GCF_015207755.1 - 13 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JADEWH010000001.1 (Nodularia sp. LEGE 06071)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	lanthipeptide-class-v,RRE-containing,spliceotide	1	36,845	Low	PcpA	ribosomal:RiPP
Region 1.2	microviridin	106,676	127,008	Low	microviridin 1688/microviridin 1739/microviridin 1748	ribosomal:RiPP:Microviridin
Region 1.3	NRPS-like	374,202	416,655
Region 1.4	lanthipeptide-class-v	474,979	517,491	Low	anacyclamide A10	ribosomal:RiPP:Cyanobactin

NZ_JADEWH010000002.1 (Nodularia sp. LEGE 06071)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	lassopeptide	176,347	203,569

NZ_JADEWH010000004.1 (Nodularia sp. LEGE 06071)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	mycosporine,lanthipeptide-class-ii	358,687	406,940	Low	hexose-palythine-serine/hexose-shinorine	NRPS:Type I

NZ_JADEWH010000005.1 (Nodularia sp. LEGE 06071)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	terpene	226,796	247,728

NZ_JADEWH010000007.1 (Nodularia sp. LEGE 06071)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	hglE-KS	45,128	92,123	Medium	heterocyst glycolipids	other:other

NZ_JADEWH010000017.1 (Nodularia sp. LEGE 06071)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	RRE-containing	73,476	93,925

NZ_JADEWH010000019.1 (Nodularia sp. LEGE 06071)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	NRP-metallophore,NRPS,T1PKS,NRPS-like	7,815	98,582	High	nocuolin A	other:other

NZ_JADEWH010000020.1 (Nodularia sp. LEGE 06071)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	terpene-precursor	23,351	44,280

NZ_JADEWH010000021.1 (Nodularia sp. LEGE 06071)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	hglE-KS,T1PKS	20,860	72,382	High	heterocyst glycolipids	other:other

NZ_JADEWH010000024.1 (Nodularia sp. LEGE 06071)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	lanthipeptide-class-v	21,438	50,094

No secondary metabolite regions were found in these records:: NZ_JADEWH010000003.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000006.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000008.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000009.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000010.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000011.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000012.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000013.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000014.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000015.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000016.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000018.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000022.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000023.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000025.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000026.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000027.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000028.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000029.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000030.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000031.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000032.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000033.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000034.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000035.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000036.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000037.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000038.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000039.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000040.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000041.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000042.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000043.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000044.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000045.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000046.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000047.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000048.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000049.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000050.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000051.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000052.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000053.1 (Nodularia sp. LEGE 06071); NZ_JADEWH010000054.1 (Nodularia sp. LEGE 06071)

Compact view

NZ_JADEWH010000001.1 - Region 1 - RRE-containing,lanthipeptide-class-v,spliceotide

Download region GenBank file

Download region SVG

Location: 1 - 36,845 nt. (total: 36,845 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-v: (APH and HopA1)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
spliceotide: (TIGR04103 and TIGR03798)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IQ233_RS00155: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Ligases: ligase

IQ233_RS00020: cobaltochelatase subunit CobN

smcogs: SMCOG1263: cobaltochelatase subunit CobN

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001733.3	0.82	ribosomal	PcpA	Pleurocapsa sp. PCC 7327
BGC0000601.4	0.42	ribosomal	sporulation killing factor	Bacillus subtilis subsp. subtilis str. 168
BGC0002575.2	0.35	ribosomal	cochonodin I	Streptococcus suis
BGC0000188.5	0.34	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000043.5	0.32	PKS	curacin A	Moorea producens 19L
BGC0000506.4	0.32	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000527.5	0.31	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000515.4	0.31	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000556.5	0.31	ribosomal	streptin	Streptococcus pyogenes
BGC0000536.3	0.30	ribosomal	nisin Q	Lactococcus lactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001733.3	0.63	ribosomal	PcpA	Pleurocapsa sp. PCC 7327
BGC0000590.5	0.51	ribosomal	microcin N	Escherichia coli
BGC0002005.2	0.51	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0002306.2	0.51	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000623.3	0.48	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000558.5	0.48	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000589.5	0.45	ribosomal	microcin M	Escherichia coli Nissle 1917
BGC0000617.5	0.45	ribosomal	coagulin	Bacillus coagulans
BGC0000513.3	0.45	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000587.5	0.44	ribosomal	microcin H47	Escherichia coli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 27.78 out of 27.78

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.48 out of 24.78

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.03 out of 26.06

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

Additional weak hits (3):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.62 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.83 out of 26.12

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.07 out of 33.14

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: PlpY_RRE; Location: 4 - 69; Score: 77.6
: RRE type: PlpY_RRE; Location: 4 - 69; Score: 77.6
: RRE type: PlpY_RRE; Location: 4 - 69; Score: 77.6

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JADEWH010000001.1 - Region 2 - microviridin

Download region GenBank file

Download region SVG

Location: 106,676 - 127,008 nt. (total: 20,333 nt) Show pHMM detection rules used

microviridin: (mvd or mvnA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000593.4	0.72	ribosomal	microviridin J	Microcystis aeruginosa MRC
BGC0002049.3	0.58	ribosomal	microviridin N9, microviridin N8, microviridin N7, microviridin N6, microviridin N5, microviridin N4, microviridin N3	Nostoc punctiforme PCC 73102
BGC0000592.5	0.57	ribosomal	microviridin B	Microcystis aeruginosa NIES-298
BGC0000594.5	0.43	ribosomal	microviridin K	Planktothrix agardhii NIVA-CYA 126/8
BGC0000591.5	0.39	ribosomal	marinostatin	Alteromonas sp. B-10-31
BGC0002626.2	0.38	ribosomal	microviridin 1688, microviridin 1739, microviridin 1748	Nostoc sp. TH1S01
BGC0002382.3	0.34	ribosomal	grimoviridin	Grimontia marina
BGC0000475.5	0.25	ribosomal	patellamide A, patellamide C	Prochloron didemni
BGC0001657.4	0.19	NRPS	lysocin	Lysobacter sp. RH2180-5
BGC0000636.3	0.19	terpene	carotenoid	Brevibacterium linens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000593.4	0.72	ribosomal	microviridin J	Microcystis aeruginosa MRC
BGC0002049.3	0.58	ribosomal	microviridin N9, microviridin N8, microviridin N7, microviridin N6, microviridin N5, microviridin N4, microviridin N3	Nostoc punctiforme PCC 73102
BGC0000592.5	0.57	ribosomal	microviridin B	Microcystis aeruginosa NIES-298
BGC0000594.5	0.43	ribosomal	microviridin K	Planktothrix agardhii NIVA-CYA 126/8
BGC0000591.5	0.39	ribosomal	marinostatin	Alteromonas sp. B-10-31
BGC0002626.2	0.38	ribosomal	microviridin 1688, microviridin 1739, microviridin 1748	Nostoc sp. TH1S01
BGC0002382.3	0.34	ribosomal	grimoviridin	Grimontia marina
BGC0000475.5	0.25	ribosomal	patellamide A, patellamide C	Prochloron didemni
BGC0001657.4	0.19	NRPS	lysocin	Lysobacter sp. RH2180-5
BGC0000636.3	0.19	terpene	carotenoid	Brevibacterium linens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

NZ_JADEWH010000001.1 - Region 3 - NRPS-like

Download region GenBank file

Download region SVG

Location: 374,202 - 416,655 nt. (total: 42,454 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IQ233_RS01840: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

IQ233_RS01910: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase acyltransferase methyltransferase

IQ233_RS01810: methyltransferase

smcogs: SMCOG1089: methyltransferase

IQ233_RS01940: acyltransferase

smcogs: SMCOG1141: acyltransferase

IQ233_RS01955: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

IQ233_RS01995: acyltransferase

smcogs: SMCOG1141: acyltransferase

Lyases: decarboxylase

IQ233_RS01875: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: ligase synthase

IQ233_RS01885: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IQ233_RS01960: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.72 out of 30.25

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 25.38 out of 27.78

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.05 out of 20.97

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.92 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.55 out of 27.78

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.47 out of 32.93

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.28 out of 26.06

Confidence: medium

Additional weak hits (9):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.89 out of 32.74

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.07 out of 32.93

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.45 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.54 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.40 out of 29.38

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.64 out of 32.93

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.43 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.38 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.82 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 374201 - 416655:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IQ233_RS01885: X

AMP-binding (12..413): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFVDSVWEGILTVSGELNLYGSTEVAGDVTW
Nearest Stachelhaus code(s):: bAla VDWVTSLADK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

IQ233_RS01955: mal

PKS_AT (6..279): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 81.7
inactive: 41.2
Methoxymalonyl-CoA: 35.2
Propionyl-CoA: 23.7
Methylmalonyl-CoA: 16.4
Isobutyryl-CoA: 13.7
2-Methylbutyryl-CoA: 10.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes

NZ_JADEWH010000001.1 - Region 4 - lanthipeptide-class-v

Download region GenBank file

Download region SVG

Location: 474,979 - 517,491 nt. (total: 42,513 nt) Show pHMM detection rules used

lanthipeptide-class-v: (APH and HopA1)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: peptidase

IQ233_RS02385: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: dehydratase

IQ233_RS02405: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000590.5	0.51	ribosomal	microcin N	Escherichia coli
BGC0000623.3	0.48	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0002382.3	0.47	ribosomal	grimoviridin	Grimontia marina
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000617.5	0.45	ribosomal	coagulin	Bacillus coagulans
BGC0002303.3	0.44	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0001862.4	0.44	ribosomal	pallidocin	Aeribacillus pallidus
BGC0002698.2	0.44	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001210.5	0.43	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002579.2	0.43	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000590.5	0.51	ribosomal	microcin N	Escherichia coli
BGC0000623.3	0.48	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0002382.3	0.47	ribosomal	grimoviridin	Grimontia marina
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000617.5	0.45	ribosomal	coagulin	Bacillus coagulans
BGC0002303.3	0.44	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0001862.4	0.44	ribosomal	pallidocin	Aeribacillus pallidus
BGC0002698.2	0.44	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001210.5	0.43	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002579.2	0.43	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.21 out of 23.43

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.75 out of 27.55

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.82 out of 27.55

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.87 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.05 out of 18.16

Confidence: strong

Additional weak hits (4):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.99 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.79 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.59 out of 30.97

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 20.83 out of 32.38

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
BldD	Development and antibiotic global regulator
GnfM	Regulator of nitrogen-fixation genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JADEWH010000002.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 176,347 - 203,569 nt. (total: 27,223 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IQ233_RS04490: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: hydrolase

IQ233_RS04515: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000575.5	0.52	ribosomal	lariatin	Rhodococcus jostii
BGC0001634.3	0.52	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001551.4	0.50	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0000571.3	0.49	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002322.3	0.49	ribosomal	citrocin	Citrobacter pasteurii
BGC0002064.2	0.48	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002103.2	0.45	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000846.5	0.43	other (other)	tabtoxin	Pseudomonas syringae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000575.5	0.52	ribosomal	lariatin	Rhodococcus jostii
BGC0001634.3	0.52	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001551.4	0.50	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0000571.3	0.49	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002322.3	0.49	ribosomal	citrocin	Citrobacter pasteurii
BGC0002064.2	0.48	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002103.2	0.45	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000846.5	0.43	other (other)	tabtoxin	Pseudomonas syringae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.30 out of 27.78

Confidence: medium

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 27.94 out of 31.73

Confidence: medium

Additional weak hits (1):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.47 out of 30.25

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 9 - 92; Score: 79.3

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
HexR	Glucose-responsive regulator

NZ_JADEWH010000004.1 - Region 1 - lanthipeptide-class-ii,mycosporine

Download region GenBank file

Download region SVG

Location: 358,687 - 406,940 nt. (total: 48,254 nt) Show pHMM detection rules used

Region on contig edge.

mycosporine: (DHQ_synthase and Methyltransf_3 and ATP-grasp_3)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase glycosyltransferase methyltransferase

IQ233_RS09860: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

IQ233_RS09870: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

IQ233_RS09890: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

IQ233_RS09900: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

IQ233_RS09905: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

IQ233_RS09910: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase dehydratase

IQ233_RS09845: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

IQ233_RS10010: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: synthase

IQ233_RS09970: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.4	0.56	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001210.5	0.44	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001555.4	0.38	ribosomal	colicin V	Escherichia coli chi7122
BGC0000527.5	0.38	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0002005.2	0.37	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0002703.2	0.35	ribosomal	archalan α	Halorussus salinus
BGC0000588.5	0.34	ribosomal	microcin L	Escherichia coli
BGC0000525.5	0.34	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000528.5	0.33	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001311.5	0.32	ribosomal	flavecins	Ruminococcus flavefaciens FD-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.4	0.62	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000427.5	0.59	NRPS	shinorine, 4-deoxygadusol, mycosporine glycine	Trichormus variabilis ATCC 29413
BGC0001210.5	0.57	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001615.3	0.52	NRPS	hexose-palythine-serine, hexose-shinorine	Heteroscytonema crispum UCFS10
BGC0000527.5	0.52	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001555.4	0.51	ribosomal	colicin V	Escherichia coli chi7122
BGC0002674.2	0.51	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0000525.5	0.51	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0002005.2	0.50	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0000732.3	0.49	saccharide	capsular polysaccharide	Raoultella planticola

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for IQ233_RS10010

IQ233_RS10005

Leader:

MSNIDIIRAWKDEDYRNSLSEEQRSQLPENPAGLIELPDEESDALSGG

Core:

CSYFTGTCGRVCAVLTPRYGCTICGGGGFTS

Core with dehydrations:

CysDhaYFDhbGDhbCysGRVCysAVLDhbPRYGCysDhbICysGGGGFDhbDha

antiSMASH-DB 4.0 matches for IQ233_RS10005

100.0%

NZ_JADEWH010000004.1:

Lanthipeptides: IQ233_RS10005_lanthipeptide

1

CSYFTGTCGRVCAVLTPRYGCTICGGGGFTS

31

CSYFTGTCGRVCAVLTPRYGCTICGGGGFTS

1

CSYFTGTCGRVCAVLTPRYGCTICGGGGFTS

31

22.6%

NZ_FOMZ01000019.1and 1 other:

NZ_FOMZ01000019.1 Lanthipeptides: BM150_RS22435_lanthipeptide

Lanthipeptides: BM150_RS22435_lanthipeptide

2

SYFTGTCGRVCAVLTPRYGC

21

S CG+ C P+ GC

1

SPTEDNCGQTCESACPQTGC

20

21.1%

NZ_RHQE01000015.1:

Lanthipeptides: allorf_100944_101117_lanthipeptide

7

TCGRVCAVLTPRYGCTICGGGG

28

TC R+ V +PR G + G

3

TCNRLEPVRSPRAGHAVNPSMG

24

with 2 more sequence matches

19.4%

NZ_FNGC01000009.1:

Lanthipeptides: allorf_112052_112270_lanthipeptide

17

PRYGCTICG

25

PRY CT+C

12

PRYDCTLCS

20

16.7%

NZ_BMFU01000012.1and 7 others:

NZ_BMFU01000012.1 Lanthipeptides: IEW26_RS25375_lanthipeptideNZ_JACHKG010000014.1 Lanthipeptides: allorf_027480_027638_lanthipeptideNZ_JACHKG010000014.1 Lanthipeptides: allorf_027480_027638_lanthipeptideNZ_JAHXMW010000012.1 Lanthipeptides: KZX51_RS23855_lanthipeptideNZ_JAHXMW010000012.1 Lanthipeptides: KZX51_RS23855_lanthipeptideNZ_VDYW01000008.1 Lanthipeptides: FS579_RS24445_lanthipeptideNZ_VDYW01000008.1 Lanthipeptides: FS579_RS24445_lanthipeptide

Lanthipeptides: IEW26_RS25375_lanthipeptide

2

SYFTGTCGRVC

12

SYF G G VC

21

SYFMGNPGHVC

31

allorf_384206_384364

Leader:

MTLKTLNGS

Core:

KRTWLTTLCGECQYHLSLFQSSYYPVFKITALVAPENSGFEYI

Core with dehydrations:

KRDhbWLDhbDhbLCysGECysQYHLDhaLFQDhaDhaYYPVFKIDhbALVAPENDhaGFEYI

antiSMASH-DB 4.0 matches for allorf_384206_384364

100.0%

NZ_JADEWH010000004.1:

Lanthipeptides: allorf_384206_384364_lanthipeptide

1

KRTWLTTLCGECQYHLSLFQSSYYPVFKITALVAPENSGFEYI

43

KRTWLTTLCGECQYHLSLFQSSYYPVFKITALVAPENSGFEYI

1

KRTWLTTLCGECQYHLSLFQSSYYPVFKITALVAPENSGFEYI

43

18.2%

NZ_CP016279.1:

Lanthipeptides: AVL59_RS52375_lanthipeptide

4

WLTTLCGECQYHLSLFQSSYYPVFKITALVAPENS

38

W T + ++ + +F ++ P FK+T + N

2

WFTCASTDGKF-VKVFDTTAKPPFKVTVDITGGNG

35

16.3%

NZ_CP060140.1:

Lanthipeptides: allorf_1942151_1942312_lanthipeptide

2

RTWLTTLCGECQYHLSLFQSSYYPVF

27

+ W ++ E Y L ++Q+++ PV+

12

KVWRSSGVREIMYFLHIWQNTWSPVY

37

with 2 more sequence matches

14.0%

NZ_BOSN01000007.1and 1 other:

NZ_JAHHXV010000040.1 Lanthipeptides: allorf_06582_06767_lanthipeptide

Lanthipeptides: allorf_250666_250851_lanthipeptide

12

CQYHLSLFQSSYY

24

C YH+ ++ SYY

20

CTYHVPSYKCSYY

32

14.0%

NZ_KN125579.1:

Lanthipeptides: allorf_0767429_0767539_lanthipeptide

3

TWLTTLCG

10

+WLT LCG

3

SWLTILCG

10

allorf_393272_393412

Leader:

MSTPVAGIATFLSNLTVA

Core:

LRRLGRRWLAHFRKFPIDQDLRNNCQKS

Core with dehydrations:

LRRLGRRWLAHFRKFPIDQDLRNNCysQKDha

antiSMASH-DB 4.0 matches for allorf_393272_393412

100.0%

NZ_JADEWH010000004.1:

Lanthipeptides: allorf_393272_393412_lanthipeptide

1

LRRLGRRWLAHFRKFPIDQDLRNNCQKS

28

LRRLGRRWLAHFRKFPIDQDLRNNCQKS

1

LRRLGRRWLAHFRKFPIDQDLRNNCQKS

28

24.3%

NZ_QNRN01000010.1:

Lanthipeptides: DET63_RS17575_lanthipeptide

11

HFRKFPIDQDLRNNCQKS

28

H +FP D DLR +C K

13

HETQFPGD-DLRKDCPKE

29

21.4%

NZ_LN868937.1:

Lanthipeptides: BN2144_RS20095_lanthipeptide

7

RWLAHFRKFPIDQDLRNNCQK

27

+W F + NNC K

3

KWYTIFTTLIGTSTISNNCGK

23

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.06 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.08 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.40 out of 27.78

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.11 out of 23.05

Confidence: medium

Additional weak hits (6):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.62 out of 21.55

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.73 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.16 out of 30.25

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.18 out of 29.72

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.73 out of 39.62

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

TFBS Finder

Core peptide predictions

IQ233_RS10005 - Class II

Cleavage pHMM score: -1.80

RODEO score: 0

Monoisotopic mass: 3010.4 Da

Molecular weight: 3012.5 Da

Number of bridges: 5

Alternative weights: (assuming N unmodified Ser/Thr residues); 3030.5 Da N = 1; 3048.5 Da N = 2

allorf_384206_384364 - Class II

Cleavage pHMM score: -2.50

RODEO score: 0

Monoisotopic mass: 4858.5 Da

Molecular weight: 4861.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4879.5 Da N = 1; 4897.6 Da N = 2; 4915.6 Da N = 3; 4933.6 Da N = 4; 4951.6 Da N = 5; 4969.6 Da N = 6

allorf_393272_393412 - Class II

Cleavage pHMM score: -7.20

RODEO score: 0

Monoisotopic mass: 3504.9 Da

Molecular weight: 3507.0 Da

Number of bridges: 1

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes

NZ_JADEWH010000005.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 226,796 - 247,728 nt. (total: 20,933 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IQ233_RS11000: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

IQ233_RS11040: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

IQ233_RS11025: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000656.5	0.47	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000645.3	0.45	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0001864.3	0.42	ribosomal	listeriocytocin	Listeria monocytogenes SLCC2540
BGC0000646.5	0.42	terpene	β-carotein	uncultured bacterium
BGC0000664.5	0.40	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000640.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000642.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000639.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000643.3	0.40	terpene	carotenoid	Brevundimonas vesicularis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000656.5	0.47	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000645.3	0.45	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0001864.3	0.42	ribosomal	listeriocytocin	Listeria monocytogenes SLCC2540
BGC0000646.5	0.42	terpene	β-carotein	uncultured bacterium
BGC0000664.5	0.40	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000640.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000642.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000639.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000643.3	0.40	terpene	carotenoid	Brevundimonas vesicularis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

IQ233_RS11045: PT_phytoene_like

Domain 1 (18 - 308): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.22 out of 27.78

Confidence: medium

Additional weak hits (1):

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.85 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ToxT	Regulator of MSHA biosynthesis

NZ_JADEWH010000007.1 - Region 1 - hglE-KS

Download region GenBank file

Download region SVG

Location: 45,128 - 92,123 nt. (total: 46,996 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IQ233_RS12975: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: acylase

IQ233_RS12925: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: ligase synthase

IQ233_RS12915: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IQ233_RS12920: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IQ233_RS12940: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000869.5	0.62	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001257.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000107.3	0.59	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002154.2	0.59	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000869.5	0.62	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001257.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000107.3	0.59	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002154.2	0.59	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.83 out of 27.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.22 out of 18.16

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.20 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 27.37 out of 30.98

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 23.46 out of 29.25

Confidence: medium

Additional weak hits (3):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.78 out of 30.98

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 45127 - 92123:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IQ233_RS12915: mal

PKS_AT (625..924): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 94.5
inactive: 44.2
Methoxymalonyl-CoA: 32.2
Methylmalonyl-CoA: 20.3
CHC-CoA: 17.6
Isobutyryl-CoA: 15.3
Propionyl-CoA: 14.2
fatty_acid: 10.2
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

IQ233_RS12920: mxmal

PKS_AT (536..857): mxmal

ATSignature: (unknown)

No matches above 50%

minowa: Methoxymalonyl-CoA

Prediction, score:

Methoxymalonyl-CoA: 27.2
Isobutyryl-CoA: 20.3
inactive: 10.5
Methylmalonyl-CoA: 10.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Malonyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
NuR	Nickel-responsive regulator
RpoN	Regulator of nitrogen assimilation and virulence
SypG	Regulator of biofilm formation and host colonization

NZ_JADEWH010000017.1 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 73,476 - 93,925 nt. (total: 20,450 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IQ233_RS21025: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: dehydratase

IQ233_RS21065: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000737.3	0.53	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000757.3	0.52	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000756.3	0.51	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000741.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000739.3	0.47	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000740.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000746.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000747.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000737.3	0.53	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000757.3	0.52	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000756.3	0.51	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000741.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000739.3	0.47	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000740.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000746.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000747.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.71 out of 28.14

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.83 out of 29.51

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.88 out of 20.01

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 9 - 90; Score: 57.6

TFBS definitions

Regulator	Description

NZ_JADEWH010000019.1 - Region 1 - NRP-metallophore,NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 7,815 - 98,582 nt. (total: 90,768 nt) Show pHMM detection rules used

Region on contig edge.

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IQ233_RS21865: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IQ233_RS21890: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase

IQ233_RS21850: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: dehydratase

IQ233_RS21710: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: isomerase

IQ233_RS21745: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

IQ233_RS21715: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IQ233_RS21725: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

IQ233_RS21730: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IQ233_RS21735: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IQ233_RS21750: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IQ233_RS21855: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IQ233_RS21860: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IQ233_RS21885: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IQ233_RS21905: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

IQ233_RS21910: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002597.2	2.74	NRPS, PKS	Nocuolactylate A, Nocuolactylate B, Nocuolactylate C	Nodularia sp. LEGE 06071
BGC0001704.3	2.19	other (other)	nocuolin A	Nodularia sp. HBU26
BGC0001164.3	2.15	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	2.15	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	1.83	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	1.81	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	1.80	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	1.79	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	1.78	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	1.75	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002597.2	0.96	NRPS, PKS	Nocuolactylate A, Nocuolactylate B, Nocuolactylate C	Nodularia sp. LEGE 06071
BGC0001704.3	0.89	other (other)	nocuolin A	Nodularia sp. HBU26
BGC0001160.5	0.74	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.74	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.72	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.95 out of 27.78

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.13 out of 27.78

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.93 out of 30.25

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.94 out of 27.78

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.38 out of 32.93

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.27 out of 24.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.95 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.05 out of 26.06

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

Additional weak hits (8):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.03 out of 26.12

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 25.12 out of 32.74

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.10 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.88 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.51 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.19 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.69 out of 36.53

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.83 out of 29.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 7814 - 98582:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ohmal) + (Cys) + (NH2) + (mal) + (fatty_acid)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 7814 - 64355:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys) + (ohmal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 46935 - 89029:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2) + (mal) + (fatty_acid)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 58736 - 98582:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2) + (mal) + (fatty_acid)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IQ233_RS21715: X

AMP-binding (510..918): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YAAAFDAAAEEPDLILGGEINTYGPTEATIVTTT
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

IQ233_RS21725: mal

PKS_AT (521..810): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 146.1
inactive: 99.9
Methoxymalonyl-CoA: 64.8
Methylmalonyl-CoA: 58.6
Propionyl-CoA: 49.2
Ethylmalonyl-CoA: 30.4
Isobutyryl-CoA: 27.9
2-Methylbutyryl-CoA: 25.3
CHC-CoA: 23.2
trans-1,2-CPDA: 15.4
Benzoyl-CoA: 15.2
Acetyl-CoA: 14.0
3-Methylbutyryl-CoA: 9.0
fatty_acid: 0.0

IQ233_RS21730: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (537..938): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: VQTSHDLSVYDGNSILGGDLSIGGPTETTVWNIG
Nearest Stachelhaus code(s):: Cys DLYNIGIVWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

IQ233_RS21750: X

AMP-binding (23..414): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: CQYAFAYGLGSFFGVSAAECEGIGTTEFLHIFLS
Nearest Stachelhaus code(s):: pNH2-Bz AYNFIAGSTK (53% 8Å match); diOH-Bz AANFVSGAIK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

IQ233_RS21860: NH2

CAL_domain (178..496): NH2

minowa: NH2

Prediction, score:

NH2: 153.7
Acetyl-CoA: 63.6
fatty_acid: 13.0
shikimic_acid: 0.0
AHBA: 0.0

IQ233_RS21885: NH2

CAL_domain (48..506): NH2

minowa: NH2

Prediction, score:

NH2: 25.5
AHBA: 17.5
fatty_acid: 16.9
shikimic_acid: 8.8
Acetyl-CoA: 1.6

IQ233_RS21905: mal

PKS_AT (532..764): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 70.8%

minowa: inactive

Prediction, score:

inactive: 99.1
Malonyl-CoA: 87.5
Methylmalonyl-CoA: 22.5
Isobutyryl-CoA: 22.2
Methoxymalonyl-CoA: 22.1
Propionyl-CoA: 16.3
Benzoyl-CoA: 13.1
Acetyl-CoA: 13.1
trans-1,2-CPDA: 13.0
2-Methylbutyryl-CoA: 10.8
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

IQ233_RS21910: fatty_acid

CAL_domain (934..1265): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 33.7
shikimic_acid: 0.0
NH2: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
LexA variant 2	Repressor of DNA damage response
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis

NZ_JADEWH010000020.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 23,351 - 44,280 nt. (total: 20,930 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

IQ233_RS22110: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.48	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.45	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000640.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000641.3	0.35	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.34	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0001859.4	0.32	other (phosphonate)	fosfomycin	Pseudomonas syringae
BGC0001605.3	0.32	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000678.5	0.32	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.48	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.45	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000640.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000641.3	0.35	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.34	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0001859.4	0.32	other (phosphonate)	fosfomycin	Pseudomonas syringae
BGC0001605.3	0.32	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000678.5	0.32	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

IQ233_RS22110: PT_FPPS_like

Domain 1 (44 - 309): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial or Geranylgeranyl diphosphate synthase or geranylfarnesyl diphosphate synthase, bacterial

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (4):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.15 out of 30.22

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.60 out of 30.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.32 out of 31.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.53 out of 32.74

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_JADEWH010000021.1 - Region 1 - T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 20,860 - 72,382 nt. (total: 51,523 nt) Show pHMM detection rules used

Region on contig edge.

hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IQ233_RS22480: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IQ233_RS22510: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

Transferases: PPTase acylase glycosyltransferase

IQ233_RS22405: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

IQ233_RS22470: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

IQ233_RS22485: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Lyases: dehydratase

IQ233_RS22430: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

IQ233_RS22455: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IQ233_RS22465: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000869.5	1.18	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.56	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002648.2	0.54	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000861.5	0.54	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000863.3	0.53	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001257.3	0.52	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000869.5	0.84	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'
BGC0001276.3	0.62	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002648.2	0.60	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000861.5	0.60	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000863.3	0.60	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001257.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.83 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.15 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.40 out of 26.06

Confidence: medium

Additional weak hits (3):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.98 out of 31.73

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.13 out of 20.01

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.09 out of 32.74

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 20859 - 72382:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IQ233_RS22455: mal

PKS_AT (626..924): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.1
Methoxymalonyl-CoA: 41.8
inactive: 36.5
Methylmalonyl-CoA: 29.8
Propionyl-CoA: 16.1
fatty_acid: 14.8
CHC-CoA: 13.0
Isobutyryl-CoA: 12.3
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

IQ233_RS22465: pk

PKS_AT (1114..1350): pk

ATSignature: (unknown)

No matches above 50%

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes

NZ_JADEWH010000024.1 - Region 1 - lanthipeptide-class-v

Download region GenBank file

Download region SVG

Location: 21,438 - 50,094 nt. (total: 28,657 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-v: (APH and HopA1)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase

IQ233_RS23185: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase

IQ233_RS23190: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Isomerases: isomerase racemase

IQ233_RS23200: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

IQ233_RS23210: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase

IQ233_RS23215: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000913.3	0.39	other (other)	MK-8	Enterobacter cloacae
BGC0000649.3	0.39	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002439.3	0.38	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0001521.3	0.38	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002473.3	0.38	NRPS	propanochelin, butanochelin, pentanochelin	Acinetobacter bouvetii DSM 14964 = CIP 107468
BGC0000871.4	0.38	other (nucleoside)	VEPE, AEPE, TG-1	Myxococcus xanthus DK 1622
BGC0000352.5	0.35	NRPS	fimsbactin A	Acinetobacter sp. ADP1
BGC0000921.5	0.34	NRPS, PKS, other (shikimate-derived)	promysalin	Pseudomonas putida
BGC0001185.5	0.34	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	0.34	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000913.3	0.39	other (other)	MK-8	Enterobacter cloacae
BGC0000649.3	0.39	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002439.3	0.38	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0001521.3	0.38	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002473.3	0.38	NRPS	propanochelin, butanochelin, pentanochelin	Acinetobacter bouvetii DSM 14964 = CIP 107468
BGC0000871.4	0.38	other (nucleoside)	VEPE, AEPE, TG-1	Myxococcus xanthus DK 1622
BGC0000352.5	0.35	NRPS	fimsbactin A	Acinetobacter sp. ADP1
BGC0000921.5	0.34	NRPS, PKS, other (shikimate-derived)	promysalin	Pseudomonas putida
BGC0001185.5	0.34	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	0.34	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.37 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.86 out of 27.78

Confidence: medium

Additional weak hits (2):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 28.31 out of 39.62

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.16 out of 29.38

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes