GCF_016924995.1 - 11 region(s)

Download region SVG

Location: 355,824 - 421,215 nt. (total: 65,392 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer oxidoreductase

JQX68_RS01905: flavodoxin

smcogs: SMCOG1134: flavodoxin

JQX68_RS01910: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: PPTase aminotransferase

JQX68_RS02030: aminotransferase

smcogs: SMCOG1019: aminotransferase

JQX68_RS02035: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase hydrolase

JQX68_RS02010: thioesterase

smcogs: SMCOG1004: thioesterase

JQX68_RS02085: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

JQX68_RS01930: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

JQX68_RS01995: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQX68_RS02005: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQX68_RS21640: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQX68_RS21650: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000433.5	0.72	NRPS	surfactin	Bacillus velezensis FZB42

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000433.5	0.72	NRPS	surfactin	Bacillus velezensis FZB42

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.80 out of 27.78

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.27 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.38 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.42 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.88 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.75 out of 28.19

Confidence: medium

Additional weak hits (6):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.52 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.59 out of 39.62

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.98 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.96 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.22 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.74 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 355823 - 421215:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Glu - Leu - D-Leu) + (Val) + (Asp - D-Leu) + (Leu)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

JQX68_RS01995: Glu - Leu - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (466..867): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: LSLAFDASVKQADGLIGGETNVYGPTETCVDASV
Nearest Stachelhaus code(s):: Glu DAKDLGVVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1510..1908): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: TETSFDAFMFDGMIMFGGELHMYGPSESTVFATY
Nearest Stachelhaus code(s):: Leu DAFMMGMVFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2938): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDASIWEPFLLTGGDVNNYGPTENTVVATS
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

JQX68_RS21640: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNAGFDAGTFEGWLIIGGDWNGYGPTENTTFSTS
Nearest Stachelhaus code(s):: Val DAFWIGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

JQX68_RS21650: Asp - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (427..830): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YWFSFDLGYTSPKLVLGGEINHYGPTEATIGAIA
Nearest Stachelhaus code(s):: Asp DLTKVGHIGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1472..1860): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDASIWEPFLLTGGDVNNYGPTENTVVATS
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

JQX68_RS02005: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LHVSFDAFTFDAFALFGGEINCYGPTEGTVFATA
Nearest Stachelhaus code(s):: Leu DAFFLGCVFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_CP070483.1 - Region 2 - NRPS,T1PKS

Download region SVG

Location: 710,179 - 791,531 nt. (total: 81,353 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JQX68_RS03760: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

JQX68_RS03775: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: formyltransferase

JQX68_RS03665: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: amidase esterase hydrolase phosphatase

JQX68_RS03745: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

JQX68_RS03755: thioesterase

smcogs: SMCOG1004: thioesterase

JQX68_RS03765: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

JQX68_RS03830: amidase

smcogs: SMCOG1105: amidase

Ligases: ligase synthase

JQX68_RS03740: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQX68_RS03780: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQX68_RS03785: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQX68_RS03790: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

JQX68_RS03795: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

JQX68_RS03800: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Translocases: permease

JQX68_RS03685: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0000426.5	0.71	NRPS	sevadicin	Paenibacillus larvae
BGC0001023.5	0.69	NRPS, PKS	myxochromide S1	Stigmatella aurantiaca
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001133.4	0.68	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0000426.5	0.68	NRPS	sevadicin	Paenibacillus larvae
BGC0001023.5	0.67	NRPS, PKS	myxochromide S1	Stigmatella aurantiaca
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001133.4	0.67	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.63 out of 26.85

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.78 out of 20.97

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.10 out of 26.06

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 25.31

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 25.34 out of 29.25

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.90 out of 27.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.78 out of 24.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.31 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.13 out of 26.06

Confidence: medium

Additional weak hits (5):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.83 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.28 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.86 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.99 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 710178 - 791531:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (Asn - ohmal - Glu) + (ohmal) + (mal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

JQX68_RS03740: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (463..859): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YSASFDLTVTSTKLIVGGEFNEYGPTEATVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

JQX68_RS03780: Asn - mal

Search NORINE for peptide: strict or relaxed

AMP-binding (480..874): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATFDLTVTSTKLILGGEFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

PKS_AT (1595..1890): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 89.1
inactive: 63.4
Methoxymalonyl-CoA: 44.6
Methylmalonyl-CoA: 31.8
Propionyl-CoA: 27.2
Isobutyryl-CoA: 9.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

JQX68_RS03785: Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (273..674): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: LGIAFDASVQTPDAMAGGETNNYGPTECAVQSAA
Nearest Stachelhaus code(s):: Ile DAQDLGVVDK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

JQX68_RS03790: mal

PKS_AT (521..804): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 128.3
inactive: 92.7
Methoxymalonyl-CoA: 49.8
Methylmalonyl-CoA: 33.4
Propionyl-CoA: 28.2
Isobutyryl-CoA: 11.5
Benzoyl-CoA: 9.7
Acetyl-CoA: 8.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

JQX68_RS03795: mal - mal

PKS_AT (531..797): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 26.2
Methoxymalonyl-CoA: 19.3
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (1508..1796): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 176.1
inactive: 102.8
Methoxymalonyl-CoA: 70.9
Methylmalonyl-CoA: 53.9
Propionyl-CoA: 36.9
Ethylmalonyl-CoA: 24.6
fatty_acid: 19.2
Benzoyl-CoA: 17.2
Isobutyryl-CoA: 12.6
Acetyl-CoA: 11.5
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

JQX68_RS03800: mal

PKS_AT (534..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 150.5
inactive: 117.1
Methoxymalonyl-CoA: 74.8
Methylmalonyl-CoA: 61.3
Propionyl-CoA: 41.4
Isobutyryl-CoA: 33.1
Ethylmalonyl-CoA: 20.0
2-Methylbutyryl-CoA: 16.1
CHC-CoA: 14.3
fatty_acid: 13.3
Benzoyl-CoA: 11.6
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
RutR	Regulator of the pyrimidine and purine metabolism
SypG	Regulator of biofilm formation and host colonization
ToxT	Regulator of MSHA biosynthesis

NZ_CP070483.1 - Region 3 - NRPS,PKS-like,T3PKS,transAT-PKS

Download region SVG

Location: 1,832,431 - 1,947,129 nt. (total: 114,699 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
PKS-like: (t2pks2 or ksIII)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

JQX68_RS09470: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

JQX68_RS09590: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JQX68_RS09610: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase

JQX68_RS09545: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

JQX68_RS09550: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

JQX68_RS09555: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase protease

JQX68_RS09540: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

JQX68_RS09625: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: hydratase

JQX68_RS09575: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

JQX68_RS09580: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

JQX68_RS09475: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

JQX68_RS09565: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

JQX68_RS09570: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

JQX68_RS09585: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQX68_RS09595: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

JQX68_RS09600: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQX68_RS09605: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001089.5	1.35	NRPS, PKS	bacillaene	Bacillus velezensis FZB42
BGC0000205.3	1.27	PKS	bryostatin	Candidatus Endobugula sertula
BGC0001135.5	1.27	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001160.5	1.27	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001132.4	1.24	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.22	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.22	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	1.20	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.20	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	1.15	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001089.5	0.77	NRPS, PKS	bacillaene	Bacillus velezensis FZB42
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000205.3	0.65	PKS	bryostatin	Candidatus Endobugula sertula
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 24.80 out of 29.25

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 23.87 out of 29.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.03 out of 26.06

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.63 out of 25.88

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.08 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.88 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.32 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.46 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.86 out of 28.19

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.97 out of 24.78

Confidence: strong

Additional weak hits (15):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.51 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.96 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.21 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 25.41 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.90 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.44 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.99 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.04 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.54 out of 36.54

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.52 out of 33.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.86 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.98 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.22 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 1832430 - 1947129:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - Gly - ccmal - ohmal - mal) + (ccmal - mal - ohmal - mal) + (Me-ccmal - ohmal - mal) + (Ala - ccmal - ccmal - Me-ccmal) + (mal - mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

JQX68_RS09545: mal

PKS_AT (4..283): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 101.8
Methoxymalonyl-CoA: 54.5
inactive: 36.9
Methylmalonyl-CoA: 35.8
Propionyl-CoA: 23.0
Ethylmalonyl-CoA: 10.8
Isobutyryl-CoA: 9.8
2-Methylbutyryl-CoA: 9.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

JQX68_RS09550: pk

PKS_AT (7..293): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 28.1
Malonyl-CoA: 25.9
Isobutyryl-CoA: 9.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

JQX68_RS09555: mal

PKS_AT (4..285): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 98.7
inactive: 41.6
Methoxymalonyl-CoA: 29.7
Methylmalonyl-CoA: 23.7
Propionyl-CoA: 16.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

JQX68_RS09585: fatty_acid - Gly

Search NORINE for peptide: strict or relaxed

CAL_domain (63..476): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 18.8
NH2: 10.3
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1159..1554): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDIAALELQALCGGEWNMFGPTETTIWSAV
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

JQX68_RS09600: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (472..880): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TFLTFDVSISEGNFMVAGEENIYGPTEASIYAAY
Nearest Stachelhaus code(s):: Ala DVSNMAIIYK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
PsrA	Oleic acid responsive regulator
SypG	Regulator of biofilm formation and host colonization
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_CP070483.1 - Region 4 - NRPS,betalactone

Download region SVG

Location: 2,013,865 - 2,091,627 nt. (total: 77,763 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JQX68_RS10180: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

JQX68_RS10275: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: carboxylase transferase

JQX68_RS10135: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

JQX68_RS10150: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

JQX68_RS10170: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Hydrolases: peptidase

JQX68_RS10265: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Lyases: hydratase

JQX68_RS10155: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

JQX68_RS10160: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

JQX68_RS10175: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQX68_RS10205: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQX68_RS10210: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQX68_RS10215: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQX68_RS10220: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

JQX68_RS10225: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000407.5	0.86	NRPS	plipastatin	Bacillus subtilis subsp. subtilis
BGC0001833.4	0.79	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.74	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001095.5	0.72	NRPS	fengycin	Bacillus velezensis FZB42
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000407.5	0.87	NRPS	plipastatin	Bacillus subtilis subsp. subtilis
BGC0001095.5	0.80	NRPS	fengycin	Bacillus velezensis FZB42
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.53 out of 20.97

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.60 out of 21.55

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.00 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.52 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.34 out of 26.06

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 24.01 out of 29.25

Confidence: medium

Additional weak hits (10):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.18 out of 31.73

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.36 out of 20.01

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.41 out of 36.54

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.44 out of 20.47

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.22 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.11 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.85 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.65 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.40 out of 30.98

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.24 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 2013864 - 2091627:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Glu - D-Orn) + (Tyr - D-Thr) + (Glu - D-Val) + (Pro - Glu - D-Tyr) + (Ile)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

JQX68_RS10175: X

AMP-binding (13..445): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NNIVF-GCVLGAHGIMAGSTIAYGQTEASPVITQ
Nearest Stachelhaus code(s):: Z-ahmohOrn FGLHIASTCK (56% 8Å match); Ile DGLFIGIPVK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

JQX68_RS10205: Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (481..874): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LNSGFDAVTFEGFLYVGGEHNIYGPTENTTFSTF
Nearest Stachelhaus code(s):: Ile DAFFYGITFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

JQX68_RS10210: Pro - Glu - Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (468..865): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LFEAFDVCYQESFLIAAGEHNHYGPSETHVVSTY
Nearest Stachelhaus code(s):: Pro DVQFIAHVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1499..1901): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: FSLTFDASIWEWHFFSGGETNSYGPTEATVEASF
Nearest Stachelhaus code(s):: Glu DAWHFGSVEK (97% 8Å match); Gln DAWHFGSVEK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2539..2933): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: TWRFFDGFLTSTIITLAGEANEYGPTENSVATTV
Nearest Stachelhaus code(s):: Tyr DGTITAEVAK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

JQX68_RS10215: Glu - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (469..870): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDASVWQWHFFAGGEIHGYGPTEATVDAAF
Nearest Stachelhaus code(s):: Glu DAWHFGGVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1510..1903): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNSSFDVGSFEGWLIIGGEWNGYGPTENTTFSTC
Nearest Stachelhaus code(s):: Val DVFWIGGTFK (100% 8Å match); Ala or Val DVFWIGGTFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

JQX68_RS10220: Tyr - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (474..865): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: TWRFFDGCVTSTIITFAGEANEYGPTENSVATTI
Nearest Stachelhaus code(s):: Tyr DGTITAEVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1902): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LHQHFDFSVWEGNQIFGGEINMYGITETTVHVTF
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

JQX68_RS10225: Glu - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (463..864): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDASVWQWHFFAGGEIHGYGPTEATVDAAF
Nearest Stachelhaus code(s):: Glu DAWHFGGVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1503..1908): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: AAWAFDVFSGDRESILGSDINSYGVTEATIDSSF
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
ArcA	Repressor of carbon oxidation
CcpA	Catabolite control protein A
MogR	Repressor of flagellar motility genes
SypG	Regulator of biofilm formation and host colonization
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP070483.1 - Region 5 - terpene

Download region SVG

Location: 2,168,919 - 2,190,817 nt. (total: 21,899 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JQX68_RS10800: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000313.4	0.36	NRPS	beauvericin	Beauveria bassiana
BGC0001535.3	0.34	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002255.3	0.29	PKS	lijiquinone	Ascomycota sp. F53
BGC0000663.5	0.27	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001338.4	0.26	PKS	citrinin	Monascus ruber
BGC0001575.4	0.26	NRPS	PZN5, PZN6, PZN7, PZN9, PZN10, PZN11	Ruminococcus sp. 5_1_39BFAA
BGC0000154.4	0.26	PKS	stipitatic acid	Talaromyces stipitatus ATCC 10500
BGC0001739.3	0.25	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0002246.3	0.24	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0001057.4	0.24	NRPS, PKS	zearalenone	Fusarium graminearum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000313.4	0.36	NRPS	beauvericin	Beauveria bassiana
BGC0001535.3	0.34	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002255.3	0.29	PKS	lijiquinone	Ascomycota sp. F53
BGC0000663.5	0.27	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001338.4	0.26	PKS	citrinin	Monascus ruber
BGC0001575.4	0.26	NRPS	PZN5, PZN6, PZN7, PZN9, PZN10, PZN11	Ruminococcus sp. 5_1_39BFAA
BGC0000154.4	0.26	PKS	stipitatic acid	Talaromyces stipitatus ATCC 10500
BGC0001739.3	0.25	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0002246.3	0.24	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0001057.4	0.24	NRPS, PKS	zearalenone	Fusarium graminearum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

JQX68_RS10805: T2TS

Domain 1 (4 - 629): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.21 out of 26.06

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 26.30 out of 27.78

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.78 out of 20.97

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.34 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.70 out of 26.06

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.10 out of 21.84

Confidence: medium

Additional weak hits (7):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 24.87 out of 33.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.62 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.49 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.82 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.69 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.53 out of 33.73

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_CP070483.1 - Region 6 - T3PKS

Download region SVG

Location: 2,237,432 - 2,278,529 nt. (total: 41,098 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JQX68_RS11325: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase methyltransferase

JQX68_RS11275: isoprenylcysteine carboxyl methyltransferase

smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

JQX68_RS11310: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Ligases: synthase

JQX68_RS11280: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001831.3	0.51	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000282.3	0.49	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001962.3	0.45	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001847.2	0.44	other (other)	1-carbapen-2-em-3-carboxylic acid	Pectobacterium carotovorum
BGC0001475.4	0.43	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002332.2	0.42	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000509.4	0.37	ribosomal	epilancin 15x	Staphylococcus epidermidis
BGC0001882.3	0.36	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001831.3	0.51	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000282.3	0.49	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001962.3	0.45	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001847.2	0.44	other (other)	1-carbapen-2-em-3-carboxylic acid	Pectobacterium carotovorum
BGC0001475.4	0.43	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002332.2	0.42	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000509.4	0.37	ribosomal	epilancin 15x	Staphylococcus epidermidis
BGC0001882.3	0.36	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.45 out of 25.88

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.48 out of 23.79

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.84 out of 29.38

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.63 out of 18.46

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.73 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.75 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.14 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.07 out of 18.16

Confidence: strong

Additional weak hits (10):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.47 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.03 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.46 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.58 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 26.01 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.76 out of 32.74

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.18 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.76 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.39 out of 28.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.01 out of 24.78

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
FuR variant 1	Ferric Uptake Regulator
IolR	Regulator of the inositol catabolism
PsrA	Oleic acid responsive regulator
RpoN	Regulator of nitrogen assimilation and virulence
ZuR variant 1	Zinc-responsive repressor

NZ_CP070483.1 - Region 7 - terpene-precursor

Download region SVG

Location: 2,457,612 - 2,478,502 nt. (total: 20,891 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

JQX68_RS12405: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: carboxylase

JQX68_RS12475: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

JQX68_RS12440: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

JQX68_RS12445: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000895.5	0.41	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001605.3	0.38	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000895.5	0.41	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001605.3	0.38	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

JQX68_RS12445: PT_FPPS_like

Domain 1 (33 - 296): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.20 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.84 out of 30.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 20.50 out of 30.12

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_CP070483.1 - Region 8 - NRP-metallophore,NRPS,terpene-precursor

Download region SVG

Location: 3,156,926 - 3,223,190 nt. (total: 66,265 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

JQX68_RS16225: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JQX68_RS16300: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

JQX68_RS16350: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

JQX68_RS16355: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

JQX68_RS16400: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Hydrolases: esterase hydrolase

JQX68_RS16135: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

JQX68_RS16185: isochorismatase

smcogs: SMCOG1027: isochorismatase

JQX68_RS16285: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

JQX68_RS16295: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthetase

JQX68_RS16155: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

JQX68_RS16280: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

JQX68_RS16290: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000309.5	1.46	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0001185.5	1.10	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000401.5	1.05	NRPS	paenibactin	Paenibacillus elgii B69
BGC0000343.5	0.87	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002695.2	0.74	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000309.5	0.90	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0001185.5	0.82	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000401.5	0.80	NRPS	paenibactin	Paenibacillus elgii B69
BGC0000343.5	0.74	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002695.2	0.70	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

JQX68_RS16155: PT_FPPS_like

Domain 1 (47 - 287): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.21 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.21 out of 26.06

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.03 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.30 out of 28.19

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.85 out of 25.31

Confidence: strong

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 25.79 out of 29.25

Confidence: medium

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 26.64 out of 32.74

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.61 out of 29.38

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.03 out of 30.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.02 out of 26.06

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.49 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.36 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.52 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.97 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.08 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.73 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.18 out of 28.19

Confidence: medium

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 26.46 out of 33.14

Confidence: medium

Additional weak hits (15):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.98 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.45 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.72 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.61 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.12 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.51 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.69 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.84 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.85 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.81 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.15 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.01 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 8, location 3156925 - 3223190:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 3171412 - 3223190:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Thr)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

JQX68_RS16280: Gly - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (463..861): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDISALELQALVGGETNLYGPTETTIWSAA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1519..1935): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQIFGGEINMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

JQX68_RS16290: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SRSLYPLSSPGGALQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVVNK (100% 8Å match); diOH-Bz or Sal PLPAQGVVNK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
FuR variant 1	Ferric Uptake Regulator
FuR variant 2	Ferric Uptake Regulator
MogR	Repressor of flagellar motility genes
SypG	Regulator of biofilm formation and host colonization
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor
ZuR variant 2	Zinc-responsive repressor

NZ_CP070483.1 - Region 9 - azole-containing-RiPP

Download region SVG

Location: 3,237,741 - 3,267,849 nt. (total: 30,109 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

JQX68_RS16635: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Transferases: aminotransferase

JQX68_RS16655: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Lyases: dehydratase

JQX68_RS16555: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002311.3	0.53	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0002120.3	0.48	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001472.5	0.47	ribosomal	berninamycin A	Streptomyces bernensis
BGC0000568.5	0.47	ribosomal	microcin B17	Escherichia coli
BGC0000605.5	0.47	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0002363.3	0.46	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0001655.3	0.45	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0001173.5	0.45	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000569.5	0.45	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0000607.5	0.45	ribosomal	micrococcin P1	Macrococcus caseolyticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002311.3	0.53	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0002120.3	0.48	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001472.5	0.47	ribosomal	berninamycin A	Streptomyces bernensis
BGC0000568.5	0.47	ribosomal	microcin B17	Escherichia coli
BGC0000605.5	0.47	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0002363.3	0.46	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0001655.3	0.45	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0001173.5	0.45	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000569.5	0.45	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0000607.5	0.45	ribosomal	micrococcin P1	Macrococcus caseolyticus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.52 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.70 out of 26.06

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.96 out of 30.25

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.90 out of 27.78

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.24 out of 32.93

Confidence: medium

Additional weak hits (1):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 20.91 out of 30.22

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

TFBS Finder

Azole RiPPs

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes

Core peptide predictions

No core peptides found.

NZ_CP070483.1 - Region 10 - sactipeptide

Download region SVG

Location: 3,766,861 - 3,788,471 nt. (total: 21,611 nt) Show pHMM detection rules used

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Sactipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer

JQX68_RS19140: flavodoxin

smcogs: SMCOG1134: flavodoxin

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000602.5	0.88	ribosomal	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000514.5	0.38	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0001170.5	0.34	ribosomal	clostridiolysin S	Clostridium sporogenes ATCC 15579
BGC0000564.5	0.34	ribosomal	clostridiolysin S	Clostridium botulinum A str. ATCC 3502
BGC0001137.5	0.34	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002666.2	0.31	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0000838.3	0.29	PKS	flexirubin	Flavobacterium johnsoniae UW101
BGC0001048.5	0.24	NRPS, PKS, saccharide	tallysomycin A, tallysomycin B	Streptoalloteichus hindustanus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000602.5	0.88	ribosomal	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000514.5	0.38	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0001170.5	0.34	ribosomal	clostridiolysin S	Clostridium sporogenes ATCC 15579
BGC0000564.5	0.34	ribosomal	clostridiolysin S	Clostridium botulinum A str. ATCC 3502
BGC0001137.5	0.34	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002666.2	0.31	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0000838.3	0.29	PKS	flexirubin	Flavobacterium johnsoniae UW101
BGC0001048.5	0.24	NRPS, PKS, saccharide	tallysomycin A, tallysomycin B	Streptoalloteichus hindustanus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Sactipeptide predictions

Sactipeptide(s) for JQX68_RS19175

JQX68_RS19175

Leader:

MKKAVIVENK

Core:

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

antiSMASH-DB 4.0 matches for JQX68_RS19175

100.0%

NC_000964.3and 235 others:

NC_014479.1 Sactipeptides: BSUW23_RS18740_sactipeptideNC_014639.1 Sactipeptides: BATR1942_RS15950_sactipeptideNC_014976.1 Sactipeptides: BSN5_RS09700_sactipeptideNC_016047.1 Sactipeptides: GYO_RS41165_sactipeptideNC_017195.1 Sactipeptides: I33_RS18040_sactipeptideNC_017743.1 Sactipeptides: MY9_RS18920_sactipeptideNC_019896.1 Sactipeptides: A7A1_RS01935_sactipeptideNC_020244.1 Sactipeptides: C663_RS18295_sactipeptideNZ_BDDH01000003.1 Sactipeptides: A7P71_RS10610_sactipeptideNZ_CABIVP010000002.1 Sactipeptides: FY199_RS09010_sactipeptideNZ_CP007409.1 Sactipeptides: Q433_RS18950_sactipeptideNZ_CP009796.1 Sactipeptides: OB04_RS19085_sactipeptideNZ_CP011101.1 Sactipeptides: bslm_RS18365_sactipeptideNZ_CP011534.1 Sactipeptides: ABA10_RS18725_sactipeptideNZ_CP011802.1 Sactipeptides: D068_RS17505_sactipeptideNZ_CP016767.1 Sactipeptides: BCV50_RS14935_sactipeptideNZ_CP017072.1 Sactipeptides: BGM23_RS02945_sactipeptideNZ_CP017112.1 Sactipeptides: BS16045_RS19810_sactipeptideNZ_CP017313.1 Sactipeptides: BH660_RS14630_sactipeptideNZ_CP017314.1 Sactipeptides: BSBS38_RS19215_sactipeptideNZ_CP017676.1 Sactipeptides: BKN48_RS08085_sactipeptideNZ_CP018173.1 Sactipeptides: BAX60_RS03615_sactipeptideNZ_CP020367.1 Sactipeptides: BSK2_RS19060_sactipeptideNZ_CP020722.1 Sactipeptides: B7470_RS09560_sactipeptideNZ_CP020915.1 Sactipeptides: B9L64_RS11255_sactipeptideNZ_CP021169.1 Sactipeptides: B9N48_RS18685_sactipeptideNZ_CP021498.1 Sactipeptides: S101444_RS19170_sactipeptideNZ_CP021892.1 Sactipeptides: S100333_RS19720_sactipeptideNZ_CP021903.1 Sactipeptides: CD007_RS18975_sactipeptideNZ_CP021911.1 Sactipeptides: CDO84_RS18225_sactipeptideNZ_CP021921.1 Sactipeptides: S101392_RS19440_sactipeptideNZ_CP022391.1 Sactipeptides: CFK25_RS18875_sactipeptideNZ_CP022890.1 Sactipeptides: CJZ70_RS01210_sactipeptideNZ_CP023257.1 Sactipeptides: CLD04_RS19470_sactipeptideNZ_CP023409.1 Sactipeptides: Bateq7PJ16_RS20450_sactipeptideNZ_CP025941.1 Sactipeptides: C0W65_RS07300_sactipeptideNZ_CP026010.1 Sactipeptides: BS11774_RS03710_sactipeptideNZ_CP026030.1 Sactipeptides: C2H91_RS12110_sactipeptideNZ_CP026035.1 Sactipeptides: C2H96_RS13375_sactipeptideNZ_CP026036.1 Sactipeptides: C2H93_RS16885_sactipeptideNZ_CP026521.1 Sactipeptides: C1T29_RS22385_sactipeptideNZ_CP028201.1 Sactipeptides: C7M16_RS17535_sactipeptideNZ_CP028202.1 Sactipeptides: C7M17_RS17600_sactipeptideNZ_CP028217.1 Sactipeptides: C7M29_RS06900_sactipeptideNZ_CP028218.1 Sactipeptides: C7M30_RS12605_sactipeptideNZ_CP028812.1 Sactipeptides: DAE22_RS20770_sactipeptideNZ_CP029364.1 Sactipeptides: DIC78_RS12275_sactipeptideNZ_CP029461.1 Sactipeptides: DJ572_RS18795_sactipeptideNZ_CP029465.1 Sactipeptides: DKG76_RS19825_sactipeptideNZ_CP029609.1 Sactipeptides: DL538_RS20030_sactipeptideNZ_CP031675.1 Sactipeptides: DYS67_RS19275_sactipeptideNZ_CP031783.1 Sactipeptides: D0808_RS00710_sactipeptideNZ_CP031784.1 Sactipeptides: D0819_RS14700_sactipeptideNZ_CP032853.1 Sactipeptides: D9C10_RS17955_sactipeptideNZ_CP032855.1 Sactipeptides: D9C11_RS09165_sactipeptideNZ_CP035161.1 Sactipeptides: EQH88_RS19675_sactipeptideNZ_CP035167.1 Sactipeptides: EQJ08_RS19095_sactipeptideNZ_CP035226.1 Sactipeptides: EQW70_RS20085_sactipeptideNZ_CP035231.1 Sactipeptides: EQZ01_RS19685_sactipeptideNZ_CP035391.1 Sactipeptides: ES965_RS19370_sactipeptideNZ_CP035395.1 Sactipeptides: ES968_RS19740_sactipeptideNZ_CP035401.1 Sactipeptides: ETA19_RS19595_sactipeptideNZ_CP035402.1 Sactipeptides: ES969_RS19660_sactipeptideNZ_CP035403.1 Sactipeptides: ETA15_RS19805_sactipeptideNZ_CP035406.1 Sactipeptides: ETK61_RS20735_sactipeptideNZ_CP035413.1 Sactipeptides: ETL58_RS19505_sactipeptideNZ_CP039935.1 Sactipeptides: FCJ76_RS19255_sactipeptideNZ_CP045006.1 Sactipeptides: F9B13_RS01950_sactipeptideNZ_CP045425.1 Sactipeptides: GCU76_RS20710_sactipeptideNZ_CP045816.1 Sactipeptides: GII86_RS19920_sactipeptideNZ_CP045824.1 Sactipeptides: GII78_RS20125_sactipeptideNZ_CP046591.1 Sactipeptides: GO004_RS15965_sactipeptideNZ_CP046860.1 Sactipeptides: GPJ55_RS11605_sactipeptideNZ_CP047645.1 Sactipeptides: GSN02_RS19265_sactipeptideNZ_CP049924.1 Sactipeptides: G4G26_RS18960_sactipeptideNZ_CP050705.1 Sactipeptides: HCU65_RS18920_sactipeptideNZ_CP051462.1 Sactipeptides: HC662_RS19240_sactipeptideNZ_CP051464.1 Sactipeptides: HC660_RS18970_sactipeptideNZ_CP054050.1 Sactipeptides: HNV25_RS02005_sactipeptideNZ_CP054177.1 Sactipeptides: HR084_RS18935_sactipeptideNZ_CP054584.1 Sactipeptides: HT135_RS19775_sactipeptideNZ_CP060193.1 Sactipeptides: H7F27_RS02180_sactipeptideNZ_CP060417.1 Sactipeptides: H8S71_RS18495_sactipeptideNZ_CP061284.1 Sactipeptides: ICJ61_RS19715_sactipeptideNZ_CP061870.1 Sactipeptides: IE382_RS22305_sactipeptideNZ_CP062497.1 Sactipeptides: IHV08_RS19770_sactipeptideNZ_CP063276.1 Sactipeptides: IM743_RS18070_sactipeptideNZ_CP065858.1 Sactipeptides: I7X10_RS03370_sactipeptideNZ_CP069789.1 Sactipeptides: JR441_RS19085_sactipeptideNZ_CP070483.1 Sactipeptides: JQX68_RS19175_sactipeptideNZ_CP070976.1 Sactipeptides: JYG31_RS19675_sactipeptideNZ_CP071043.1 Sactipeptides: JS609_RS19245_sactipeptideNZ_CP073265.1 Sactipeptides: KCX77_RS18900_sactipeptideNZ_CP075344.1 Sactipeptides: KIL00_RS20100_sactipeptideNZ_CP076083.1 Sactipeptides: KFF76_RS18635_sactipeptideNZ_CP079759.1 Sactipeptides: KXZ66_RS19695_sactipeptideNZ_CP080508.1 Sactipeptides: K0V03_RS08595_sactipeptideNZ_CP089148.1 Sactipeptides: LRO88_RS20980_sactipeptideNZ_CP090125.1 Sactipeptides: LXE94_RS19505_sactipeptideNZ_CP093289.1 Sactipeptides: MNG38_RS19730_sactipeptideNZ_CP093546.1 Sactipeptides: MOW04_RS19180_sactipeptideNZ_CP095736.1 Sactipeptides: MX663_RS20090_sactipeptideNZ_CP096590.1 Sactipeptides: M0696_RS18995_sactipeptideNZ_CP096889.1 Sactipeptides: EFK13_RS19225_sactipeptideNZ_CP098738.1 Sactipeptides: NDR85_RS18965_sactipeptideNZ_CP100651.1 Sactipeptides: NLW79_RS19990_sactipeptideNZ_CP100752.1 Sactipeptides: NLV76_RS19060_sactipeptideNZ_CP101718.1 Sactipeptides: NPA28_RS19075_sactipeptideNZ_CP101936.1 Sactipeptides: NP434_RS18980_sactipeptideNZ_CP103352.1 Sactipeptides: NX823_RS19780_sactipeptideNZ_CP104878.1 Sactipeptides: N8A75_RS20105_sactipeptideNZ_CP107539.1 Sactipeptides: OEG95_RS19105_sactipeptideNZ_CP110264.1 Sactipeptides: OMK57_RS18975_sactipeptideNZ_CP114899.1 Sactipeptides: O6U12_RS19480_sactipeptideNZ_CP116773.1 Sactipeptides: PNF29_RS01990_sactipeptideNZ_FTMW01000001.1 Sactipeptides: BW968_RS02045_sactipeptideNZ_JAAUXF010000005.1 Sactipeptides: HC742_RS19325_sactipeptideNZ_JABRUZ010000003.1 Sactipeptides: HRF55_RS03085_sactipeptideNZ_JABRVH010000018.1 Sactipeptides: HRF53_RS09100_sactipeptideNZ_JABUKD010000002.1 Sactipeptides: HRW04_RS09345_sactipeptideNZ_JAEACL010000001.1 Sactipeptides: I5F14_RS00800_sactipeptideNZ_JAHVOC010000002.1 Sactipeptides: KXD37_RS07830_sactipeptideNZ_JAJFDG010000003.1 Sactipeptides: LJF29_RS11575_sactipeptideNZ_JAJHUI010000011.1 Sactipeptides: LK399_RS16325_sactipeptideNZ_JALAJC010000012.1 Sactipeptides: MOB18_RS16080_sactipeptideNZ_JALAKW010000005.1 Sactipeptides: MOB93_RS12665_sactipeptideNZ_JALAKZ010000001.1 Sactipeptides: MOB76_RS02240_sactipeptideNZ_JALALA010000011.1 Sactipeptides: MOB82_RS15020_sactipeptideNZ_JALALE010000020.1 Sactipeptides: MOB33_RS20855_sactipeptideNZ_JALALO010000006.1 Sactipeptides: MOB75_RS09230_sactipeptideNZ_JALAMD010000002.1 Sactipeptides: MOB22_RS02315_sactipeptideNZ_JALAME010000005.1 Sactipeptides: MOC02_RS13805_sactipeptideNZ_JALAMJ010000012.1 Sactipeptides: MOB80_RS16635_sactipeptideNZ_JALAMO010000007.1 Sactipeptides: MOB98_RS08535_sactipeptideNZ_JALAMR010000019.1 Sactipeptides: MOC09_RS17975_sactipeptideNZ_JALAMZ010000002.1 Sactipeptides: MOC43_RS01370_sactipeptideNZ_JALANN010000012.1 Sactipeptides: MOC49_RS18290_sactipeptideNZ_JALANX010000001.1 Sactipeptides: MOC25_RS03365_sactipeptideNZ_JALAPT010000001.1 Sactipeptides: MOC95_RS01580_sactipeptideNZ_JALAPV010000005.1 Sactipeptides: MOC91_RS13515_sactipeptideNZ_JALAPW010000003.1 Sactipeptides: MOD18_RS06235_sactipeptideNZ_JALAPX010000003.1 Sactipeptides: MOC97_RS06805_sactipeptideNZ_JALAPZ010000002.1 Sactipeptides: MOC81_RS03830_sactipeptideNZ_JALAQA010000008.1 Sactipeptides: MOD07_RS14955_sactipeptideNZ_JALAQC010000001.1 Sactipeptides: MOD00_RS01290_sactipeptideNZ_JALAQD010000002.1 Sactipeptides: MOD08_RS05770_sactipeptideNZ_JALAQE010000002.1 Sactipeptides: MOD19_RS04725_sactipeptideNZ_JALASB010000002.1 Sactipeptides: MOD42_RS03685_sactipeptideNZ_JALASC010000024.1 Sactipeptides: MOD69_RS20580_sactipeptideNZ_JALASM010000006.1 Sactipeptides: MOD51_RS10970_sactipeptideNZ_JALASR010000006.1 Sactipeptides: MOD87_RS10780_sactipeptideNZ_JALAST010000011.1 Sactipeptides: MOE17_RS14670_sactipeptideNZ_JALASW010000005.1 Sactipeptides: MOE15_RS06925_sactipeptideNZ_JALATC010000001.1 Sactipeptides: MOD56_RS03380_sactipeptideNZ_JALATD010000001.1 Sactipeptides: MOE02_RS03350_sactipeptideNZ_JALATE010000006.1 Sactipeptides: MOD98_RS11440_sactipeptideNZ_JALATF010000003.1 Sactipeptides: MOD44_RS09960_sactipeptideNZ_JALATG010000002.1 Sactipeptides: MOE16_RS03490_sactipeptideNZ_JALATJ010000007.1 Sactipeptides: MOD90_RS15770_sactipeptideNZ_JALATU010000001.1 Sactipeptides: MOE27_RS01985_sactipeptideNZ_JALATV010000005.1 Sactipeptides: MOD97_RS07020_sactipeptideNZ_JALAUA010000008.1 Sactipeptides: MOD32_RS16030_sactipeptideNZ_JALAUD010000001.1 Sactipeptides: MOE28_RS03345_sactipeptideNZ_JALAUJ010000006.1 Sactipeptides: MOE37_RS12685_sactipeptideNZ_JALAUK010000012.1 Sactipeptides: MOE38_RS11825_sactipeptideNZ_JALAUV010000003.1 Sactipeptides: MOE71_RS06545_sactipeptideNZ_JALAUW010000015.1 Sactipeptides: MOE83_RS13210_sactipeptideNZ_JALAVA010000002.1 Sactipeptides: MOE81_RS02625_sactipeptideNZ_JALAVE010000001.1 Sactipeptides: MOE67_RS03645_sactipeptideNZ_JALAVI010000011.1 Sactipeptides: MOE80_RS14660_sactipeptideNZ_JALAVK010000006.1 Sactipeptides: MOE96_RS10120_sactipeptideNZ_JALAVL010000002.1 Sactipeptides: MOE60_RS03290_sactipeptideNZ_JALAVM010000009.1 Sactipeptides: MOE49_RS16195_sactipeptideNZ_JALAVO010000008.1 Sactipeptides: MOE63_RS14665_sactipeptideNZ_JALAVQ010000003.1 Sactipeptides: MOE59_RS02420_sactipeptideNZ_JALAVS010000002.1 Sactipeptides: MOE46_RS02250_sactipeptideNZ_JALAVT010000005.1 Sactipeptides: MOF25_RS08325_sactipeptideNZ_JALAVU010000004.1 Sactipeptides: MOE78_RS09660_sactipeptideNZ_JALAVV010000004.1 Sactipeptides: MOE66_RS02855_sactipeptideNZ_JALAVW010000001.1 Sactipeptides: MOE86_RS01005_sactipeptideNZ_JALAVX010000009.1 Sactipeptides: MOE40_RS07525_sactipeptideNZ_JALAVZ010000002.1 Sactipeptides: MOF00_RS02525_sactipeptideNZ_JALAWB010000008.1 Sactipeptides: MOE87_RS15020_sactipeptideNZ_JALAWK010000002.1 Sactipeptides: MOF06_RS12140_sactipeptideNZ_JALAWW010000010.1 Sactipeptides: MOF23_RS17300_sactipeptideNZ_JALAXQ010000012.1 Sactipeptides: MOF24_RS14120_sactipeptideNZ_JALAXV010000001.1 Sactipeptides: MOF15_RS00375_sactipeptideNZ_JALAYA010000016.1 Sactipeptides: MOF34_RS08915_sactipeptideNZ_JALAYD010000019.1 Sactipeptides: MOF39_RS20725_sactipeptideNZ_JALNTO010000006.1 Sactipeptides: MTN95_RS11045_sactipeptideNZ_JAMDFN010000008.1 Sactipeptides: M3M31_RS18245_sactipeptideNZ_JAMYDW010000003.1 Sactipeptides: NHM07_RS10830_sactipeptideNZ_JANBMP010000002.1 Sactipeptides: NL430_RS07940_sactipeptideNZ_JANDGG010000001.1 Sactipeptides: NKU38_RS03365_sactipeptideNZ_JANFAP010000001.1 Sactipeptides: NEC81_RS02065_sactipeptideNZ_JAQFFE010000015.1 Sactipeptides: PG051_RS13540_sactipeptideNZ_JAQOXM010000001.1 Sactipeptides: PO770_RS01950_sactipeptideNZ_JH600279.1 Sactipeptides: GYU_RS0104160_sactipeptideNZ_JXHL01000020.1 Sactipeptides: B4069_RS07025_sactipeptideNZ_JXHP01000031.1 Sactipeptides: B4073_RS09425_sactipeptideNZ_JXHR01000010.1 Sactipeptides: B4146_RS06925_sactipeptideNZ_KZ848487.1 Sactipeptides: DSL71_RS14015_sactipeptideNZ_LPVE01000021.1 Sactipeptides: AU385_RS06600_sactipeptideNZ_LSBB01000001.1 Sactipeptides: AXI57_RS01770_sactipeptideNZ_LUUT01000004.1 Sactipeptides: A6751_RS18460_sactipeptideNZ_MOEO01000004.1 Sactipeptides: BLL41_RS09830_sactipeptideNZ_MUXL01000002.1 Sactipeptides: B0W20_RS08845_sactipeptideNZ_MZZI01000001.1 Sactipeptides: B2G85_RS18515_sactipeptideNZ_NBBO01000003.1 Sactipeptides: B6K89_RS01830_sactipeptideNZ_NERK01000024.1 Sactipeptides: B9T64_RS18540_sactipeptideNZ_NJRD01000003.1 Sactipeptides: CE053_RS09115_sactipeptideNZ_NJRE01000002.1 Sactipeptides: CE047_RS07205_sactipeptideNZ_NKAK01000003.1 Sactipeptides: CE489_RS10400_sactipeptideNZ_NMOM01000004.1 Sactipeptides: CFI07_RS07245_sactipeptideNZ_PHIE01000002.1 Sactipeptides: CVV77_RS10760_sactipeptideNZ_PJCT01000002.1 Sactipeptides: CW370_RS11825_sactipeptideNZ_PVQM01000002.1 Sactipeptides: C6W22_RS11490_sactipeptideNZ_PVQN01000002.1 Sactipeptides: C6W23_RS05885_sactipeptideNZ_PVRK01000001.1 Sactipeptides: C6350_RS02025_sactipeptideNZ_PVWC01000004.1 Sactipeptides: C6372_RS11675_sactipeptideNZ_QRFZ01000012.1 Sactipeptides: DXT72_RS19010_sactipeptideNZ_SDKE01000003.1 Sactipeptides: EUA35_RS12130_sactipeptideNZ_SHOB01000002.1 Sactipeptides: ES060_RS14270_sactipeptideNZ_SIRN01000006.1 Sactipeptides: EYH65_RS15720_sactipeptideNZ_SNWK01000001.1 Sactipeptides: DFO69_RS02055_sactipeptideNZ_SOBO01000012.1 Sactipeptides: DFO78_RS18210_sactipeptideNZ_SORJ01000001.1 Sactipeptides: BJ795_RS03350_sactipeptideNZ_VBRP01000025.1 Sactipeptides: FE220_RS07065_sactipeptideNZ_VFNF01000001.1 Sactipeptides: FB592_RS03405_sactipeptideNZ_VIOH01000001.1 Sactipeptides: FLN47_RS01935_sactipeptideNZ_VLJK01000012.1 Sactipeptides: L605_RS10195_sactipeptideNZ_VLJL01000006.1 Sactipeptides: L604_RS05585_sactipeptideNZ_VLJX01000001.1 Sactipeptides: L609_RS01950_sactipeptideNZ_VTEK01000003.1 Sactipeptides: FZC71_RS10310_sactipeptideNZ_WTKJ01000004.1 Sactipeptides: NWT17_RS06185_sactipeptide

Sactipeptides: BSU_37350_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

97.0%

NZ_CP092751.1:

Sactipeptides: MKF32_RS18515_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFEIAGATGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEIAGATGLFGLWG

33

93.9%

NZ_CP048852.1:

Sactipeptides: G4P54_RS19300_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFE+AGATGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEVAGATGLFGLWG

33

with 15 more sequence matches

Only the first 10 are displayed here.

90.9%

NZ_JALAKO010000018.1and 1 other:

NZ_JALAOG010000035.1 Sactipeptides: MOC96_RS18415_sactipeptide

Sactipeptides: MOB26_RS11095_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDGPIPDFEI G TGLFGLWG

1

GCATCSIGAVCLVDGPIPDFEIGGVTGLFGLWG

33

87.9%

NZ_CP026362.1and 3 others:

NZ_CP033052.1 Sactipeptides: D9779_RS19215_sactipeptideNZ_JALAPG010000031.1 Sactipeptides: MOC70_RS13155_sactipeptideNZ_JALAQI010000016.1 Sactipeptides: MOD13_RS11485_sactipeptide

Sactipeptides: BV11031_RS20865_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GCATCSIGA CLVDG IPDFEI G TGLFGLWG

1

GCATCSIGAVCLVDGFIPDFEIGGVTGLFGLWG

33

78.8%

NZ_NXEM01000021.1:

Sactipeptides: CPT06_RS05595_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GC TCSIGA CLV+GPIPDF+ G TGLFGLWG

1

GCTTCSIGAVCLVNGPIPDFKTGGVTGLFGLWG

33

72.7%

NC_014925.1and 17 others:

NZ_ANOI01000001.1 Sactipeptides: F779_RS13290_sactipeptideNZ_CP031604.1 Sactipeptides: DNJ55_RS07055_sactipeptideNZ_CP031605.1 Sactipeptides: DRC71_RS00165_sactipeptideNZ_CP035741.1 Sactipeptides: EW136_RS01865_sactipeptideNZ_CP039747.1 Sactipeptides: EFT29_RS00935_sactipeptideNZ_CP054206.2 Sactipeptides: HP560_RS11995_sactipeptideNZ_CP060700.1 Sactipeptides: H9Q12_RS10940_sactipeptideNZ_CP065920.1 Sactipeptides: JC281_RS11580_sactipeptideNZ_CP076465.1 Sactipeptides: KDE16_RS00560_sactipeptideNZ_JANPRJ010000013.1 Sactipeptides: NVR03_RS10250_sactipeptideNZ_JANPRN010000039.1 Sactipeptides: NVR04_RS07875_sactipeptideNZ_JTKO01000012.1 Sactipeptides: NO87_RS10650_sactipeptideNZ_LR134267.1 Sactipeptides: EL085_RS11430_sactipeptideNZ_MQMO01000006.1 Sactipeptides: BSR38_RS07375_sactipeptideNZ_MQNF01000024.1 Sactipeptides: BSR36_RS12515_sactipeptideNZ_QQPJ01000025.1 Sactipeptides: DV949_RS11300_sactipeptideNZ_SEZW01000001.1 Sactipeptides: EWV33_RS08610_sactipeptide

Sactipeptides: SPSINT_RS00615_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+TCSIGAACL+DGP+PDFE+ G TG+FGL

1

GCSTCSIGAACLIDGPLPDFEVMGITGIFGL

31

69.7%

NZ_CP027770.1:

Sactipeptides: C7J90_RS04260_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ CSIGAACL+DGP PDFE+ G TG FGL

1

GCSACSIGAACLIDGPFPDFEVMGITGTFGL

31

69.7%

NZ_CP066885.1:

Sactipeptides: JGZ27_RS11325_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+TCSIG ACL+DGP+PDFE+ G TG+FGL

1

GCSTCSIGVACLIDGPLPDFEVMGITGIFGL

31

69.7%

NZ_CP094808.1and 3 others:

NZ_CP094809.1 Sactipeptides: MUA95_RS01320_sactipeptideNZ_CP094813.1 Sactipeptides: MUA84_RS01300_sactipeptideNZ_VKCY01000004.1 Sactipeptides: FNK43_RS05155_sactipeptide

Sactipeptides: MUA11_RS01375_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C+IGAACL DGPIPDFE+AG TG FG+

1

GCSACAIGAACLADGPIPDFEVAGITGTFGI

31

66.7%

NZ_ATDF02000020.1and 1 other:

NZ_KV827785.1 Sactipeptides: HMPREF2580_RS10900_sactipeptide

Sactipeptides: M462_RS08950_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C++GAACL DGPIPDFE+AG TG FG+

1

GCSACAVGAACLADGPIPDFEVAGITGTFGM

31

63.6%

NC_022584.1and 2 others:

NZ_CP047883.1 Sactipeptides: M594_RS05585_sactipeptideNZ_KV802690.1 Sactipeptides: HMPREF2764_RS03300_sactipeptide

Sactipeptides: N596_RS03165_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

33

GC+ C+IGA CL DGPIPDFEIAG + +F +G

1

GCSVCAIGAVCLADGPIPDFEIAGVSAVFTAFG

33

63.6%

NZ_CP063367.1and 1 other:

NZ_LR134263.1 Sactipeptides: EL101_RS12790_sactipeptide

Sactipeptides: IPU22_RS12430_sactipeptide

1

GCATCSIGAACLVDGPIPDFEIAGATGLFGL

31

GC+ C++GA CL DGPIPDFE+AG TG FG+

1

GCSACAVGAVCLADGPIPDFEVAGITGTFGI

31

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.64 out of 27.78

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 25.99 out of 30.25

Confidence: medium

Additional weak hits (3):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.07 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.81 out of 33.14

Confidence: weak

RREFinder

Sactipeptides

TFBS Finder

RRE predictions

: RRE type: Subtilosin_rSAM_RRE; Location: 5 - 97; Score: 99.7

Core peptide predictions

JQX68_RS19175: Putative sactipeptide; RODEO score: 33.0; Core sequence, approximate: GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator

NZ_CP070483.1 - Region 11 - other