 136.0
trans-1,2-CPDA: 129.3
Malonyl-CoA: 115.1
CHC-CoA: 103.3
Benzoyl-CoA: 69.0
Isobutyryl-CoA: 63.1
Acetyl-CoA: 62.2
3-Methylbutyryl-CoA: 31.8
inactive: 29.1
fatty_acid: 25.4

Link to PARAS substrate predictor

NZ_JAGFWR010000047.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 9,108 nt. (total: 9,108 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: dehalogenase

JQN83_RS32365: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002295.3	0.62	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002174.2	0.60	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002295.3	0.62	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002174.2	0.60	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.19 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.65 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 9108:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS32385: Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (36..433): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QWLTFDAAQWEAQCFTGGEVNLYGPTECTINSSA
Nearest Stachelhaus code(s):: Gln DAWQFGLINK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_JAGFWR010000048.1 - Region 1 - PKS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 7,478 nt. (total: 7,478 nt) Show pHMM detection rules used

Region on contig edge.

PKS-like: (t2pks2 or ksIII)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

JQN83_RS32410: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase

JQN83_RS32405: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

JQN83_RS32415: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002175.3	0.54	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002154.2	0.54	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.54	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000107.3	0.53	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001258.3	0.53	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002191.2	0.53	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000037.4	0.53	PKS	cichorine	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001258.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.67 out of 25.31

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 7478:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS32415: mal

PKS_AT (539..836): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 199.2
inactive: 96.3
Methoxymalonyl-CoA: 52.9
Methylmalonyl-CoA: 35.5
Propionyl-CoA: 26.7
Isobutyryl-CoA: 22.8
2-Methylbutyryl-CoA: 9.8
Acetyl-CoA: 9.3
CHC-CoA: 5.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -4.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_JAGFWR010000005.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 237,763 - 249,697 nt. (total: 11,935 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.39	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001157.6	0.36	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.36	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0000470.6	0.36	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.34	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0001753.3	0.32	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0001441.5	0.31	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0000598.5	0.31	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001148.5	0.27	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0002358.3	0.19	PKS	cyclofaulknamycin	Streptomyces albidoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.39	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001157.6	0.36	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.36	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0000470.6	0.36	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.34	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0001753.3	0.32	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0001441.5	0.31	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0000598.5	0.31	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001148.5	0.27	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0002358.3	0.19	PKS	cyclofaulknamycin	Streptomyces albidoflavus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.65 out of 23.43

Confidence: medium

Additional weak hits (7):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.83 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.39 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.00 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.01 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.51 out of 27.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.91 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
BldD	Development and antibiotic global regulator

NZ_JAGFWR010000054.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 2,984 nt. (total: 2,984 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

JQN83_RS32525: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.57	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002171.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000393.5	0.50	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0002749.2	0.46	NRPS, PKS	aspcandine	Aspergillus candidus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.57	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002171.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000393.5	0.50	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0002749.2	0.46	NRPS, PKS	aspcandine	Aspergillus candidus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

JQN83_RS32525: mal

PKS_AT (516..805): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 148.8
Methoxymalonyl-CoA: 64.9
inactive: 59.2
Methylmalonyl-CoA: 47.4
Isobutyryl-CoA: 35.4
Propionyl-CoA: 29.4
Benzoyl-CoA: 17.8
Acetyl-CoA: 17.2
Ethylmalonyl-CoA: 17.1
fatty_acid: 12.3
2-Methylbutyryl-CoA: 10.5
CHC-CoA: 9.2
3-Methylbutyryl-CoA: 8.8
trans-1,2-CPDA: 0.0

Link to PARAS substrate predictor

NZ_JAGFWR010000006.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 80,116 - 161,865 nt. (total: 81,750 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

JQN83_RS13700: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JQN83_RS13760: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

JQN83_RS13810: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

JQN83_RS13815: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JQN83_RS13850: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

JQN83_RS33080: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

JQN83_RS13765: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

JQN83_RS13775: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

JQN83_RS13795: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

JQN83_RS33805: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.66	PKS	oronofacic acid	Pseudomonas syringae
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000067.5	0.63	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.66	PKS	oronofacic acid	Pseudomonas syringae
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000067.5	0.63	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.96 out of 30.22

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (18):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.40 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.34 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.16 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.60 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.19 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.16 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.92 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.83 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.33 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.43 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.46 out of 24.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.14 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.67 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.20 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.06 out of 27.04

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 80115 - 161865:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - Me-redmal) + (mal - ccmal) + (ccmal - ccmal) + (ohmal) + (mal)
Non-colinear ordering:: JQN83_RS13795 + JQN83_RS33080 + JQN83_RS13775 + JQN83_RS33805 + JQN83_RS13765

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS13765: mal

PKS_AT (557..847): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 143.0
Methoxymalonyl-CoA: 57.2
inactive: 56.2
Methylmalonyl-CoA: 56.0
Propionyl-CoA: 41.5
CHC-CoA: 24.4
fatty_acid: 19.2
Ethylmalonyl-CoA: 18.9
2-Methylbutyryl-CoA: 13.5
Isobutyryl-CoA: 13.3
trans-1,2-CPDA: 11.7
Acetyl-CoA: 10.7
Benzoyl-CoA: 8.0
3-Methylbutyryl-CoA: 0.0

JQN83_RS33805: mal

PKS_AT (584..850): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 172.9
Methoxymalonyl-CoA: 65.2
Methylmalonyl-CoA: 63.1
inactive: 59.9
Propionyl-CoA: 39.4
Ethylmalonyl-CoA: 26.8
Acetyl-CoA: 21.8
Benzoyl-CoA: 21.6
CHC-CoA: 20.4
trans-1,2-CPDA: 16.4
Isobutyryl-CoA: 16.0
fatty_acid: 15.9
2-Methylbutyryl-CoA: 5.3
3-Methylbutyryl-CoA: 0.0

JQN83_RS13775: mal - mal

PKS_AT (587..854): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 164.0
Methoxymalonyl-CoA: 65.8
Methylmalonyl-CoA: 63.9
inactive: 59.5
Propionyl-CoA: 34.2
Ethylmalonyl-CoA: 29.0
Acetyl-CoA: 24.4
Isobutyryl-CoA: 21.9
Benzoyl-CoA: 17.7
CHC-CoA: 17.1
fatty_acid: 16.0
trans-1,2-CPDA: 13.4
2-Methylbutyryl-CoA: 11.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (2296..2563): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 160.5
Methoxymalonyl-CoA: 63.9
Methylmalonyl-CoA: 62.9
inactive: 56.9
Acetyl-CoA: 28.8
Propionyl-CoA: 24.8
Ethylmalonyl-CoA: 24.3
Isobutyryl-CoA: 21.8
CHC-CoA: 20.8
Benzoyl-CoA: 18.5
fatty_acid: 17.3
trans-1,2-CPDA: 14.4
2-Methylbutyryl-CoA: 12.6
3-Methylbutyryl-CoA: 0.0

JQN83_RS33080: mal - mal

PKS_AT (567..834): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 167.7
Methoxymalonyl-CoA: 66.6
Methylmalonyl-CoA: 65.7
inactive: 59.1
Propionyl-CoA: 36.9
Ethylmalonyl-CoA: 32.7
Acetyl-CoA: 24.2
Isobutyryl-CoA: 22.8
CHC-CoA: 20.5
fatty_acid: 19.7
Benzoyl-CoA: 18.6
trans-1,2-CPDA: 15.0
2-Methylbutyryl-CoA: 11.7
3-Methylbutyryl-CoA: 0.0

PKS_AT (1848..2131): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 171.6
inactive: 78.4
Methoxymalonyl-CoA: 55.9
Methylmalonyl-CoA: 52.2
Propionyl-CoA: 28.9
Isobutyryl-CoA: 24.4
Benzoyl-CoA: 19.2
CHC-CoA: 18.7
Acetyl-CoA: 15.0
fatty_acid: 14.8
Ethylmalonyl-CoA: 10.4
2-Methylbutyryl-CoA: 10.3
trans-1,2-CPDA: 9.6
3-Methylbutyryl-CoA: 0.0

JQN83_RS13795: mal - mal - mmal

PKS_AT (503..776): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 176.7
inactive: 72.4
Methylmalonyl-CoA: 65.2
Methoxymalonyl-CoA: 60.4
Isobutyryl-CoA: 39.4
Ethylmalonyl-CoA: 32.7
Propionyl-CoA: 32.6
Acetyl-CoA: 22.5
Benzoyl-CoA: 20.5
fatty_acid: 20.1
CHC-CoA: 18.2
2-Methylbutyryl-CoA: 15.4
trans-1,2-CPDA: 12.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (1512..1779): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 164.2
Methylmalonyl-CoA: 65.0
Methoxymalonyl-CoA: 64.9
inactive: 58.5
Propionyl-CoA: 35.4
Ethylmalonyl-CoA: 30.5
Acetyl-CoA: 25.7
Isobutyryl-CoA: 21.6
fatty_acid: 19.0
CHC-CoA: 18.1
Benzoyl-CoA: 17.2
trans-1,2-CPDA: 14.7
2-Methylbutyryl-CoA: 10.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (3142..3428): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.7
Ethylmalonyl-CoA: 200.4
Methoxymalonyl-CoA: 166.4
2-Methylbutyryl-CoA: 154.0
CHC-CoA: 111.0
Propionyl-CoA: 110.5
trans-1,2-CPDA: 107.6
Malonyl-CoA: 96.6
Isobutyryl-CoA: 94.3
Benzoyl-CoA: 83.2
Acetyl-CoA: 59.1
fatty_acid: 42.3
3-Methylbutyryl-CoA: 41.5
inactive: 21.7

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
ClgR	Caseinolytic protease gene regulator
IolR	Regulator of the inositol catabolism

NZ_JAGFWR010000006.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 294,922 - 329,931 nt. (total: 35,010 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

JQN83_RS14455: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

JQN83_RS14465: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Ligases: ligase

JQN83_RS14410: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQN83_RS14440: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQN83_RS14460: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQN83_RS14480: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000342.4	0.64	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001250.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000342.4	0.64	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001250.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.91 out of 28.19

Confidence: medium

Additional weak hits (11):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.42 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.76 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.71 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.70 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.85 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.28 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.66 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.64 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.12 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.52 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 294921 - 329931:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

JQN83_RS14440: X

AMP-binding (17..426): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YEFAYDAHYCEPETMCSGEHNEYGPSECILLTWH
Nearest Stachelhaus code(s):: aza-bTyr DACELALLAK (53% 8Å match)
Stachelhaus code match:: 60% (weak)

JQN83_RS14460: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (16..396): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWSTFDLTITSGKMVVGGEVNEYGPSEATVGCCR
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
RpoN	Regulator of nitrogen assimilation and virulence
ZuR variant 1	Zinc-responsive repressor

NZ_JAGFWR010000007.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 119,211 - 160,272 nt. (total: 41,062 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JQN83_RS15110: Hydroxylation

MITE: MITE0000081Hydroxylation (identity: 79.70%)
smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: Prenylation aminotransferase methyltransferase

JQN83_RS15100: Prenylation

MITE: MITE0000083Prenylation (identity: 66.00%)

JQN83_RS15105: Methylation

MITE: MITE0000082Methylation (identity: 61.00%)
smcogs: SMCOG1089: methyltransferase

JQN83_RS15180: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: deformylase

JQN83_RS15075: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: synthase

JQN83_RS15115: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002362.3	0.80	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001077.4	0.71	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0000918.3	0.56	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001896.4	0.43	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001206.5	0.43	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002554.2	0.42	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001903.3	0.41	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0001534.3	0.41	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002007.2	0.41	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002362.3	0.80	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001077.4	0.71	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0000918.3	0.56	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001896.4	0.43	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001206.5	0.43	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002554.2	0.42	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001903.3	0.41	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0001534.3	0.41	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002007.2	0.41	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (7):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.57 out of 20.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.10 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.83 out of 24.78

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production