GCF_016803985.1 - 22 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CP049945.1 (Streptomyces koyangensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS,T1PKS,NRPS-like,terpene-precursor	1	206,151	High	candicidin	NRPS:Type I+PKS
Region 1.2	T3PKS,betalactone	212,498	254,791	High	naringenin	PKS:Type III
Region 1.3	terpene,RiPP-like	353,657	382,145	Medium	isorenieratene	terpene
Region 1.4	ectoine	1,148,592	1,158,990	High	ectoine	other:other
Region 1.5	NI-siderophore	2,112,036	2,142,417	High	desferrioxamin B	other:other
Region 1.6	NRPS	3,525,531	3,575,820
Region 1.7	lassopeptide	3,709,353	3,731,640
Region 1.8	NRPS	3,843,925	3,898,703	Low	mannopeptimycin	NRPS:Type I
Region 1.9	lanthipeptide-class-iii	3,967,892	3,990,465	High	AmfS	ribosomal:RiPP:Lanthipeptide
Region 1.10	terpene	4,794,912	4,815,886	Low	julichrome Q3-3/julichrome Q3-5	PKS
Region 1.11	terpene-precursor	4,825,822	4,846,865
Region 1.12	terpene	5,137,859	5,160,144	High	geosmin	terpene:Sesquiterpene
Region 1.13	NI-siderophore	5,402,522	5,435,592
Region 1.14	T1PKS	5,512,360	5,587,109	High	Neoabyssomicin B/Abyssomicin 2/Abyssomicin 4	PKS
Region 1.15	NRPS,NRPS-like,T1PKS	5,779,249	5,835,550
Region 1.16	RiPP-like	5,849,746	5,861,074
Region 1.17	RiPP-like	6,243,324	6,253,539
Region 1.18	terpene	6,332,696	6,359,254	High	hopene	terpene
Region 1.19	NRPS,T1PKS	6,410,035	6,459,448	High	SGR PTMs/SGR PTM Compound b/SGR PTM Compound c/SGR PTM Compound d	NRPS:Type I+PKS
Region 1.20	terpene	6,633,149	6,655,731
Region 1.21	NRPS,T1PKS,lanthipeptide-class-ii,lanthipeptide-class-iii	6,781,885	6,835,617

NZ_CP049946.1 (Streptomyces koyangensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	T1PKS,butyrolactone	1	140,231	Low	ECO-02301	PKS

Compact view

NZ_CP049945.1 - Region 1 - NRPS,NRPS-like,T1PKS,terpene-precursor

Download region GenBank file

Download region SVG

Location: 1 - 206,151 nt. (total: 206,151 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

G9U55_RS00070: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

G9U55_RS00095: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

G9U55_RS00105: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

G9U55_RS00145: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

G9U55_RS00230: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

G9U55_RS00330: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase acylase aminotransferase glycosyltransferase

G9U55_RS00220: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

G9U55_RS00225: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

G9U55_RS00265: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

G9U55_RS00270: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase

G9U55_RS00240: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

G9U55_RS00290: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: isomerase

G9U55_RS00245: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase synthetase

G9U55_RS00090: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

G9U55_RS00100: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

G9U55_RS00110: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

G9U55_RS00250: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

G9U55_RS00275: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

G9U55_RS00280: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

G9U55_RS00285: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

G9U55_RS00320: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000958.5	1.73	NRPS, PKS	antimycin	Streptomyces sp. S4
BGC0001216.5	1.50	NRPS, PKS	splenocin C	Streptomyces sp. CNQ431
BGC0001273.3	1.29	PKS	asperlactone	Aspergillus ochraceus
BGC0001455.6	1.26	NRPS, PKS	antimycin A1B	Streptomyces argillaceus
BGC0000034.5	1.26	NRPS, PKS	candicidin	Streptomyces sp. FR-008
BGC0001257.3	1.19	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	1.19	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001164.3	1.17	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	1.17	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	1.15	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000034.5	0.91	NRPS, PKS	candicidin	Streptomyces sp. FR-008
BGC0000958.5	0.91	NRPS, PKS	antimycin	Streptomyces sp. S4
BGC0001216.5	0.86	NRPS, PKS	splenocin C	Streptomyces sp. CNQ431
BGC0001455.6	0.81	NRPS, PKS	antimycin A1B	Streptomyces argillaceus
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

G9U55_RS00320: PT_FPPS_like

Domain 1 (80 - 367): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.29 out of 20.97

Confidence: medium

Additional weak hits (25):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.41 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.41 out of 29.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.87 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.27 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.63 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.23 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.72 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.14 out of 32.93

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.90 out of 26.85

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.15 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.77 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.11 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.58 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.95 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.48 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.40 out of 20.01

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.04 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.40 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 206151:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal - pk - ohmal - ohmal - ohmal) + (redmal - redmal - ohmal - redmal) + (ccmal) + (Me-ohmal - Me-redmal - Me-ccmal) + (ccmal - ccmal - ccmal - ccmal - ccmal - ccmal) + (X - mal) + (mal) + (Thr - fatty_acid)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 52350:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - fatty_acid) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 50929 - 206151:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal - pk - ohmal - ohmal - ohmal) + (redmal - redmal - ohmal - redmal) + (ccmal) + (Me-ohmal - Me-redmal - Me-ccmal) + (ccmal - ccmal - ccmal - ccmal - ccmal - ccmal) + (X - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

G9U55_RS00095: Thr - fatty_acid

Search NORINE for peptide: strict or relaxed

AMP-binding (461..875): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LASHFDFSVWEGNQVLGGEVNMYGITETSVHVTF
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

CAL_domain (1710..2121): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 19.2
AHBA: 7.0
NH2: 3.6
shikimic_acid: 0.0
Acetyl-CoA: -0.5

G9U55_RS00100: mal

PKS_AT (543..825): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 125.5
inactive: 68.7
Methoxymalonyl-CoA: 59.2
Methylmalonyl-CoA: 39.2
Ethylmalonyl-CoA: 23.7
Propionyl-CoA: 23.3
Isobutyryl-CoA: 15.1
Benzoyl-CoA: 13.3
Acetyl-CoA: 10.3
fatty_acid: 9.4
2-Methylbutyryl-CoA: 3.8
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

G9U55_RS00110: X

AMP-binding (7..402): X

nrpys: Pyv, Ant

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IGWCHGSMVVSTWMLYGAARQVYGMTEVGGFVTL
Nearest Stachelhaus code(s):: Pyv or Ant GSVWLGVGFK (100% 8Å match); Ant GSVWLGVGFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

G9U55_RS00250: X - mal

AMP-binding (30..440): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NAACHCFGLQSSVALTAGAVVVWGMSEVGNGTSS
Nearest Stachelhaus code(s):: pOH-Bz AFEVLAILGK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

PKS_AT (1204..1498): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.2
inactive: 97.8
Methoxymalonyl-CoA: 65.8
Methylmalonyl-CoA: 57.1
Isobutyryl-CoA: 51.3
Acetyl-CoA: 32.0
Ethylmalonyl-CoA: 30.9
Propionyl-CoA: 27.8
2-Methylbutyryl-CoA: 20.9
Benzoyl-CoA: 20.2
fatty_acid: 17.1
CHC-CoA: 10.2
3-Methylbutyryl-CoA: 9.2
trans-1,2-CPDA: 8.9

G9U55_RS00265: mal - mal - mal - mal - mal - mal

PKS_AT (578..870): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 230.6
inactive: 105.1
Methoxymalonyl-CoA: 53.3
Methylmalonyl-CoA: 47.5
Propionyl-CoA: 26.1
Acetyl-CoA: 18.6
Benzoyl-CoA: 17.1
Isobutyryl-CoA: 15.0
Ethylmalonyl-CoA: 15.0
fatty_acid: 12.7
trans-1,2-CPDA: 8.1
2-Methylbutyryl-CoA: 3.5
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2320..2612): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 225.4
inactive: 107.1
Methoxymalonyl-CoA: 54.4
Methylmalonyl-CoA: 50.0
Propionyl-CoA: 27.1
Benzoyl-CoA: 20.1
Isobutyryl-CoA: 20.0
Acetyl-CoA: 19.8
trans-1,2-CPDA: 13.6
Ethylmalonyl-CoA: 11.8
fatty_acid: 9.8
2-Methylbutyryl-CoA: 5.8
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (4058..4348): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.0
inactive: 106.9
Methoxymalonyl-CoA: 56.3
Methylmalonyl-CoA: 52.6
Acetyl-CoA: 27.6
Propionyl-CoA: 20.1
Benzoyl-CoA: 17.3
Isobutyryl-CoA: 16.8
CHC-CoA: 11.7
Ethylmalonyl-CoA: 10.4
fatty_acid: 9.4
2-Methylbutyryl-CoA: 9.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (5777..6069): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.1
inactive: 115.1
Methoxymalonyl-CoA: 50.6
Methylmalonyl-CoA: 47.7
Propionyl-CoA: 23.3
Acetyl-CoA: 23.1
Isobutyryl-CoA: 16.4
Ethylmalonyl-CoA: 14.9
Benzoyl-CoA: 12.2
fatty_acid: 11.9
trans-1,2-CPDA: 9.4
2-Methylbutyryl-CoA: 8.7
CHC-CoA: 3.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (7496..7787): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.8
inactive: 90.3
Methoxymalonyl-CoA: 51.5
Methylmalonyl-CoA: 42.2
Propionyl-CoA: 24.8
Acetyl-CoA: 18.3
Isobutyryl-CoA: 14.9
Ethylmalonyl-CoA: 12.8
Benzoyl-CoA: 10.0
trans-1,2-CPDA: 9.5
fatty_acid: 7.8
2-Methylbutyryl-CoA: 2.2
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (9334..9623): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.5
inactive: 89.0
Methoxymalonyl-CoA: 40.7
Methylmalonyl-CoA: 40.0
Propionyl-CoA: 29.0
Acetyl-CoA: 25.1
Ethylmalonyl-CoA: 16.8
Isobutyryl-CoA: 9.8
Benzoyl-CoA: 9.8
2-Methylbutyryl-CoA: 6.6
CHC-CoA: 2.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

G9U55_RS00270: mmal - mmal - mmal

PKS_AT (573..870): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 214.1
Ethylmalonyl-CoA: 208.6
Methoxymalonyl-CoA: 166.4
2-Methylbutyryl-CoA: 148.7
trans-1,2-CPDA: 128.9
Propionyl-CoA: 113.3
Malonyl-CoA: 96.3
CHC-CoA: 88.0
Benzoyl-CoA: 61.7
Isobutyryl-CoA: 61.2
Acetyl-CoA: 48.1
fatty_acid: 38.6
inactive: 32.6
3-Methylbutyryl-CoA: 31.4

PKS_AT (2141..2438): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 216.4
Ethylmalonyl-CoA: 213.9
Methoxymalonyl-CoA: 168.8
2-Methylbutyryl-CoA: 154.7
trans-1,2-CPDA: 127.7
Propionyl-CoA: 116.7
Malonyl-CoA: 96.4
CHC-CoA: 91.5
Isobutyryl-CoA: 72.8
Benzoyl-CoA: 66.5
Acetyl-CoA: 50.5
fatty_acid: 43.4
inactive: 41.2
3-Methylbutyryl-CoA: 35.4

PKS_AT (4249..4546): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 204.4
Ethylmalonyl-CoA: 197.4
Methoxymalonyl-CoA: 168.4
2-Methylbutyryl-CoA: 127.9
trans-1,2-CPDA: 126.0
Malonyl-CoA: 106.1
Propionyl-CoA: 104.7
CHC-CoA: 94.9
Isobutyryl-CoA: 75.8
Benzoyl-CoA: 61.2
Acetyl-CoA: 43.2
inactive: 41.8
3-Methylbutyryl-CoA: 30.8
fatty_acid: 29.3

G9U55_RS00275: mal

PKS_AT (547..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 225.0
inactive: 117.6
Methoxymalonyl-CoA: 62.9
Methylmalonyl-CoA: 57.2
Isobutyryl-CoA: 23.5
Propionyl-CoA: 23.0
Acetyl-CoA: 22.2
Benzoyl-CoA: 19.1
fatty_acid: 14.2
Ethylmalonyl-CoA: 13.6
trans-1,2-CPDA: 10.9
CHC-CoA: 8.8
2-Methylbutyryl-CoA: 6.2
3-Methylbutyryl-CoA: 0.0

G9U55_RS00280: mal - mal - mal - mal

PKS_AT (550..845): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 234.3
inactive: 116.3
Methoxymalonyl-CoA: 66.7
Methylmalonyl-CoA: 60.2
Isobutyryl-CoA: 26.5
Benzoyl-CoA: 24.3
Acetyl-CoA: 22.4
Propionyl-CoA: 22.2
Ethylmalonyl-CoA: 18.2
fatty_acid: 13.3
CHC-CoA: 10.5
2-Methylbutyryl-CoA: 9.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2592..2891): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 202.5
inactive: 97.0
Methoxymalonyl-CoA: 57.8
Methylmalonyl-CoA: 45.4
Benzoyl-CoA: 20.2
Acetyl-CoA: 16.8
Isobutyryl-CoA: 16.0
Ethylmalonyl-CoA: 14.2
fatty_acid: 12.6
Propionyl-CoA: 11.5
CHC-CoA: 8.3
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (4635..4931): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 221.0
inactive: 109.2
Methoxymalonyl-CoA: 70.8
Methylmalonyl-CoA: 61.5
Propionyl-CoA: 33.6
Isobutyryl-CoA: 32.6
Benzoyl-CoA: 27.1
Ethylmalonyl-CoA: 25.7
fatty_acid: 21.4
Acetyl-CoA: 20.6
2-Methylbutyryl-CoA: 16.2
CHC-CoA: 16.0
trans-1,2-CPDA: 8.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (6162..6460): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.2
inactive: 103.6
Methoxymalonyl-CoA: 63.3
Methylmalonyl-CoA: 50.6
Propionyl-CoA: 21.3
2-Methylbutyryl-CoA: 17.6
Ethylmalonyl-CoA: 16.6
Acetyl-CoA: 16.1
Benzoyl-CoA: 14.8
fatty_acid: 12.0
CHC-CoA: 11.9
Isobutyryl-CoA: 9.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

G9U55_RS00285: mal - mal - pk - mal - mal - mal

PKS_AT (558..859): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 216.0
inactive: 89.9
Methoxymalonyl-CoA: 53.9
Methylmalonyl-CoA: 44.2
Isobutyryl-CoA: 29.8
Propionyl-CoA: 28.2
Ethylmalonyl-CoA: 23.4
2-Methylbutyryl-CoA: 23.0
Acetyl-CoA: 18.1
Benzoyl-CoA: 16.6
CHC-CoA: 13.7
trans-1,2-CPDA: 8.7
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2311..2618): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.3
inactive: 100.3
Methoxymalonyl-CoA: 60.2
Methylmalonyl-CoA: 46.8
Propionyl-CoA: 37.9
Acetyl-CoA: 22.0
Isobutyryl-CoA: 20.8
Benzoyl-CoA: 16.5
2-Methylbutyryl-CoA: 16.5
Ethylmalonyl-CoA: 10.5
trans-1,2-CPDA: 9.1
CHC-CoA: 8.8
fatty_acid: 8.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (3870..4167): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 224.8
Methylmalonyl-CoA: 222.9
Methoxymalonyl-CoA: 180.8
2-Methylbutyryl-CoA: 166.3
trans-1,2-CPDA: 134.2
Propionyl-CoA: 119.3
CHC-CoA: 113.3
Malonyl-CoA: 110.0
Isobutyryl-CoA: 84.0
Benzoyl-CoA: 66.0
Acetyl-CoA: 54.7
3-Methylbutyryl-CoA: 36.4
inactive: 32.4
fatty_acid: 30.8

PKS_AT (5406..5713): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 218.5
inactive: 112.3
Methoxymalonyl-CoA: 63.7
Methylmalonyl-CoA: 57.1
Isobutyryl-CoA: 21.9
Propionyl-CoA: 21.3
Benzoyl-CoA: 13.6
3-Methylbutyryl-CoA: 13.1
Acetyl-CoA: 12.9
CHC-CoA: 9.6
fatty_acid: 9.1
trans-1,2-CPDA: 3.5
2-Methylbutyryl-CoA: -0.1
Ethylmalonyl-CoA: -3.1

PKS_AT (6933..7232): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 236.2
inactive: 123.4
Methoxymalonyl-CoA: 67.1
Methylmalonyl-CoA: 62.0
Propionyl-CoA: 29.0
Isobutyryl-CoA: 24.2
Benzoyl-CoA: 23.5
Ethylmalonyl-CoA: 20.9
Acetyl-CoA: 19.5
2-Methylbutyryl-CoA: 13.4
CHC-CoA: 13.3
fatty_acid: 13.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (8462..8762): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 226.8
inactive: 106.8
Methoxymalonyl-CoA: 66.0
Methylmalonyl-CoA: 59.4
Propionyl-CoA: 28.0
Isobutyryl-CoA: 27.7
Ethylmalonyl-CoA: 27.7
Benzoyl-CoA: 19.2
Acetyl-CoA: 18.7
fatty_acid: 17.6
CHC-CoA: 16.1
trans-1,2-CPDA: 12.8
2-Methylbutyryl-CoA: 11.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A

NZ_CP049945.1 - Region 2 - T3PKS,betalactone

Download region GenBank file

Download region SVG

Location: 212,498 - 254,791 nt. (total: 42,294 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

G9U55_RS00465: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

G9U55_RS00470: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

G9U55_RS00475: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

G9U55_RS00515: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

G9U55_RS00550: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Hydrolases: deformylase hydrolase

G9U55_RS00555: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

G9U55_RS00595: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: ligase synthase

G9U55_RS00520: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

G9U55_RS00530: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

G9U55_RS00560: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	1.16	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.79	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.68	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.54	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000307.4	0.47	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.47	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.46	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.46	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.46	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.45	NRPS	dimethylcoprogen	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.83	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.71	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.67	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.61	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000307.4	0.57	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.57	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.56	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.56	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.56	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.56	NRPS	dimethylcoprogen	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (9):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.94 out of 27.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.27 out of 32.74

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.12 out of 27.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.81 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.48 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.69 out of 30.98

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.51 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.10 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

G9U55_RS00530: X

AMP-binding (19..396): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSGAWDACGLEGVLFIGGEVNCYGPMESFAFATM
Nearest Stachelhaus code(s):: Ile DALFLGCTFK (50% 8Å match); aIle DALVFGVVLK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP049945.1 - Region 3 - RiPP-like,terpene

Download region GenBank file

Download region SVG

Location: 353,657 - 382,145 nt. (total: 28,489 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

G9U55_RS01075: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

G9U55_RS01140: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

G9U55_RS01170: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

G9U55_RS01215: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase synthetase

G9U55_RS01110: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

G9U55_RS01175: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.51	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.43	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.41	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.41	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.40	terpene	isorenieratene	Streptomyces argillaceus
BGC0002276.2	0.39	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000648.3	0.30	terpene	carotenoid	Myxococcus xanthus
BGC0002309.2	0.29	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000677.5	0.28	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000644.3	0.26	terpene	carotenoid	Dietzia sp. CQ4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.72	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.67	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.64	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.64	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.64	terpene	isorenieratene	Streptomyces argillaceus
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.51	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000645.3	0.49	terpene	carotenoid	Halobacillus halophilus DSM 2266

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

G9U55_RS01135: Lycopene_cycl

Domain 1 (5 - 382): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

G9U55_RS01165: PT_phytoene_like

Domain 1 (16 - 313): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

G9U55_RS01175: PT_FPPS_like

Domain 1 (70 - 366): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.85 out of 20.97

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.67 out of 28.19

Confidence: medium

Additional weak hits (8):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.37 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.82 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.02 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.26 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.27 out of 31.73

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_CP049945.1 - Region 4 - ectoine

Download region GenBank file

Download region SVG

Location: 1,148,592 - 1,158,990 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

G9U55_RS04905: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: aminotransferase

G9U55_RS04880: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

G9U55_RS04890: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

G9U55_RS04915: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.86	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.86	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.42 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (9):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.78 out of 28.14

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.51 out of 20.97

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.37 out of 29.51

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.95 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 32.93

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_CP049945.1 - Region 5 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 2,112,036 - 2,142,417 nt. (total: 30,382 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

G9U55_RS09030: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

G9U55_RS09070: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

G9U55_RS09090: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

G9U55_RS30930: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: decarboxylase

G9U55_RS09085: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.73	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000941.3	0.72	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.69	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.69	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.63	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.63	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002464.3	0.57	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002073.3	0.55	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002690.2	0.54	other (other)	FW0622	Verrucosispora sp. FIM060022

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.73	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000941.3	0.72	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.69	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.69	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.63	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.63	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002464.3	0.57	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002073.3	0.55	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002690.2	0.54	other (other)	FW0622	Verrucosispora sp. FIM060022

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 36.53 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.62 out of 36.53

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.65 out of 23.43

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 26.85

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.84 out of 30.12

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (5):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.10 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.23 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.87 out of 20.97

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.59 out of 30.98

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.57 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
BldD	Development and antibiotic global regulator
DmdR1	Iron(II)-dependent repressor
OsdR	Development and stress management regulator
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP049945.1 - Region 6 - NRPS

Download region GenBank file

Download region SVG

Location: 3,525,531 - 3,575,820 nt. (total: 50,290 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

G9U55_RS15805: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: acyltransferase

G9U55_RS15695: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.13 out of 27.04

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.86 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.03 out of 36.53

Confidence: medium

Additional weak hits (10):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.43 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.58 out of 20.01

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.78 out of 23.43

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.07 out of 30.22

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.68 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.70 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.71 out of 36.54

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.27 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 32.93

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.81 out of 39.62

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 3525530 - 3575820:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Orn - Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

G9U55_RS15695: X - Orn - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (469..866): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHHAFDASWDPWETALGGELNYYGPTETTVDAVT
Nearest Stachelhaus code(s):: Lys DADDAGTVDK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1523..1921): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LHHAFDASWDPWETALGGEWNLYGPTEATVDALV
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (76% 8Å match); Lys DADDAGTVDK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2582..2976): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LHHLFDAAWDPWETALGGELNLYGPTEATVDTLT
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (68% 8Å match); Lys DADDAGTVDK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor

NZ_CP049945.1 - Region 7 - lassopeptide

Download region GenBank file

Download region SVG

Location: 3,709,353 - 3,731,640 nt. (total: 22,288 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase kinase

G9U55_RS16570: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

G9U55_RS16600: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: esterase hydrolase

G9U55_RS16555: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

smcogs: SMCOG1283: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

G9U55_RS16590: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Translocases: permease

G9U55_RS16575: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.50	ribosomal	albusnodin	Streptomyces albus
BGC0000571.3	0.49	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001781.4	0.43	ribosomal	sphaericin	Planomonospora sphaerica
BGC0002015.4	0.42	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001920.4	0.42	ribosomal	siamycin I	Streptomyces sp.
BGC0002307.3	0.42	ribosomal	humidimycin	Streptomyces humidus
BGC0001674.5	0.42	ribosomal	MS-271	Streptomyces mirabilis
BGC0000537.3	0.41	ribosomal	nisin U	Streptococcus uberis
BGC0001789.3	0.41	ribosomal	suicin 90-1330	Streptococcus suis
BGC0002144.3	0.40	ribosomal	phazolicin	Rhizobium sp. Pop5

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.50	ribosomal	albusnodin	Streptomyces albus
BGC0000571.3	0.49	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001781.4	0.43	ribosomal	sphaericin	Planomonospora sphaerica
BGC0002015.4	0.42	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001920.4	0.42	ribosomal	siamycin I	Streptomyces sp.
BGC0002307.3	0.42	ribosomal	humidimycin	Streptomyces humidus
BGC0001674.5	0.42	ribosomal	MS-271	Streptomyces mirabilis
BGC0000537.3	0.41	ribosomal	nisin U	Streptococcus uberis
BGC0001789.3	0.41	ribosomal	suicin 90-1330	Streptococcus suis
BGC0002144.3	0.40	ribosomal	phazolicin	Rhizobium sp. Pop5

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.76 out of 29.38

Confidence: weak

Lasso peptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description

NZ_CP049945.1 - Region 8 - NRPS

Download region GenBank file

Download region SVG

Location: 3,843,925 - 3,898,703 nt. (total: 54,779 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

G9U55_RS17285: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

G9U55_RS17370: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

G9U55_RS17430: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: halogenase methyltransferase

G9U55_RS17275: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
MITE: MITE0000030Halogenation (identity: 61.20%)
smcogs: SMCOG1119: halogenase

G9U55_RS17300: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Lyases: cyclase

G9U55_RS17435: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase synthase

G9U55_RS17255: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

G9U55_RS17320: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

G9U55_RS17325: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.95 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

Additional weak hits (15):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.45 out of 26.85

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.00 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.72 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.28 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.69 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.69 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.19 out of 20.97

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.53 out of 29.51

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.68 out of 32.74

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.88 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.12 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.21 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.77 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 14, location 3843924 - 3898703:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - X) + (D-X - Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

G9U55_RS17320: Val - X

Search NORINE for peptide: strict or relaxed

AMP-binding (178..572): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDHSFDASTYEVFLITGGEVNAYGPTEATTYALL
Nearest Stachelhaus code(s):: Ile or Val DAYFIGAIFK (47% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1241..1634): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TAVCFDTGVQDTSIRVGGDINNYGPTEAGVTVSL
Nearest Stachelhaus code(s):: Lys DIESIGTVTK (47% 8Å match)
Stachelhaus code match:: 60% (weak)

G9U55_RS17325: X - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (511..917): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IAWAVDLFLGDFATSLGAEVNAYGATETTVDSTV
Nearest Stachelhaus code(s):: Lys DSGFSGAVDK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2035..2433): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FDMTFDIAHLEVQALVGGETNVYGPTETTIWSTS
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP049945.1 - Region 9 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 3,967,892 - 3,990,465 nt. (total: 22,574 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

G9U55_RS17805: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acetyltransferase

G9U55_RS17815: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

G9U55_RS17820: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.81	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.80	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000553.3	0.66	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000546.3	0.61	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000513.3	0.60	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.56	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002073.3	0.50	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.81	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.80	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000553.3	0.66	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000546.3	0.61	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000513.3	0.60	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.56	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002073.3	0.50	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for G9U55_RS17845

G9U55_RS17850

Leader:

MALLDLQAMDTPQEEAVGDLAT

Core:

GSQVSLLICEYSSLSVTLCTP

Core with dehydrations:

GDhaQVDhaLLICysEYDhaDhaLDhaVDhbLCysDhbP

antiSMASH-DB 4.0 matches for G9U55_RS17850

100.0%

NZ_CM001165.1and 4 others:

NZ_CP021118.1 Lanthipeptides: CAC01_RS28155_lanthipeptideNZ_CP049945.1 Lanthipeptides: G9U55_RS17850_lanthipeptideNZ_CP119149.1 Lanthipeptides: P0D76_RS02270_lanthipeptideNZ_RWGV01000033.1 Lanthipeptides: EJA11_RS20985_lanthipeptide

Lanthipeptides: STTU_RS29395_lanthipeptide

1

GSQVSLLICEYSSLSVTLCTP

21

GSQVSLLICEYSSLSVTLCTP

1

GSQVSLLICEYSSLSVTLCTP

21

95.2%

NC_020990.1and 26 others:

NZ_AMPN02000002.1 Lanthipeptides: SM8_RS12785_lanthipeptideNZ_AP025692.1 Lanthipeptides: MTP06_RS18190_lanthipeptideNZ_CM002273.1 Lanthipeptides: B590_RS12280_lanthipeptideNZ_CP009802.1 Lanthipeptides: SFR_RS12925_lanthipeptideNZ_CP014485.1 Lanthipeptides: Salbus254_RS12710_lanthipeptideNZ_CP016824.1 Lanthipeptides: BEN82_RS18165_lanthipeptideNZ_CP026490.1 Lanthipeptides: C3K23_RS19520_lanthipeptideNZ_CP031742.1 Lanthipeptides: D0C37_RS13445_lanthipeptideNZ_CP047147.1 Lanthipeptides: GR131_RS18520_lanthipeptideNZ_CP053539.1 Lanthipeptides: HN026_RS11800_lanthipeptideNZ_CP056773.1 Lanthipeptides: HWN34_RS12245_lanthipeptideNZ_CP063844.1 Lanthipeptides: IPZ55_RS12410_lanthipeptideNZ_CP064783.1 Lanthipeptides: IT782_RS12060_lanthipeptideNZ_CP076385.1 Lanthipeptides: KNZ81_RS12450_lanthipeptideNZ_CP079112.1 Lanthipeptides: STALF2_RS18135_lanthipeptideNZ_CP091820.1 Lanthipeptides: L2I08_RS02835_lanthipeptideNZ_CP106650.1 Lanthipeptides: B591_RS12385_lanthipeptideNZ_CP113103.1 Lanthipeptides: OSU72_RS17905_lanthipeptideNZ_JAHUVY010000001.1 Lanthipeptides: STALF3_RS17905_lanthipeptideNZ_JALLPQ010000001.1 Lanthipeptides: MWG58_RS12385_lanthipeptideNZ_KB890715.1 Lanthipeptides: B048_RS0115750_lanthipeptideNZ_KN549183.1 Lanthipeptides: D076_RS30740_lanthipeptideNZ_KZ195583.1 Lanthipeptides: B9W68_RS12440_lanthipeptideNZ_MNPQ01000004.1 Lanthipeptides: BGV78_RS11170_lanthipeptideNZ_OX371412.1 Lanthipeptides: OZE77_RS18215_lanthipeptideNZ_VOGX01000092.1 Lanthipeptides: FRZ02_RS31600_lanthipeptide

Lanthipeptides: XNR_RS11575_lanthipeptide

1

GSQVSLLICEYSSLSVTLCTP

21

GSQ+SLLICEYSSLSVTLCTP

1

GSQISLLICEYSSLSVTLCTP

21

95.2%

NZ_BDHJ01000008.1and 4 others:

NZ_CP032543.1 Lanthipeptides: D6270_RS22715_lanthipeptideNZ_CP076457.1 Lanthipeptides: KME66_RS09945_lanthipeptideNZ_CP077652.1 Lanthipeptides: KRR37_RS22855_lanthipeptideNZ_WUEJ01000001.1 Lanthipeptides: GRQ63_RS04560_lanthipeptide

Lanthipeptides: BHQ08_RS03045_lanthipeptide

1

GSQVSLLICEYSSLSVTLCTP

21

GSQVSLL+CEYSSLSVTLCTP

1

GSQVSLLVCEYSSLSVTLCTP

21

with 71 more sequence matches

Only the first 10 are displayed here.

95.2%

NZ_CP045178.1:

Lanthipeptides: GBW32_RS28450_lanthipeptide

1

GSQVSLLICEYSSLSVTLCTP

21

GSQVSLLICEYSSLSV LCTP

1

GSQVSLLICEYSSLSVVLCTP

21

95.2%

NZ_ML123034.1:

Lanthipeptides: EES43_RS19795_lanthipeptide

1

GSQVSLLICEYSSLSVTLCTP

21

GSQVSLLICE+SSLSVTLCTP

1

GSQVSLLICEFSSLSVTLCTP

21

90.5%

NC_010572.1and 60 others:

NC_021177.1 Lanthipeptides: SFUL_RS24355_lanthipeptideNZ_AQRK01000102.1 Lanthipeptides: YUW_RS30025_lanthipeptideNZ_ARPF01000003.1 Lanthipeptides: B083_RS0107255_lanthipeptideNZ_BMRY01000001.1 Lanthipeptides: IE140_RS02070_lanthipeptideNZ_BMSP01000003.1 Lanthipeptides: IE150_RS06495_lanthipeptideNZ_BMSZ01000003.1 Lanthipeptides: IE135_RS07550_lanthipeptideNZ_BMTW01000017.1 Lanthipeptides: IE134_RS28550_lanthipeptideNZ_BMUG01000009.1 Lanthipeptides: IE264_RS25430_lanthipeptideNZ_BMVK01000002.1 Lanthipeptides: IE272_RS07115_lanthipeptideNZ_BNBJ01000002.1 Lanthipeptides: IE304_RS05195_lanthipeptideNZ_CM003601.1 Lanthipeptides: JI76_RS25200_lanthipeptideNZ_CP010833.1 Lanthipeptides: TK78_RS10875_lanthipeptideNZ_CP011522.1 Lanthipeptides: ABE83_RS11805_lanthipeptideNZ_CP013738.1 Lanthipeptides: WQO_RS23525_lanthipeptideNZ_CP015362.1 Lanthipeptides: A6E92_RS09975_lanthipeptideNZ_CP020563.1 Lanthipeptides: B7C62_RS24450_lanthipeptideNZ_CP020570.1 Lanthipeptides: B1H20_RS34690_lanthipeptideNZ_CP024957.1 Lanthipeptides: CVT27_RS22730_lanthipeptideNZ_CP029361.1 Lanthipeptides: DIJ69_RS10225_lanthipeptideNZ_CP030930.1 Lanthipeptides: DTW94_RS22865_lanthipeptideNZ_CP061072.1 Lanthipeptides: HYC88_RS10560_lanthipeptideNZ_CP079114.1 Lanthipeptides: KV381_RS24895_lanthipeptideNZ_CP084357.1 Lanthipeptides: LEL86_RS29435_lanthipeptideNZ_CP086102.1 Lanthipeptides: LK895_RS11660_lanthipeptideNZ_CP090837.1 Lanthipeptides: LZ559_RS24025_lanthipeptideNZ_CP096281.1 Lanthipeptides: MWG59_RS25685_lanthipeptideNZ_CP101397.1 Lanthipeptides: NLU04_RS06465_lanthipeptideNZ_CP110539.1 Lanthipeptides: OH133_RS12690_lanthipeptideNZ_CP112880.1 Lanthipeptides: N7925_RS11185_lanthipeptideNZ_CP113262.1 Lanthipeptides: OUQ49_RS22935_lanthipeptideNZ_CP117709.1 Lanthipeptides: PSQ21_RS24530_lanthipeptideNZ_DS999644.1 Lanthipeptides: SSGG_RS09925_lanthipeptideNZ_GL877172.1 Lanthipeptides: SACT1_RS12960_lanthipeptideNZ_JAAWWP010000002.1 Lanthipeptides: HFV08_RS04115_lanthipeptideNZ_JAGGOV010000004.1 Lanthipeptides: J7E92_RS02930_lanthipeptideNZ_JAHHWT010000009.1 Lanthipeptides: KM153_RS24430_lanthipeptideNZ_JALDPQ010000064.1 Lanthipeptides: MQC87_RS23965_lanthipeptideNZ_JAMFLF010000002.1 Lanthipeptides: M1212_RS07295_lanthipeptideNZ_JANRMN010000004.1 Lanthipeptides: NW249_RS08610_lanthipeptideNZ_JNLT01000003.1 Lanthipeptides: CD02_RS0108685_lanthipeptideNZ_KB890925.1 Lanthipeptides: B053_RS0113845_lanthipeptideNZ_KL573549.1 Lanthipeptides: BG84_RS0119125_lanthipeptideNZ_KQ257779.1 Lanthipeptides: IQ60_RS22540_lanthipeptideNZ_KZ195572.1 Lanthipeptides: B9W61_RS11940_lanthipeptideNZ_KZ679082.1 Lanthipeptides: C6W96_RS24050_lanthipeptideNZ_KZ819154.1 Lanthipeptides: DBP12_RS10285_lanthipeptideNZ_KZ819178.1 Lanthipeptides: DBP20_RS23960_lanthipeptideNZ_KZ819182.1 Lanthipeptides: DBP21_RS24660_lanthipeptideNZ_LACR01000009.1 Lanthipeptides: YW5_RS12280_lanthipeptideNZ_LIPB01000001.1 Lanthipeptides: AMK17_RS03280_lanthipeptideNZ_LIPE01000001.1 Lanthipeptides: AMK12_RS03355_lanthipeptideNZ_LIVT01000001.1 Lanthipeptides: AMK24_RS01700_lanthipeptideNZ_LIVW01000001.1 Lanthipeptides: AMK28_RS03165_lanthipeptideNZ_LIXK01000001.1 Lanthipeptides: AMK23_RS04085_lanthipeptideNZ_LMEL01000012.1 Lanthipeptides: ASD29_RS10010_lanthipeptideNZ_LZRD01000054.1 Lanthipeptides: A3Q37_RS33745_lanthipeptideNZ_ML123117.1 Lanthipeptides: EES46_RS10300_lanthipeptideNZ_NNBN01000004.1 Lanthipeptides: CG717_RS12310_lanthipeptideNZ_VEHK01000004.1 Lanthipeptides: FS984_RS13530_lanthipeptideNZ_WWGD01000029.1 Lanthipeptides: GTY72_RS23245_lanthipeptide

Lanthipeptides: SGR_RS11800_lanthipeptide

1

GSQVSLLICEYSSLSVTLCTP

21

GSQVSLL+CEYSSLSV LCTP

1

GSQVSLLVCEYSSLSVVLCTP

21

90.5%

NZ_LWLE01000019.1:

Lanthipeptides: A6A29_RS44250_lanthipeptide

1

GSQVSLLICEYSSLSVTLCTP

21

GSQVSLLICE+SSLS+TLCTP

1

GSQVSLLICEHSSLSLTLCTP

21

85.7%

NZ_CP010519.1and 1 other:

NZ_CP092644.1 Lanthipeptides: MID12_RS21330_lanthipeptide

Lanthipeptides: SLNWT_RS22370_lanthipeptide

1

GSQVSLLICEYSSLSVTLCTP

21

GSQVSLL+CEYSSLSV LC+P

1

GSQVSLLVCEYSSLSVVLCSP

21

85.7%

NZ_CP045702.1:

Lanthipeptides: F0344_RS33200_lanthipeptide

1

GSQVSLLICEYSSLSVTLCTP

21

GSQVSLL+CE+SSLS+TLCTP

1

GSQVSLLVCEHSSLSLTLCTP

21

85.7%

NZ_CP054926.1and 11 others:

NZ_CP068598.1 Lanthipeptides: IFE09_RS23820_lanthipeptideNZ_CP071044.1 Lanthipeptides: JHY03_RS23495_lanthipeptideNZ_CP080029.1 Lanthipeptides: KZO11_RS24935_lanthipeptideNZ_JAJUKK010000008.1 Lanthipeptides: LXH09_RS27635_lanthipeptideNZ_JOJC01000009.1 Lanthipeptides: IO23_RS0108435_lanthipeptideNZ_KB891296.1 Lanthipeptides: B061_RS0103425_lanthipeptideNZ_KZ268499.1 Lanthipeptides: CE422_RS23450_lanthipeptideNZ_KZ819159.1 Lanthipeptides: DBP19_RS22830_lanthipeptideNZ_LR881952.1 Lanthipeptides: STRPST75_RS10975_lanthipeptideNZ_LZQS01000001.1 Lanthipeptides: STIB_RS05225_lanthipeptideNZ_RCOL01000001.1 Lanthipeptides: STAN_RS24840_lanthipeptide

Lanthipeptides: HUT09_RS23550_lanthipeptide

1

GSQVSLLICEYSSLSVTLCTP

21

GSQVSLL+CE+SSLSV LCTP

1

GSQVSLLVCEFSSLSVVLCTP

21

85.7%

NZ_CP058556.1and 5 others:

NZ_CP059898.1 Lanthipeptides: H3V39_RS22935_lanthipeptideNZ_CP070242.1 Lanthipeptides: I6J39_RS23755_lanthipeptideNZ_CP070260.1 Lanthipeptides: I6J40_RS10935_lanthipeptideNZ_JAJDST010000047.1 Lanthipeptides: LJC81_RS16960_lanthipeptideNZ_WWGL01000003.1 Lanthipeptides: GTY38_RS03410_lanthipeptide

Lanthipeptides: HXS80_RS11105_lanthipeptide

1

GSQVSLLICEYSSLSVTLCTP

21

GSQVS+L+CEYSSLSV LCTP

1

GSQVSVLVCEYSSLSVVLCTP

21

81.0%

NZ_AQRJ01000051.1and 1 other:

NZ_LFBV01000002.1 Lanthipeptides: AB852_RS09920_lanthipeptide

Lanthipeptides: YW7_RS14945_lanthipeptide

1

GSQVSLLICEYSSLSVTLCTP

21

GSQVSL++CEYSSLS LCTP

1

GSQVSLIVCEYSSLSALLCTP

21

66.7%

NZ_QGGR01000008.1:

Lanthipeptides: BC793_RS19230_lanthipeptide

1

GSQVSLLICEYSSLSVTLCT

20

GSQ SLL+C SSLSVT C

2

GSQASLLLCGDSSLSVTTCN

21

MIBiG 4.0 matches for G9U55_RS17850

86.4%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

1

GSQVSLLICEYSSLSVTLCTP

21

GSQVSLL+CEYSSLSV LCTP

2

GSQVSLLVCEYSSLSVVLCTP

22

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

Additional weak hits (4):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.11 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.07 out of 39.62

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.30 out of 18.57

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.35 out of 20.01

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

G9U55_RS17850 - Class III

Cleavage pHMM score: 30.10

RODEO score: 0

Monoisotopic mass: 2073.1 Da

Molecular weight: 2074.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2092.4 Da N = 1; 2110.4 Da N = 2; 2128.4 Da N = 3; 2146.5 Da N = 4; 2164.5 Da N = 5

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_CP049945.1 - Region 10 - terpene

Download region GenBank file

Download region SVG

Location: 4,794,912 - 4,815,886 nt. (total: 20,975 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

G9U55_RS21460: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: deformylase

G9U55_RS21450: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: cyclase

G9U55_RS21455: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.81	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000650.3	0.36	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0002181.3	0.36	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000706.3	0.35	saccharide	kanamycin	Streptomyces kanamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.81	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000650.3	0.36	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0002181.3	0.36	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000706.3	0.35	saccharide	kanamycin	Streptomyces kanamyceticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

G9U55_RS21455: T1TS

Domain 1 (2 - 303): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.14 out of 24.78

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.17 out of 25.88

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.21 out of 27.18

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.01 out of 27.18

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.29 out of 27.04

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (6):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.68 out of 27.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.28 out of 27.04

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.42 out of 28.14

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
DasR	N-acetylglucosamine dependent repressor
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes
PsrA	Oleic acid responsive regulator

NZ_CP049945.1 - Region 11 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 4,825,822 - 4,846,865 nt. (total: 21,044 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

G9U55_RS21640: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

G9U55_RS21590: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000498.5	0.38	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0001364.3	0.38	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000561.5	0.38	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0002116.3	0.37	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001910.4	0.36	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000498.5	0.38	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0001364.3	0.38	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000561.5	0.38	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0002116.3	0.37	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001910.4	0.36	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

G9U55_RS21590: PT_FPPS_like

Domain 1 (60 - 340): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (8):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.69 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.09 out of 26.06

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.71 out of 19.26

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.82 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.78 out of 30.98

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.14 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_CP049945.1 - Region 12 - terpene

Download region GenBank file

Download region SVG

Location: 5,137,859 - 5,160,144 nt. (total: 22,286 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

G9U55_RS22945: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

G9U55_RS22935: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000821.5	0.29	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001562.5	0.29	NRPS	curacomycin	Streptomyces curacoi
BGC0001895.4	0.29	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0002443.3	0.29	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus
BGC0000453.5	0.28	NRPS	valinomycin	Streptomyces tsusimaensis
BGC0001300.5	0.28	PKS	anthracimycin	Streptomyces sp. CNH365
BGC0002514.3	0.28	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0000252.5	0.28	PKS	nonactin	Streptomyces griseus subsp. griseus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000821.5	0.29	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001562.5	0.29	NRPS	curacomycin	Streptomyces curacoi
BGC0001895.4	0.29	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0002443.3	0.29	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus
BGC0000453.5	0.28	NRPS	valinomycin	Streptomyces tsusimaensis
BGC0001300.5	0.28	PKS	anthracimycin	Streptomyces sp. CNH365
BGC0002514.3	0.28	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0000252.5	0.28	PKS	nonactin	Streptomyces griseus subsp. griseus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

G9U55_RS22945: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (350 - 717): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 25.31

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.69 out of 30.11

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (3):

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.96 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CatR	H2O2-responsive repressor
CelR	Cellobiose uptake repressor

NZ_CP049945.1 - Region 13 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 5,402,522 - 5,435,592 nt. (total: 33,071 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

G9U55_RS24150: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

G9U55_RS24095: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

G9U55_RS24155: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.55	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.53	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002305.2	0.50	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.55	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.53	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002305.2	0.50	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 25.90 out of 27.18

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.14 out of 27.18

Confidence: medium

Additional weak hits (9):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.94 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.90 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.48 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.85 out of 26.06

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.32 out of 27.18

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.37 out of 25.88

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NZ_CP049945.1 - Region 14 - T1PKS

Download region GenBank file

Download region SVG

Location: 5,512,360 - 5,587,109 nt. (total: 74,750 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

G9U55_RS24525: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

G9U55_RS24535: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

G9U55_RS24585: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

G9U55_RS24635: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: acylase

G9U55_RS24605: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

G9U55_RS24610: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

G9U55_RS24615: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase phosphatase

G9U55_RS24560: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

G9U55_RS24580: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: synthase

G9U55_RS24555: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Translocases: transporter

G9U55_RS24650: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001694.4	0.90	PKS	Neoabyssomicin B, Abyssomicin 2, Abyssomicin 4	Streptomyces koyangensis
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.73	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001694.4	0.90	PKS	Neoabyssomicin B, Abyssomicin 2, Abyssomicin 4	Streptomyces koyangensis
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.73	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (12):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.03 out of 30.22

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.85 out of 26.85

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.32 out of 25.88

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.61 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.00 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.91 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.43 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.87 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.81 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 20, location 5512359 - 5587109:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-ccmal - ccmal - ccmal) + (Me-ccmal - redmal) + (mal)
Non-colinear ordering:: G9U55_RS24605 + G9U55_RS24610 + G9U55_RS24615

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

G9U55_RS24605: mal - mmal - mal - mal

PKS_AT (550..841): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 185.5
inactive: 90.5
Methylmalonyl-CoA: 64.8
Methoxymalonyl-CoA: 61.2
Propionyl-CoA: 42.0
Ethylmalonyl-CoA: 39.8
CHC-CoA: 26.3
fatty_acid: 25.3
Benzoyl-CoA: 23.5
trans-1,2-CPDA: 22.4
2-Methylbutyryl-CoA: 20.1
Isobutyryl-CoA: 16.9
Acetyl-CoA: 15.9
3-Methylbutyryl-CoA: 2.7

PKS_AT (1563..1864): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 212.3
Ethylmalonyl-CoA: 207.6
Methoxymalonyl-CoA: 170.4
2-Methylbutyryl-CoA: 150.4
trans-1,2-CPDA: 128.7
Propionyl-CoA: 125.2
Malonyl-CoA: 92.3
CHC-CoA: 91.2
Isobutyryl-CoA: 78.9
Benzoyl-CoA: 49.4
fatty_acid: 44.7
3-Methylbutyryl-CoA: 38.6
Acetyl-CoA: 37.9
inactive: 28.5

PKS_AT (3388..3679): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 185.9
inactive: 90.3
Methylmalonyl-CoA: 67.2
Methoxymalonyl-CoA: 62.3
Ethylmalonyl-CoA: 40.9
Propionyl-CoA: 40.0
CHC-CoA: 26.5
fatty_acid: 25.9
Benzoyl-CoA: 24.1
trans-1,2-CPDA: 23.5
2-Methylbutyryl-CoA: 20.8
Acetyl-CoA: 20.1
Isobutyryl-CoA: 17.6
3-Methylbutyryl-CoA: 3.4

PKS_AT (5133..5424): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 190.6
inactive: 91.8
Methylmalonyl-CoA: 69.6
Methoxymalonyl-CoA: 63.7
Propionyl-CoA: 45.8
Ethylmalonyl-CoA: 43.4
fatty_acid: 26.8
CHC-CoA: 26.2
2-Methylbutyryl-CoA: 25.6
Benzoyl-CoA: 23.8
trans-1,2-CPDA: 23.0
Isobutyryl-CoA: 18.6
Acetyl-CoA: 17.5
3-Methylbutyryl-CoA: 3.7

G9U55_RS24610: mmal - mal

PKS_AT (556..855): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 212.5
Ethylmalonyl-CoA: 207.2
Methoxymalonyl-CoA: 171.4
2-Methylbutyryl-CoA: 149.3
trans-1,2-CPDA: 133.1
Propionyl-CoA: 124.5
Malonyl-CoA: 93.4
CHC-CoA: 91.4
Isobutyryl-CoA: 79.0
Benzoyl-CoA: 50.3
fatty_acid: 45.2
Acetyl-CoA: 38.4
3-Methylbutyryl-CoA: 37.7
inactive: 28.9

PKS_AT (2358..2650): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 185.5
inactive: 89.3
Methylmalonyl-CoA: 71.5
Methoxymalonyl-CoA: 66.3
Propionyl-CoA: 44.0
Ethylmalonyl-CoA: 42.4
CHC-CoA: 33.2
trans-1,2-CPDA: 27.1
fatty_acid: 27.0
Benzoyl-CoA: 26.6
2-Methylbutyryl-CoA: 21.8
Isobutyryl-CoA: 19.8
Acetyl-CoA: 17.3
3-Methylbutyryl-CoA: 7.5

G9U55_RS24615: mal

PKS_AT (569..859): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.8
inactive: 88.0
Methylmalonyl-CoA: 69.8
Methoxymalonyl-CoA: 66.3
Propionyl-CoA: 43.2
Ethylmalonyl-CoA: 42.2
2-Methylbutyryl-CoA: 26.8
CHC-CoA: 25.4
Benzoyl-CoA: 25.2
Isobutyryl-CoA: 24.9
fatty_acid: 23.8
trans-1,2-CPDA: 21.0
Acetyl-CoA: 20.2
3-Methylbutyryl-CoA: 7.4

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_CP049945.1 - Region 15 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 5,779,249 - 5,835,550 nt. (total: 56,302 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

G9U55_RS25570: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Ligases: ligase synthase

G9U55_RS25550: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

G9U55_RS25555: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

G9U55_RS25575: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

G9U55_RS25580: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

G9U55_RS25625: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Translocases: permease transporter

G9U55_RS25590: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

G9U55_RS25630: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.90	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002192.3	0.90	PKS	FR901512	fungal sp. No.14919
BGC0002135.2	0.90	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001273.3	0.90	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.89	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.89	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.89	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001166.5	0.88	NRPS	HC-toxin	Alternaria jesenskae
BGC0001160.5	0.87	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.87	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.96 out of 30.25

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.36 out of 27.04

Confidence: medium

Additional weak hits (19):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.91 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.48 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.32 out of 29.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.70 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.56 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.52 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.54 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.37 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.43 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.12 out of 30.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.28 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.95 out of 36.53

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.09 out of 28.14

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.83 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.90 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.47 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.96 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 21, location 5779248 - 5835550:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA) + (ohmal)
Non-colinear ordering:: G9U55_RS25575 + G9U55_RS25580

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 22, location 5779248 - 5827063:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA) + (ohmal)
Non-colinear ordering:: G9U55_RS25575 + G9U55_RS25580

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 23, location 5787121 - 5835550:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA) + (ohmal)
Non-colinear ordering:: G9U55_RS25575 + G9U55_RS25580

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

G9U55_RS25555: X

AMP-binding (41..428): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWGAFDFSVWEAHFFCGGAFNQYGPTETCIDSTT
Nearest Stachelhaus code(s):: Glu DVWHFGRINK (68% 8Å match); Gln DAWQFGLIDK (65% 8Å match); His DYWHFGAVDK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

G9U55_RS25575: Acetyl-CoA

CAL_domain (199..602): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 12.0
AHBA: 8.7
shikimic_acid: 7.9
NH2: 2.6
fatty_acid: 0.0

G9U55_RS25580: mal

PKS_AT (540..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 54.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 153.4
Methoxymalonyl-CoA: 91.7
inactive: 79.4
Methylmalonyl-CoA: 76.6
Propionyl-CoA: 56.7
Isobutyryl-CoA: 54.4
Ethylmalonyl-CoA: 52.5
2-Methylbutyryl-CoA: 35.8
Benzoyl-CoA: 29.2
fatty_acid: 26.7
trans-1,2-CPDA: 26.6
CHC-CoA: 25.7
Acetyl-CoA: 24.3
3-Methylbutyryl-CoA: 16.4

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
ColR	Phenol-responsive regulator
DasR	N-acetylglucosamine dependent repressor

NZ_CP049945.1 - Region 16 - RiPP-like

Download region GenBank file

Download region SVG

Location: 5,849,746 - 5,861,074 nt. (total: 11,329 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

G9U55_RS25720: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: deacetylase

G9U55_RS25750: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002788.2	0.29	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001377.5	0.28	PKS	uncialamycin	Streptomyces uncialis
BGC0001060.5	0.25	PKS	dynemicin A	Micromonospora chersina
BGC0001984.3	0.25	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0000241.5	0.24	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.24	PKS	nenestatin	Micromonospora echinospora
BGC0000240.5	0.23	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora pacifica
BGC0000029.5	0.23	PKS	BE-14106	Streptomyces sp. DSM 21069
BGC0000233.5	0.21	PKS	hedamycin	Streptomyces griseoruber
BGC0001764.4	0.19	NRPS	s56-p1	Streptomyces sp. SoC090715LN-17

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002788.2	0.29	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001377.5	0.28	PKS	uncialamycin	Streptomyces uncialis
BGC0001060.5	0.25	PKS	dynemicin A	Micromonospora chersina
BGC0001984.3	0.25	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0000241.5	0.24	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.24	PKS	nenestatin	Micromonospora echinospora
BGC0000240.5	0.23	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora pacifica
BGC0000029.5	0.23	PKS	BE-14106	Streptomyces sp. DSM 21069
BGC0000233.5	0.21	PKS	hedamycin	Streptomyces griseoruber
BGC0001764.4	0.19	NRPS	s56-p1	Streptomyces sp. SoC090715LN-17

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.23 out of 32.74

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CP049945.1 - Region 17 - RiPP-like

Download region GenBank file

Download region SVG

Location: 6,243,324 - 6,253,539 nt. (total: 10,216 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.46	ribosomal	microcin L	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.43	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002698.2	0.42	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.41	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000484.5	0.40	ribosomal	glycocin F	Lactobacillus plantarum
BGC0001862.4	0.40	ribosomal	pallidocin	Aeribacillus pallidus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.46	ribosomal	microcin L	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.43	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002698.2	0.42	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.41	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000484.5	0.40	ribosomal	glycocin F	Lactobacillus plantarum
BGC0001862.4	0.40	ribosomal	pallidocin	Aeribacillus pallidus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.68 out of 30.12

Confidence: medium

Additional weak hits (5):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.61 out of 21.55

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 27.04

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.98 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP049945.1 - Region 18 - terpene

Download region GenBank file

Download region SVG

Location: 6,332,696 - 6,359,254 nt. (total: 26,559 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

G9U55_RS27830: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

G9U55_RS27865: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

G9U55_RS27925: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

Transferases: aminotransferase transferase

G9U55_RS27825: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

G9U55_RS27890: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Ligases: synthetase

G9U55_RS27870: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

G9U55_RS27855: PT_phytoene_like

Domain 1 (17 - 293): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

G9U55_RS27860: PT_phytoene_like

Domain 1 (17 - 299): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

G9U55_RS27870: PT_FPPS_like

Domain 1 (60 - 354): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

G9U55_RS27875: T2TS

Domain 1 (23 - 656): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.25 out of 29.72

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (8):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.13 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.08 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.36 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.59 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.96 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
NtrC	Nitrogen regulatory protein C

NZ_CP049945.1 - Region 19 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 6,410,035 - 6,459,448 nt. (total: 49,414 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxygenase

G9U55_RS28225: flavodoxin

smcogs: SMCOG1134: flavodoxin

G9U55_RS28245: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

G9U55_RS28250: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

G9U55_RS28255: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

G9U55_RS28260: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase kinase

G9U55_RS28175: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

G9U55_RS28270: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Ligases: synthase

G9U55_RS28240: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002365.2	1.21	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001043.4	1.21	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001273.3	0.90	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.90	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000996.5	0.90	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001244.3	0.89	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002075.3	0.83	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001726.4	0.75	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0001556.5	0.69	NRPS, PKS	combamide	Streptomyces sp.
BGC0002509.3	0.69	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002365.2	0.84	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001043.4	0.84	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000996.5	0.75	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001726.4	0.70	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0001556.5	0.68	NRPS, PKS	combamide	Streptomyces sp.
BGC0002509.3	0.68	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (12):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.07 out of 39.62

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.69 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.06 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.03 out of 24.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.21 out of 27.04

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.28 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.14 out of 31.73

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.33 out of 25.75

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.87 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 27, location 6410034 - 6459448:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

G9U55_RS28240: pk - Orn

Search NORINE for peptide: strict or relaxed

PKS_AT (558..854): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; CE-Malonyl-CoA: 54.2%; Acetyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 103.9
Methoxymalonyl-CoA: 96.3
Malonyl-CoA: 91.2
Ethylmalonyl-CoA: 85.2
Propionyl-CoA: 63.6
Isobutyryl-CoA: 60.3
Benzoyl-CoA: 57.0
Acetyl-CoA: 49.4
trans-1,2-CPDA: 48.2
2-Methylbutyryl-CoA: 46.0
fatty_acid: 28.9
CHC-CoA: 27.0
inactive: 21.8
3-Methylbutyryl-CoA: 15.4

AMP-binding (2312..2725): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: ASWAFDVFTGDRELIVGSDLNSYGVTEATIDSAC
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_CP049945.1 - Region 20 - terpene

Download region GenBank file

Download region SVG

Location: 6,633,149 - 6,655,731 nt. (total: 22,583 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

G9U55_RS29165: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

G9U55_RS29180: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

G9U55_RS29190: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

G9U55_RS29195: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: deacetylase hydrolase

G9U55_RS29170: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

G9U55_RS29210: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002318.2	0.42	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001962.3	0.40	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000194.5	0.39	PKS	actinorhodin	Streptomyces coelicolor A3(2)
BGC0001858.2	0.39	PKS	alternapyrone B, alternapyrone C, alternapyrone D, alternapyrone E, alternapyrone F	Parastagonospora nodorum SN15
BGC0000012.3	0.39	PKS	alternapyrone	Alternaria solani

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002318.2	0.42	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001962.3	0.40	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000194.5	0.39	PKS	actinorhodin	Streptomyces coelicolor A3(2)
BGC0001858.2	0.39	PKS	alternapyrone B, alternapyrone C, alternapyrone D, alternapyrone E, alternapyrone F	Parastagonospora nodorum SN15
BGC0000012.3	0.39	PKS	alternapyrone	Alternaria solani

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

G9U55_RS29160: PT_phytoene_like

Domain 1 (279 - 532): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 14.75 out of 31.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_CP049945.1 - Region 21 - NRPS,T1PKS,lanthipeptide-class-ii,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 6,781,885 - 6,835,617 nt. (total: 53,733 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
lanthipeptide-class-ii: cds(LANC_like and DUF4135)
lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

G9U55_RS29815: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

G9U55_RS29820: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

G9U55_RS29860: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Hydrolases: protease

G9U55_RS29930: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

G9U55_RS29875: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: synthase

G9U55_RS29865: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.81	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.78	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.78	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.76	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000553.3	0.74	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000513.3	0.71	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000518.3	0.70	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000525.5	0.69	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for G9U55_RS29875

allorf_6814320_6814448

Leader:

MPRREGARASRARPPGAHRAYAA

allorf_6814320_6814448

Leader:

MPRREGARASRARPPGAHRAYAA

Shared core:

RTRAHQRYAWAARRCGPPR

Core with dehydrations:

RDhbRAHQRYAWAARRCysGPPR

antiSMASH-DB 4.0 matches for allorf_6814320_6814448

100.0%

NZ_CP049945.1and 2 others:

NZ_CP049945.1 Lanthipeptides: allorf_6814320_6814448_lanthipeptideNZ_CP049945.1 Lanthipeptides: allorf_6814320_6814448_lanthipeptide

Lanthipeptides: allorf_6814320_6814448_lanthipeptide

1

RTRAHQRYAWAARRCGPPR

19

RTRAHQRYAWAARRCGPPR

1

RTRAHQRYAWAARRCGPPR

19

42.9%

NZ_CP031742.1and 1 other:

NZ_CP031742.1 Lanthipeptides: allorf_0126471_0126689_lanthipeptide

Lanthipeptides: allorf_0126471_0126689_lanthipeptide

1

RTRAHQRYAWAARRCGPPR

19

RTRAHQ YAWAARRCGPPR

24

RTRAHQGYAWAARRCGPPR

42

30.0%

NZ_CP071463.1:

Lanthipeptides: allorf_0726548_0726703_lanthipeptide

10

WAARRCGPPR

19

W + RCG PR

10

WTSSRCGNPR

19

Lanthipeptide(s) for G9U55_RS29895

allorf_6814320_6814448

Leader:

MPRREGARASRARPPGAHRAYAA

allorf_6814320_6814448

Leader:

MPRREGARASRARPPGAHRAYAA

Shared core:

RTRAHQRYAWAARRCGPPR

Core with dehydrations:

RDhbRAHQRYAWAARRCysGPPR

antiSMASH-DB 4.0 matches for allorf_6814320_6814448

100.0%

NZ_CP049945.1and 2 others:

NZ_CP049945.1 Lanthipeptides: allorf_6814320_6814448_lanthipeptideNZ_CP049945.1 Lanthipeptides: allorf_6814320_6814448_lanthipeptide

Lanthipeptides: allorf_6814320_6814448_lanthipeptide

1

RTRAHQRYAWAARRCGPPR

19

RTRAHQRYAWAARRCGPPR

1

RTRAHQRYAWAARRCGPPR

19

42.9%

NZ_CP031742.1and 1 other:

NZ_CP031742.1 Lanthipeptides: allorf_0126471_0126689_lanthipeptide

Lanthipeptides: allorf_0126471_0126689_lanthipeptide

1

RTRAHQRYAWAARRCGPPR

19

RTRAHQ YAWAARRCGPPR

24

RTRAHQGYAWAARRCGPPR

42

30.0%

NZ_CP071463.1:

Lanthipeptides: allorf_0726548_0726703_lanthipeptide

10

WAARRCGPPR

19

W + RCG PR

10

WTSSRCGNPR

19

allorf_6834514_6834684

Leader:

MTPGTAREREAGS

Core:

GSWPASPVRSPGPQRPAKVCRRAVPVQDRPLAAAVRRLPAPRP

Core with dehydrations:

GDhaWPADhaPVRDhaPGPQRPAKVCysRRAVPVQDRPLAAAVRRLPAPRP

antiSMASH-DB 4.0 matches for allorf_6834514_6834684

100.0%

NZ_CP049945.1:

Lanthipeptides: allorf_6834514_6834684_lanthipeptide

1

GSWPASPVRSPGPQRPAKVCRRAVPVQDRPLAAAVRRLPAPRP

43

GSWPASPVRSPGPQRPAKVCRRAVPVQDRPLAAAVRRLPAPRP

1

GSWPASPVRSPGPQRPAKVCRRAVPVQDRPLAAAVRRLPAPRP

43

23.3%

NZ_CP070326.1:

Lanthipeptides: allorf_7802948_7803130_lanthipeptide

18

KVCRRAVPVQDRPLAAAVRRLPAPRP

43

+VCR+A P+ A+R L RP

1

EVCRKAFPLGMWWRVTAMRSLRMARP

26

22.9%

NZ_JACCCA010000013.1and 1 other:

NZ_JACHCM010000004.1 Lanthipeptides: HDE76_RS13970_lanthipeptide

Lanthipeptides: HDE78_RS18170_lanthipeptide

4

PASPVRSPGPQRPAKVCRRAVPVQDRP

30

PAS + PQ+PA A+P RP

17

PASATSTVKPQQPAITGNSAIPDNQRP

43

with 7 more sequence matches

19.6%

NZ_KN293991.1:

Lanthipeptides: ROSMUC_RS19030_lanthipeptide

19

VCRRAVPVQDRPLAAAVRRL

38

+CR QDRP A +RR

1

ICRE----QDRPAAQVIRRF

16

18.6%

NZ_FOSG01000004.1:

Lanthipeptides: allorf_347099_347284_lanthipeptide

1

GSWPASPVRSPGP

13

G W PVR PGP

3

GRWDGEPVRWPGP

15

18.6%

NZ_LT607413.1:

Lassopeptides: GA0070618_RS33740_lassopeptide

1

GSWPASPVRSPGPQRPAKVCR

21

GS S S Q+PA +C

1

GSLFTSCRESFVTQKPASICN

21

18.6%

NZ_SLWR01000003.1:

Lanthipeptides: allorf_089384_089611_lanthipeptide

14

QRPAKVCRRAVPVQDRPL

31

P +VCRR+ P +DR

4

HHPDRVCRRSQPCRDRSY

21

17.3%

NZ_CP013219.1:

Lanthipeptides: allorf_0170753_0170935_lanthipeptide

7

PVRSPGPQRPAKVCRR

22

P RS G RP+KV +R

19

PCRSIGAGRPSKVAQR

34

16.3%

NZ_BBZG01000001.1and 1 other:

NZ_FOBF01000002.1 Lanthipeptides: BMX74_RS43825_lanthipeptide

Lanthipeptides: ASC57_RS43625_lanthipeptide

12

GPQRPAKVCRRAV

24

GPQ A C+R V

4

GPQACANTCKRTV

16

14.0%

NZ_CP026498.1:

Lanthipeptides: C2142_RS40575_lanthipeptide

23

AVPVQDRPLAAAVRR

37

+ +QDR AA+R

4

GIELQDRAFVAAIRE

18

MIBiG 4.0 matches for allorf_6834514_6834684

9.3%

BGC0000582.4 (ADR72962.1):

Linaridin: cypemycin

4

PASPVRSPGPQRPAKVC

20

PA+P + + + +C

3

PATPTVAQFVIQGSTIC

19

allorf_6834749_6834883

Leader:

MFTEYPGAIMVRPPGG

Core:

HAGRSGCSPLPPRFAPLRHRPGRQGSRT

Core with dehydrations:

HAGRDhaGCysDhaPLPPRFAPLRHRPGRQGDhaRDhb

antiSMASH-DB 4.0 matches for allorf_6834749_6834883

100.0%

NZ_CP049945.1:

Lanthipeptides: allorf_6834749_6834883_lanthipeptide

1

HAGRSGCSPLPPRFAPLRHRPGRQGSRT

28

HAGRSGCSPLPPRFAPLRHRPGRQGSRT

1

HAGRSGCSPLPPRFAPLRHRPGRQGSRT

28

26.7%

NZ_BMVL01000013.1and 1 other:

NZ_BMVL01000013.1 Lanthipeptides: allorf_062892_063122_lanthipeptide

Lanthipeptides: allorf_062892_063122_lanthipeptide

3

GRSGCSPLPPRFAPLRHRPGRQGSR

27

G +GC+ + P+R G SR

5

GNAGCTTVGASAGPIRSIRGSDTSR

29

19.4%

NZ_CP059734.1:

Lanthipeptides: SG34_RS31140_lanthipeptide

3

GRSGCSPLPPR

13

G + CSP PPR

23

GSAICSPCPPR

33

with 2 more sequence matches

18.2%

NZ_CP119804.1:

Lanthipeptides: allorf_1910563_1910769_lanthipeptide

2

AGRSGCSPLPPRFAPL

17

R+GC PPR +

2

VERAGCESDPPRIYEI

17

17.9%

NZ_JAELVF020000001.1:

Lanthipeptides: allorf_1254884_1255084_lanthipeptide

1

HAGRSGCSP

9

HAGR GC+P

6

HAGRWGCAP

14

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.48 out of 36.53

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.89 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.37 out of 23.79

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.71 out of 23.79

Confidence: medium

Additional weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.92 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.77 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.86 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.96 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.75 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

allorf_6814320_6814448 - Class II

Cleavage pHMM score: -6.50

RODEO score: 0

Monoisotopic mass: 2290.2 Da

Molecular weight: 2291.6 Da

Number of bridges: 1

allorf_6814320_6814448 - Class II

Cleavage pHMM score: -6.50

RODEO score: 0

Monoisotopic mass: 2290.2 Da

Molecular weight: 2291.6 Da

Number of bridges: 1

allorf_6814320_6814448 - Class II

Cleavage pHMM score: -6.50

RODEO score: 0

Monoisotopic mass: 2290.2 Da

Molecular weight: 2291.6 Da

Number of bridges: 1

allorf_6814320_6814448 - Class II

Cleavage pHMM score: -6.50

RODEO score: 0

Monoisotopic mass: 2290.2 Da

Molecular weight: 2291.6 Da

Number of bridges: 1

allorf_6834514_6834684 - Class II

Cleavage pHMM score: -5.10

RODEO score: 0

Monoisotopic mass: 4565.6 Da

Molecular weight: 4568.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4586.3 Da N = 1; 4604.4 Da N = 2

allorf_6834749_6834883 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 2978.6 Da

Molecular weight: 2980.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2998.4 Da N = 1; 3016.4 Da N = 2; 3034.4 Da N = 3

Predicted core structure(s)

For candidate cluster 29, location 6781884 - 6835617:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - mal - Pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 30, location 6781884 - 6832651:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - mal - Pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

G9U55_RS29865: Acetyl-CoA - mal - Pro

Search NORINE for peptide: strict or relaxed

CAL_domain (161..488): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 22.8
NH2: 15.4
shikimic_acid: 0.0
AHBA: 0.0
fatty_acid: -3.1

PKS_AT (1194..1476): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 98.4
inactive: 57.5
Methylmalonyl-CoA: 40.7
Methoxymalonyl-CoA: 35.1
Propionyl-CoA: 30.2
fatty_acid: 24.7
2-Methylbutyryl-CoA: 24.0
CHC-CoA: 19.5
Benzoyl-CoA: 17.1
trans-1,2-CPDA: 16.2
Acetyl-CoA: 14.9
Ethylmalonyl-CoA: 14.1
Isobutyryl-CoA: 12.5
3-Methylbutyryl-CoA: 8.7

AMP-binding (2586..2980): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LEHTFDVSVQETFMYSAGEYNQYGPTETSVIVTS
Nearest Stachelhaus code(s):: Pro DVQFAAQVVK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP049946.1 - Region 1 - T1PKS,butyrolactone

Download region GenBank file

Download region SVG

Location: 1 - 140,231 nt. (total: 140,231 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

G9U55_RS30085: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

G9U55_RS30165: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase acylase transferase

G9U55_RS30040: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

G9U55_RS30110: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

G9U55_RS30140: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

G9U55_RS30160: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase

G9U55_RS30155: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

G9U55_RS30135: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

G9U55_RS30145: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

G9U55_RS30170: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

G9U55_RS30190: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

G9U55_RS30295: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

G9U55_RS30855: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

G9U55_RS31210: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

G9U55_RS31415: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.98	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.75	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.60	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001273.3	0.47	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.46	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.46	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.45	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.32	PKS	oronofacic acid	Pseudomonas syringae
BGC0002192.3	0.31	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.30	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001273.3	0.77	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000849.4	0.70	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000850.5	0.63	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001268.4	0.63	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.80 out of 23.79

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.56 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.56 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 17.89 out of 23.79

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 17.84 out of 23.79

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 27.25 out of 30.22

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.84 out of 30.12

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.57 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.48 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 27.18 out of 30.12

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.30 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 17.88 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.15 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.71 out of 23.79

Confidence: medium

Additional weak hits (101):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.12 out of 26.85

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.76 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.33 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.30 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.16 out of 19.26

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.94 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.21 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.25 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.60 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.70 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.98 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.39 out of 30.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.46 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.65 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.23 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.38 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.11 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.07 out of 32.74

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.51 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.22 out of 30.22

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 19.98 out of 32.74

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.14 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.51 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.02 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.95 out of 27.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.78 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.04 out of 32.74

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.38 out of 26.85

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 20.91 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 19.98 out of 32.74

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.16 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.36 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.16 out of 30.22

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.70 out of 29.51

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.36 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.78 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.13 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.39 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.68 out of 29.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.38 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.91 out of 32.74

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.81 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.85 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.75 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.82 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.06 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.90 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.79 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.28 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.43 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.44 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.04 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.44 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.04 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.22 out of 30.98

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.41 out of 23.43

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.04 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.53 out of 32.93

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 19.93 out of 27.18

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.99 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.30 out of 20.01

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.04 out of 29.65

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.76 out of 27.18

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.22 out of 30.98

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.58 out of 25.31

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.04 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.04 out of 29.65

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 18.78 out of 27.04

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.29 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.75 out of 29.65

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 18.91 out of 27.04

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.22 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.44 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.09 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.48 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.13 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 140231:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - ccmal) + (redmal - ohmal - ohmal - ccmal - ccmal - ohmal) + (Me-ohmal - ohmal - ohmal - Me-redmal) + (redmal - Me-ohmal - pk) + (ohmal) + (ohmal - redmal) + (ohmal)
Non-colinear ordering:: G9U55_RS31415 + G9U55_RS31420 + G9U55_RS30855 + G9U55_RS30295 + G9U55_RS30170 + G9U55_RS31210 + G9U55_RS30190 + G9U55_RS30040

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

G9U55_RS30040: mal

PKS_AT (584..876): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 195.3
inactive: 81.3
Methoxymalonyl-CoA: 63.7
Methylmalonyl-CoA: 49.2
Ethylmalonyl-CoA: 27.8
Propionyl-CoA: 18.6
fatty_acid: 17.4
Benzoyl-CoA: 14.6
Isobutyryl-CoA: 14.4
Acetyl-CoA: 13.3
CHC-CoA: 2.1
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -0.9

G9U55_RS30170: mal - mmal - pk

PKS_AT (581..857): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 218.4
inactive: 99.7
Methoxymalonyl-CoA: 84.7
Methylmalonyl-CoA: 72.1
Propionyl-CoA: 44.0
Ethylmalonyl-CoA: 35.5
Isobutyryl-CoA: 32.2
Benzoyl-CoA: 23.8
Acetyl-CoA: 22.6
fatty_acid: 20.6
2-Methylbutyryl-CoA: 18.7
CHC-CoA: 15.8
trans-1,2-CPDA: 12.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (2626..2923): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%; Methoxymalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 177.2
Ethylmalonyl-CoA: 171.7
Methoxymalonyl-CoA: 153.4
2-Methylbutyryl-CoA: 116.4
trans-1,2-CPDA: 106.4
Propionyl-CoA: 91.9
Malonyl-CoA: 90.8
CHC-CoA: 85.0
Isobutyryl-CoA: 81.1
Benzoyl-CoA: 56.6
3-Methylbutyryl-CoA: 47.0
fatty_acid: 37.2
Acetyl-CoA: 30.1
inactive: 10.3

PKS_AT (4171..4472): pk

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Methoxymalonyl-CoA: 79.2%; Malonyl-CoA: 70.8%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 163.3
Methylmalonyl-CoA: 161.7
Methoxymalonyl-CoA: 135.4
2-Methylbutyryl-CoA: 109.3
Propionyl-CoA: 91.4
Isobutyryl-CoA: 79.7
Malonyl-CoA: 76.8
trans-1,2-CPDA: 72.2
Benzoyl-CoA: 54.6
CHC-CoA: 48.9
inactive: 35.3
Acetyl-CoA: 33.6
3-Methylbutyryl-CoA: 28.3
fatty_acid: 24.0

G9U55_RS31210: mal

PKS_AT (559..823): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 209.0
inactive: 102.8
Methoxymalonyl-CoA: 77.9
Methylmalonyl-CoA: 67.4
Isobutyryl-CoA: 29.8
Ethylmalonyl-CoA: 26.9
Propionyl-CoA: 26.4
Acetyl-CoA: 20.1
fatty_acid: 17.7
Benzoyl-CoA: 17.2
CHC-CoA: 12.9
2-Methylbutyryl-CoA: 9.9
trans-1,2-CPDA: 4.7
3-Methylbutyryl-CoA: 0.0

G9U55_RS30190: mal - mal

PKS_AT (539..813): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 174.4
inactive: 81.2
Methoxymalonyl-CoA: 68.0
Methylmalonyl-CoA: 58.9
Propionyl-CoA: 31.4
Isobutyryl-CoA: 24.0
Ethylmalonyl-CoA: 15.5
2-Methylbutyryl-CoA: 13.6
Benzoyl-CoA: 13.0
CHC-CoA: 11.8
Acetyl-CoA: 10.8
fatty_acid: 7.6
3-Methylbutyryl-CoA: 7.0
trans-1,2-CPDA: 0.0

PKS_AT (1966..2243): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 216.2
inactive: 115.8
Methoxymalonyl-CoA: 81.1
Methylmalonyl-CoA: 74.8
Isobutyryl-CoA: 36.1
Propionyl-CoA: 35.1
Ethylmalonyl-CoA: 31.4
Acetyl-CoA: 21.5
Benzoyl-CoA: 20.6
fatty_acid: 18.3
CHC-CoA: 16.4
2-Methylbutyryl-CoA: 15.8
trans-1,2-CPDA: 12.0
3-Methylbutyryl-CoA: 0.0

G9U55_RS31415: mmal - mal

PKS_AT (516..813): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 193.6
Ethylmalonyl-CoA: 188.6
Methoxymalonyl-CoA: 155.4
2-Methylbutyryl-CoA: 127.9
trans-1,2-CPDA: 112.3
Malonyl-CoA: 95.9
Propionyl-CoA: 89.8
Isobutyryl-CoA: 86.1
CHC-CoA: 84.5
Benzoyl-CoA: 66.3
Acetyl-CoA: 45.5
inactive: 43.2
3-Methylbutyryl-CoA: 30.2
fatty_acid: 20.7

PKS_AT (1538..1816): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 210.2
inactive: 103.7
Methoxymalonyl-CoA: 77.3
Methylmalonyl-CoA: 66.6
Propionyl-CoA: 36.0
Ethylmalonyl-CoA: 30.2
Isobutyryl-CoA: 25.6
Acetyl-CoA: 24.1
Benzoyl-CoA: 21.9
2-Methylbutyryl-CoA: 21.9
fatty_acid: 18.9
CHC-CoA: 17.9
trans-1,2-CPDA: 12.2
3-Methylbutyryl-CoA: 0.0

G9U55_RS30855: mal - mal - mal - mal - mal - mal

PKS_AT (570..847): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.8
inactive: 94.0
Methoxymalonyl-CoA: 73.7
Methylmalonyl-CoA: 63.0
Ethylmalonyl-CoA: 26.3
Propionyl-CoA: 25.6
Benzoyl-CoA: 21.0
Acetyl-CoA: 19.3
Isobutyryl-CoA: 19.0
fatty_acid: 16.8
CHC-CoA: 13.9
trans-1,2-CPDA: 7.1
2-Methylbutyryl-CoA: 5.3
3-Methylbutyryl-CoA: 4.6

PKS_AT (2573..2851): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.1
inactive: 106.9
Methoxymalonyl-CoA: 78.1
Methylmalonyl-CoA: 70.2
Propionyl-CoA: 33.1
Ethylmalonyl-CoA: 31.3
Isobutyryl-CoA: 24.0
Benzoyl-CoA: 22.6
Acetyl-CoA: 21.5
fatty_acid: 19.7
CHC-CoA: 16.9
2-Methylbutyryl-CoA: 14.6
trans-1,2-CPDA: 12.1
3-Methylbutyryl-CoA: 6.8

PKS_AT (4044..4316): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 200.9
inactive: 94.8
Methoxymalonyl-CoA: 72.2
Methylmalonyl-CoA: 57.5
Propionyl-CoA: 30.7
Ethylmalonyl-CoA: 28.0
fatty_acid: 23.5
Isobutyryl-CoA: 20.0
Acetyl-CoA: 18.9
Benzoyl-CoA: 18.4
2-Methylbutyryl-CoA: 17.0
CHC-CoA: 11.9
trans-1,2-CPDA: 11.2
3-Methylbutyryl-CoA: 4.8

PKS_AT (5519..5799): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 210.7
inactive: 94.9
Methoxymalonyl-CoA: 77.3
Methylmalonyl-CoA: 65.7
Isobutyryl-CoA: 28.7
Ethylmalonyl-CoA: 28.5
Propionyl-CoA: 27.5
Acetyl-CoA: 23.8
Benzoyl-CoA: 18.0
fatty_acid: 15.7
CHC-CoA: 14.4
2-Methylbutyryl-CoA: 12.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (7215..7492): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; Methoxymalonyl-CoA: 54.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 111.4
Methoxymalonyl-CoA: 51.7
inactive: 46.6
Methylmalonyl-CoA: 44.7
Propionyl-CoA: 29.6
Ethylmalonyl-CoA: 21.9
Acetyl-CoA: 14.7
fatty_acid: 13.1
trans-1,2-CPDA: 11.8
3-Methylbutyryl-CoA: 10.3
Benzoyl-CoA: 10.0
Isobutyryl-CoA: 8.0
CHC-CoA: 5.4
2-Methylbutyryl-CoA: 0.0

PKS_AT (8919..9198): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 197.1
inactive: 83.3
Methoxymalonyl-CoA: 68.8
Methylmalonyl-CoA: 61.8
Isobutyryl-CoA: 28.9
Propionyl-CoA: 27.5
Ethylmalonyl-CoA: 20.4
Acetyl-CoA: 17.8
fatty_acid: 17.4
Benzoyl-CoA: 14.2
CHC-CoA: 12.8
trans-1,2-CPDA: 8.7
2-Methylbutyryl-CoA: 4.3
3-Methylbutyryl-CoA: 0.0

G9U55_RS30295: mmal - mal - mal - mmal

PKS_AT (580..876): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 204.2
Ethylmalonyl-CoA: 196.0
Methoxymalonyl-CoA: 164.3
2-Methylbutyryl-CoA: 133.2
trans-1,2-CPDA: 119.6
CHC-CoA: 110.1
Propionyl-CoA: 107.2
Malonyl-CoA: 103.3
Isobutyryl-CoA: 77.4
Benzoyl-CoA: 70.8
Acetyl-CoA: 44.0
inactive: 40.0
3-Methylbutyryl-CoA: 32.8
fatty_acid: 32.5

PKS_AT (2106..2382): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.0
inactive: 113.6
Methoxymalonyl-CoA: 77.2
Methylmalonyl-CoA: 69.1
Isobutyryl-CoA: 30.1
Propionyl-CoA: 29.4
Ethylmalonyl-CoA: 22.2
Acetyl-CoA: 22.2
Benzoyl-CoA: 17.8
2-Methylbutyryl-CoA: 14.5
fatty_acid: 14.3
CHC-CoA: 11.3
3-Methylbutyryl-CoA: 5.5
trans-1,2-CPDA: 0.0

PKS_AT (3604..3871): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 203.7
inactive: 98.9
Methoxymalonyl-CoA: 74.4
Methylmalonyl-CoA: 63.2
Propionyl-CoA: 34.5
Ethylmalonyl-CoA: 24.0
Isobutyryl-CoA: 22.2
Acetyl-CoA: 21.4
fatty_acid: 20.7
Benzoyl-CoA: 17.3
2-Methylbutyryl-CoA: 10.8
CHC-CoA: 10.6
3-Methylbutyryl-CoA: 9.1
trans-1,2-CPDA: 0.0

PKS_AT (5117..5415): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 191.8
Ethylmalonyl-CoA: 189.3
Methoxymalonyl-CoA: 161.4
trans-1,2-CPDA: 125.5
2-Methylbutyryl-CoA: 118.9
Malonyl-CoA: 98.8
Propionyl-CoA: 98.6
Isobutyryl-CoA: 90.6
CHC-CoA: 84.1
Benzoyl-CoA: 67.4
Acetyl-CoA: 46.8
3-Methylbutyryl-CoA: 43.8
fatty_acid: 21.5
inactive: 19.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
ClgR	Caseinolytic protease gene regulator
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems