GCF_014650915.1 - 33 region(s)

Download region SVG

Location: 239,718 - 260,749 nt. (total: 21,032 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucanase glucosidase protease

IE242_RS01060: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

IE242_RS01095: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

IE242_RS01100: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Lyases: cyclase hydratase

IE242_RS01045: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

IE242_RS01075: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.50	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000622.5	0.50	ribosomal	megacin	Bacillus megaterium
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000500.5	0.43	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0001407.5	0.42	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000584.5	0.41	ribosomal	colicin V	Escherichia coli
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.50	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000622.5	0.50	ribosomal	megacin	Bacillus megaterium
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000500.5	0.43	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0001407.5	0.42	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000584.5	0.41	ribosomal	colicin V	Escherichia coli
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

IE242_RS01075: T1TS

Domain 1 (23 - 315): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.66 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.43 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.47 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

NZ_BMVW01000001.1 - Region 2 - terpene-precursor

Download region SVG

Location: 462,460 - 483,617 nt. (total: 21,158 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

IE242_RS02030: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

IE242_RS02060: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IE242_RS02060: PT_FPPS_like

Domain 1 (100 - 383): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

Additional weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.91 out of 32.93

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.44 out of 28.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.89 out of 23.43

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
ToxT	Regulator of MSHA biosynthesis

NZ_BMVW01000001.1 - Region 3 - terpene

Download region SVG

Location: 489,404 - 510,489 nt. (total: 21,086 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE242_RS02180: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: deformylase

IE242_RS02190: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: cyclase

IE242_RS02185: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.85	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0002012.4	0.32	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0001639.3	0.32	ribosomal	klebsidin	Klebsiella pneumoniae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.85	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0002012.4	0.32	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0001639.3	0.32	ribosomal	klebsidin	Klebsiella pneumoniae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

IE242_RS02185: T1TS

Domain 1 (7 - 339): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.51 out of 27.18

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.62 out of 29.72

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 25.59 out of 30.22

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.31 out of 27.18

Confidence: medium

Additional weak hits (5):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.84 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.63 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.15 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.74 out of 32.93

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
ClgR	Caseinolytic protease gene regulator
NrdR	Represses ribonucleotide reductase encoding genes
NtrC	Nitrogen regulatory protein C

NZ_BMVW01000002.1 - Region 1 - terpene

Download region SVG

Location: 386,734 - 412,404 nt. (total: 25,671 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE242_RS08640: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

IE242_RS08660: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase transferase

IE242_RS08620: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

IE242_RS08645: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: dehydratase

IE242_RS08615: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

IE242_RS08625: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

IE242_RS08655: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.81	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.75	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.74	terpene	carotenoid	Streptomyces avermitilis
BGC0000649.3	0.74	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.73	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.81	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.75	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.74	terpene	carotenoid	Streptomyces avermitilis
BGC0000649.3	0.74	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.73	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

IE242_RS08650: Lycopene_cycl

Domain 1 (5 - 388): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

IE242_RS08655: PT_FPPS_like

Domain 1 (92 - 402): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

IE242_RS08665: PT_phytoene_like

Domain 1 (16 - 309): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

Additional weak hits (7):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.23 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.70 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.25 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.71 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.90 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.76 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 14.95 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVW01000003.1 - Region 1 - terpene

Download region SVG

Location: 83,958 - 105,205 nt. (total: 21,248 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

IE242_RS10615: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: methyltransferase

IE242_RS10600: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: dehalogenase esterase hydrolase

IE242_RS10575: thioesterase

smcogs: SMCOG1004: thioesterase

IE242_RS10595: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

IE242_RS10650: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: cyclase

IE242_RS10605: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.79	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000657.5	0.70	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000278.3	0.45	PKS	urdamycin	Streptomyces fradiae
BGC0002047.2	0.42	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0000277.5	0.41	PKS	urdamycin	Streptomyces fradiae
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001485.4	0.39	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000688.4	0.39	terpene	copalyl diphosphate	Diaporthe amygdali
BGC0001267.3	0.39	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.79	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000657.5	0.70	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000278.3	0.45	PKS	urdamycin	Streptomyces fradiae
BGC0002047.2	0.42	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0000277.5	0.41	PKS	urdamycin	Streptomyces fradiae
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001485.4	0.39	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000688.4	0.39	terpene	copalyl diphosphate	Diaporthe amygdali
BGC0001267.3	0.39	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

IE242_RS10605: T1TS

Domain 1 (67 - 410): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.99 out of 20.97

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 28.31 out of 30.12

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (12):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.22 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.55 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.04 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.69 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.25 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.79 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.24 out of 36.53

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.80 out of 29.25

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.91 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.15 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.56 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVW01000003.1 - Region 2 - NAPAA,NRPS,T1PKS,t3nrps-iterative

Download region SVG

Location: 173,728 - 286,640 nt. (total: 112,913 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NAPAA: (AMP-binding and TIGR02353)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE242_RS11005: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE242_RS11185: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE242_RS11205: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE242_RS11210: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

IE242_RS11215: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase

IE242_RS11070: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: hydrolase

IE242_RS10955: isochorismatase

smcogs: SMCOG1027: isochorismatase

IE242_RS10990: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

IE242_RS11230: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IE242_RS11235: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: decarboxylase lyase

IE242_RS11060: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

IE242_RS11075: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: synthase

IE242_RS11015: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE242_RS11065: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

IE242_RS11095: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

IE242_RS11200: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	1.83	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	1.48	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002434.2	1.10	NRPS, PKS	clifednamide D, clifednamide E, clifednamide F, clifednamide G, clifednamide H, clifednamide I, clifednamide J	Kitasatospora sp.
BGC0001164.3	1.00	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	1.00	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001275.3	0.92	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.91	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001163.3	0.87	PKS	1-heptadecene	Moorea producens 3L
BGC0001553.5	0.87	NRPS, PKS	clifednamide A	Streptomyces sp. JV178
BGC0001726.4	0.84	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002434.2	0.70	NRPS, PKS	clifednamide D, clifednamide E, clifednamide F, clifednamide G, clifednamide H, clifednamide I, clifednamide J	Kitasatospora sp.
BGC0001164.3	0.68	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.68	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.57 out of 26.33

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.80 out of 20.01

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.43 out of 23.79

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.57 out of 36.53

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.77 out of 29.72

Confidence: medium

Additional weak hits (37):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.85 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.09 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.47 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.42 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.43 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.10 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.68 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.11 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.98 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.15 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.25 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.60 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.19 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.84 out of 23.43

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.13 out of 39.62

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.28 out of 20.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.25 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.28 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.11 out of 28.19

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.17 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.94 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.89 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.54 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.10 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.36 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.74 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.37 out of 32.74

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.71 out of 39.62

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.19 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.67 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.55 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.54 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 173727 - 286640:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - Orn) + (AHBA - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 173727 - 243797:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 236905 - 286640:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

IE242_RS11015: AHBA - mal

CAL_domain (178..488): AHBA

minowa: AHBA

Prediction, score:

AHBA: 130.3
shikimic_acid: 69.1
fatty_acid: 0.0
NH2: 0.0
Acetyl-CoA: 0.0

PKS_AT (1229..1533): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 192.2
inactive: 103.6
Methoxymalonyl-CoA: 63.9
Methylmalonyl-CoA: 44.4
Isobutyryl-CoA: 36.2
Acetyl-CoA: 25.9
Propionyl-CoA: 20.7
Ethylmalonyl-CoA: 19.7
Benzoyl-CoA: 11.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

IE242_RS11200: pk - Orn

Search NORINE for peptide: strict or relaxed

PKS_AT (610..909): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; CE-Malonyl-CoA: 58.3%; Acetyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 116.1
Malonyl-CoA: 113.8
Methoxymalonyl-CoA: 107.1
Ethylmalonyl-CoA: 94.7
Acetyl-CoA: 80.7
Isobutyryl-CoA: 76.5
Propionyl-CoA: 59.0
Benzoyl-CoA: 57.8
2-Methylbutyryl-CoA: 55.6
trans-1,2-CPDA: 52.0
fatty_acid: 39.9
3-Methylbutyryl-CoA: 39.9
CHC-CoA: 36.5
inactive: 29.3

AMP-binding (2421..2831): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAWAFDVFTGDREFVVGSDVNSYGLTETTVDSAC
Nearest Stachelhaus code(s):: Orn DVGEVGSIDK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
ArgR	Regulator of arginine biosynthesis genes
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
NtrC	Nitrogen regulatory protein C
OsdR	Development and stress management regulator

NZ_BMVW01000003.1 - Region 3 - terpene

Download region SVG

Location: 292,167 - 313,078 nt. (total: 20,912 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE242_RS11350: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

IE242_RS11355: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

IE242_RS11385: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Lyases: cyclase

IE242_RS11360: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

IE242_RS11375: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.59	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002274.2	0.56	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0000307.4	0.56	NRPS	AbT1	Aureobasidium pullulans
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000675.5	0.55	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000674.5	0.50	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001659.3	0.47	terpene	mangicol A	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.59	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002274.2	0.56	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0000307.4	0.56	NRPS	AbT1	Aureobasidium pullulans
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000675.5	0.55	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000674.5	0.50	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001659.3	0.47	terpene	mangicol A	Fusarium equiseti

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

IE242_RS11360: T1TS

Domain 1 (3 - 271): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.68 out of 26.85

Confidence: medium

Additional weak hits (3):

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.13 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.32 out of 29.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_BMVW01000003.1 - Region 4 - terpene

Download region SVG

Location: 528,486 - 551,140 nt. (total: 22,655 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

IE242_RS12410: isochorismatase

smcogs: SMCOG1027: isochorismatase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.40	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001928.2	0.39	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001579.4	0.39	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000503.5	0.38	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001229.4	0.36	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0001727.3	0.35	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000544.4	0.35	ribosomal	planosporicin	Planomonospora alba
BGC0001496.3	0.35	ribosomal	actinokineosin	Actinokineospora spheciospongiae
BGC0002496.3	0.34	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0002110.3	0.34	ribosomal	birimositide	Streptomyces rimosus subsp. rimosus WC-3908

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.40	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001928.2	0.39	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001579.4	0.39	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000503.5	0.38	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001229.4	0.36	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0001727.3	0.35	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000544.4	0.35	ribosomal	planosporicin	Planomonospora alba
BGC0001496.3	0.35	ribosomal	actinokineosin	Actinokineospora spheciospongiae
BGC0002496.3	0.34	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0002110.3	0.34	ribosomal	birimositide	Streptomyces rimosus subsp. rimosus WC-3908

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

IE242_RS12380: PT_phytoene_like

Domain 1 (298 - 549): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.64 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (4):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.39 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 30.98

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.63 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVW01000003.1 - Region 5 - lanthipeptide-class-i

Download region SVG

Location: 616,672 - 638,423 nt. (total: 21,752 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

IE242_RS12810: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE242_RS12815: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase dehydratase

IE242_RS12770: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

IE242_RS12775: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Translocases: permease

IE242_RS12750: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000540.5	0.46	ribosomal	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0002635.2	0.46	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000515.4	0.42	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0001789.3	0.41	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000506.4	0.41	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000617.5	0.41	ribosomal	coagulin	Bacillus coagulans
BGC0002825.2	0.40	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000540.5	0.46	ribosomal	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0002635.2	0.46	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000515.4	0.42	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0001789.3	0.41	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000506.4	0.41	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000617.5	0.41	ribosomal	coagulin	Bacillus coagulans
BGC0002825.2	0.40	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for IE242_RS12770

IE242_RS12765

Leader:

MTIQLERPIAPTQPDAEAVHDATDPFNLDITFIEGTPATE

Core:

TVLMCSTGDTCGSSCPSACVTS

Core with dehydrations:

DhbVLMCysDhaDhbGDDhbCysGDhaDhaCysPDhaACysVDhbDha

antiSMASH-DB 4.0 matches for IE242_RS12765

100.0%

NZ_BMVW01000003.1and 2 others:

NZ_CP011799.1 Lanthipeptides: QR97_RS02045_lanthipeptideNZ_JAEVFI010000002.1 Lanthipeptides: JJV70_RS02680_lanthipeptide

Lanthipeptides: IE242_RS12765_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

TVLMCSTGDTCGSSCPSACVTS

1

TVLMCSTGDTCGSSCPSACVTS

22

95.5%

NZ_BBYG01000011.1and 23 others:

NZ_BBZE01000004.1 Lanthipeptides: AOQ56_RS00075_lanthipeptideNZ_BMUG01000008.1 Lanthipeptides: IE264_RS24565_lanthipeptideNZ_CP013219.1 Lanthipeptides: SHL15_RS30830_lanthipeptideNZ_CP021978.1 Lanthipeptides: CEB94_RS33350_lanthipeptideNZ_CP029342.1 Lanthipeptides: B9S64_RS02555_lanthipeptideNZ_CP030073.1 Lanthipeptides: DN051_RS07240_lanthipeptideNZ_CP041610.2 Lanthipeptides: FNV62_RS40125_lanthipeptideNZ_CP041613.2 Lanthipeptides: FNV68_RS42745_lanthipeptideNZ_CP051006.1 Lanthipeptides: HEP81_RS07390_lanthipeptideNZ_CP074102.1 Lanthipeptides: SMIR_RS04425_lanthipeptideNZ_CP101397.1 Lanthipeptides: NLU04_RS20150_lanthipeptideNZ_CP113910.1 Lanthipeptides: HUV60_RS04250_lanthipeptideNZ_FKJI03000004.1 Lanthipeptides: A7P67_RS09720_lanthipeptideNZ_JACHCX010000047.1 Lanthipeptides: HDC93_RS37275_lanthipeptideNZ_KQ948477.1 Lanthipeptides: AQJ27_RS43755_lanthipeptideNZ_KQ948550.1 Lanthipeptides: AQJ30_RS07460_lanthipeptideNZ_LIVY01000006.1 Lanthipeptides: AMK30_RS21645_lanthipeptideNZ_LMDL01000002.1 Lanthipeptides: ASD08_RS03885_lanthipeptideNZ_RAII01000001.1 Lanthipeptides: EBH12_RS06225_lanthipeptideNZ_SHKS01000004.1 Lanthipeptides: EV567_RS16240_lanthipeptideNZ_SHKU01000001.1 Lanthipeptides: EV284_RS02155_lanthipeptideNZ_SZNQ01000001.1 Lanthipeptides: E4U91_RS28815_lanthipeptideNZ_VIUV01000003.1 Lanthipeptides: FB570_RS08885_lanthipeptide

Lanthipeptides: AOQ37_RS11080_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

TVLMCSTGDTCGSSCPSAC TS

1

TVLMCSTGDTCGSSCPSACTTS

22

90.9%

NZ_CP029042.1:

Lanthipeptides: DDE74_RS17120_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

TVLMCSTGD CGSSCPSAC TS

1

TVLMCSTGDNCGSSCPSACTTS

22

with 191 more sequence matches

Only the first 10 are displayed here.

90.9%

NZ_CP050976.1:

Lanthipeptides: HEP86_RS36805_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

TVLMC+TGDTCGSSCPSAC TS

1

TVLMCTTGDTCGSSCPSACTTS

22

90.9%

NZ_CP070379.1:

Lanthipeptides: JVE63_RS10125_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

TVL C+TGDTCGSSCPSACVTS

1

TVLTCTTGDTCGSSCPSACVTS

22

86.4%

NZ_BMSO01000039.1and 5 others:

NZ_BMTU01000002.1 Lanthipeptides: IE118_RS05930_lanthipeptideNZ_BMUK01000002.1 Lanthipeptides: IE276_RS05195_lanthipeptideNZ_CP036534.1 Lanthipeptides: EZV63_RS30040_lanthipeptideNZ_KB907208.1 Lanthipeptides: G339_RS0101560_lanthipeptideNZ_KB907208.1 Lanthipeptides: G339_RS0101560_lanthipeptide

Lanthipeptides: IE184_RS41715_lanthipeptide

3

LMCSTGDTCGSSCPSACVTS

22

LMCSTGDTCGSSCPSAC TS

1

LMCSTGDTCGSSCPSACTTS

20

86.4%

NZ_CP045178.1:

Lanthipeptides: GBW32_RS14380_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

T+LMCSTGD CGSSCPSAC TS

1

TMLMCSTGDNCGSSCPSACTTS

22

86.4%

NZ_KI866523.1and 2 others:

NZ_VYTZ01000014.1 Lanthipeptides: F5972_RS30195_lanthipeptideNZ_VYTZ01000014.1 Lanthipeptides: F5972_RS30195_lanthipeptide

Lanthipeptides: MPTA5024_RS18085_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

TVL+CSTGD CGSSCPSAC TS

1

TVLLCSTGDNCGSSCPSACTTS

22

86.4%

NZ_ML123117.1:

Lanthipeptides: EES46_RS09865_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

TVLMC TGD CGSSCPSAC TS

1

TVLMCGTGDNCGSSCPSACTTS

22

81.8%

NZ_CP036455.1:

Lanthipeptides: EKD16_RS21370_lanthipeptide

1

TVLMCSTGDTCGSSCPSACVTS

22

T L+CSTGD CGSSCPSAC TS

1

TELLCSTGDNCGSSCPSACTTS

22

81.8%

NZ_FNCN01000004.1:

Lanthipeptides: BLQ73_RS05220_lanthipeptide

3

LMCSTGDTCGSSCPSACVTS

22

LMC TGDTCGSSCPSAC TS

1

LMCGTGDTCGSSCPSACTTS

20

81.8%

NZ_JAHLXF010000013.1:

Lanthipeptides: KQY13_RS21225_lanthipeptide

3

LMCSTGDTCGSSCPSACVTS

22

LMCSTGD CGSSCPSAC TS

1

LMCSTGDNCGSSCPSACTTS

20

77.3%

NZ_FOQY01000053.1:

Lanthipeptides: BM085_RS43985_lanthipeptide

3

LMCSTGDTCGSSCPSACVTS

22

LMCSTGD CG+SCPSAC TS

1

LMCSTGDNCGTSCPSACTTS

20

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.14 out of 27.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.88 out of 20.01

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

IE242_RS12765 - Class I

Cleavage pHMM score: -5.20

RODEO score: 24

Monoisotopic mass: 1946.8 Da

Molecular weight: 1948.2 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 1966.2 Da N = 1; 1984.2 Da N = 2; 2002.3 Da N = 3; 2020.3 Da N = 4; 2038.3 Da N = 5

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 156 - 241; Score: 52.1

TFBS definitions

Regulator	Description

NZ_BMVW01000005.1 - Region 1 - T2PKS

Download region SVG

Location: 203,219 - 275,764 nt. (total: 72,546 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

IE242_RS15845: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

IE242_RS15850: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

IE242_RS15890: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

IE242_RS15895: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE242_RS15910: Monooxygenation

MITE: MITE0000012Monooxygenation (identity: 68.00%)
smcogs: SMCOG1050: monooxygenase FAD-binding

IE242_RS15920: Monooxygenation

MITE: MITE0000013Monooxygenation (identity: 75.30%)
smcogs: SMCOG1050: monooxygenase FAD-binding

IE242_RS15930: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE242_RS15935: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE242_RS15950: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IE242_RS15955: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IE242_RS16005: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE242_RS16010: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE242_RS16025: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: glycosyltransferase methyltransferase

IE242_RS15925: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

IE242_RS15945: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

IE242_RS16170: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE242_RS16175: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase

IE242_RS15970: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: cyclase

IE242_RS15980: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

IE242_RS37720: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Isomerases: mutase

IE242_RS16080: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthase

IE242_RS15990: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE242_RS15995: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000266.5	0.83	PKS	collinomycin	Streptomyces collinus
BGC0000231.5	0.65	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.61	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000234.5	0.61	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000275.4	0.55	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0000204.5	0.55	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0001513.3	0.55	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000215.5	0.55	PKS	curamycin	Streptomyces cyaneus
BGC0000272.3	0.55	PKS	spore pigment	Streptomyces collinus
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000266.5	0.83	PKS	collinomycin	Streptomyces collinus
BGC0000231.5	0.65	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.61	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000234.5	0.61	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000275.4	0.55	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0000204.5	0.55	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0001513.3	0.55	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000215.5	0.55	PKS	curamycin	Streptomyces cyaneus
BGC0000272.3	0.55	PKS	spore pigment	Streptomyces collinus
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.18 out of 20.97

Confidence: strong

Additional weak hits (10):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.94 out of 27.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.85 out of 30.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.36 out of 25.88

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.18 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.57 out of 32.93

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.98 out of 28.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 203218 to 275764
Starter unit(s):: malonamyl-CoA (Score: 560.0; E-value: 0)
Malonyl elongations:: 11|12 (Score: 700.2; E-value: 1.5e-213)
Product class(es):: pentangular polyphenol
Product molecular weight(s):: malonamyl-CoA_11: 599 Da
malonamyl-CoA_12: 641 Da

IE242_RS15895: KR (Score: 176.3; E-value: 2.1e-54)
IE242_RS15910: OXY (Score: 275.3; E-value: 2.6e-84)
IE242_RS15920: OXY (Score: 459.0; E-value: 4.8e-140)
IE242_RS15925: MET (Score: 381.4; E-value: 8.8e-117)
IE242_RS15945: MET C13O|C17O (Score: 415.4; E-value: 3.4e-127)
IE242_RS15950: OXY (Score: 278.4; E-value: 2.8e-85)
IE242_RS15955: OXY (Score: 295.4; E-value: 2e-90)
IE242_RS15970: AMID (Score: 730.9; E-value: 2.3e-222); AMID CAM34350.1_Lysolipin_malonamyl-CoA (Score: 560.0; E-value: 0.0)
IE242_RS15980: CYC C4-C21/C2-C23|C2-C19 (Score: 181.0; E-value: 1.1e-56)
IE242_RS15985: CYC C5-C18 (Score: 216.2; E-value: 2.7e-67)
IE242_RS15990: KS (Score: 765.1; E-value: 3.8e-233)
IE242_RS15995: CLF 11|12 (Score: 700.2; E-value: 1.5e-213)
IE242_RS16000: ACP (Score: 113.2; E-value: 9.7e-36)
IE242_RS16005: KR C11 (Score: 258.2; E-value: 1.7e-79)
IE242_RS16010: KR C19 (Score: 428.6; E-value: 1.7e-131)
IE242_RS16170: MET (Score: 23.4; E-value: 6.4e-08)
IE242_RS37720: CYC C9-C14 (Score: 260.5; E-value: 8.9e-81)

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
MexT	Global virulence regulator

NZ_BMVW01000008.1 - Region 1 - melanin

Download region SVG

Location: 75,202 - 85,792 nt. (total: 10,591 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.82	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.70	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.37	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000662.5	0.32	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000889.5	0.31	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.31	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.24	other (other)	iso-A82775C	Pestalotiopsis fici

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.82	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.70	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.37	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000662.5	0.32	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000889.5	0.31	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.31	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.24	other (other)	iso-A82775C	Pestalotiopsis fici

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (2):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_BMVW01000009.1 - Region 1 - T1PKS

Download region SVG

Location: 16,434 - 69,554 nt. (total: 53,121 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE242_RS21905: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Transferases: acylase transferase

IE242_RS21940: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

IE242_RS21965: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Hydrolases: esterase

IE242_RS21950: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

IE242_RS21955: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

IE242_RS21945: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.67	PKS	oronofacic acid	Pseudomonas syringae
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.67	PKS	oronofacic acid	Pseudomonas syringae
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.44 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 27.18 out of 30.12

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.68 out of 30.12

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (8):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.25 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.08 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 25.82 out of 32.74

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.12 out of 27.55

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.36 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 16433 - 69554:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - redmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

IE242_RS21940: mmal - mal

PKS_AT (137..434): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 208.7
Ethylmalonyl-CoA: 195.3
Methoxymalonyl-CoA: 173.3
2-Methylbutyryl-CoA: 126.6
trans-1,2-CPDA: 119.3
Propionyl-CoA: 107.4
CHC-CoA: 90.5
Malonyl-CoA: 83.0
Isobutyryl-CoA: 80.4
Benzoyl-CoA: 51.5
3-Methylbutyryl-CoA: 38.8
Acetyl-CoA: 31.5
fatty_acid: 24.5
inactive: 17.3

PKS_AT (1112..1397): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 186.5
inactive: 74.0
Methoxymalonyl-CoA: 55.7
Methylmalonyl-CoA: 48.0
Propionyl-CoA: 25.4
Ethylmalonyl-CoA: 19.9
Acetyl-CoA: 19.7
Isobutyryl-CoA: 18.7
Benzoyl-CoA: 11.0
CHC-CoA: 10.3
2-Methylbutyryl-CoA: 8.5
trans-1,2-CPDA: 8.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVW01000009.1 - Region 2 - NRPS,lanthipeptide-class-i,transAT-PKS

Download region SVG

Location: 222,277 - 295,287 nt. (total: 73,011 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE242_RS22870: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

IE242_RS22915: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase methyltransferase

IE242_RS22765: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE242_RS22770: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE242_RS22935: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

IE242_RS22940: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: phosphatase

IE242_RS22945: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Lyases: cyclase

IE242_RS22795: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Isomerases: isomerase

IE242_RS22880: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: synthase

IE242_RS22950: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.46 out of 30.11

Confidence: medium

Additional weak hits (6):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.94 out of 21.55

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.95 out of 31.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.46 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.47 out of 27.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 2, location 222276 - 295287:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Asp) + (ohmal - ccmal - mal) + (ohmal - Me-mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 235067 - 281763:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Asp) + (ohmal - ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 253065 - 295287:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Asp) + (ohmal - ccmal - mal) + (ohmal - Me-mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

IE242_RS22885: X - Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (9..406): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDSAFDPSVHCHTIITGGDRCAYGPTEATMVASQ
Nearest Stachelhaus code(s):: Leu DALLIGAVVK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1058..1457): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWSSFDLTVTGTKALLGGERNVYGPTEATVNCAE
Nearest Stachelhaus code(s):: Asp DLTKLGVVNK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

IE242_RS22940: mal

PKS_AT (5..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 127.2
inactive: 43.1
Methoxymalonyl-CoA: 39.9
Methylmalonyl-CoA: 30.6
Isobutyryl-CoA: 24.9
Propionyl-CoA: 20.5
CHC-CoA: 8.0
Ethylmalonyl-CoA: 7.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor

NZ_BMVW01000010.1 - Region 1 - NI-siderophore

Download region SVG

Location: 233,141 - 262,913 nt. (total: 29,773 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE242_RS24060: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

IE242_RS24100: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: carboxylase

IE242_RS24110: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Lyases: decarboxylase

IE242_RS24065: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase

IE242_RS24105: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Translocases: transporter

IE242_RS23995: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000940.5	0.85	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.63	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.57	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002073.3	0.56	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000940.5	0.85	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.63	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.57	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002073.3	0.56	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 33.36 out of 36.53

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.26 out of 23.43

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 27.04

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.77 out of 36.53

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.86 out of 23.79

Confidence: medium

Additional weak hits (9):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.31 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.50 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.16 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.61 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.73 out of 26.85

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.99 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.77 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.32 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator

NZ_BMVW01000012.1 - Region 1 - NRPS,NRPS-like,arylpolyene,terpene-precursor

Download region SVG

Location: 8,515 - 124,332 nt. (total: 115,818 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
terpene-precursor: (PT_FPPS_like and not PT_HPP)
arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

IE242_RS25420: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE242_RS25475: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE242_RS25495: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE242_RS25510: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE242_RS25530: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

IE242_RS25660: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase acyltransferase aminotransferase transferase

IE242_RS25465: aminotransferase

smcogs: SMCOG1019: aminotransferase

IE242_RS25505: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

IE242_RS25575: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

IE242_RS25610: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: esterase hydrolase

IE242_RS25415: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IE242_RS25455: thioesterase

smcogs: SMCOG1004: thioesterase

IE242_RS25645: thioesterase

smcogs: SMCOG1004: thioesterase

IE242_RS25685: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

IE242_RS25555: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase synthetase

IE242_RS25500: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE242_RS25515: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE242_RS25535: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

IE242_RS25560: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE242_RS25585: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE242_RS25605: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

IE242_RS25675: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE242_RS25690: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE242_RS25695: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE242_RS25700: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.98	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002277.2	0.96	NRPS	atromentin	Suillus grevillei
BGC0002274.2	0.94	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001641.4	0.92	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002193.2	0.91	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0000016.4	0.64	other (other)	amphotericin B	Streptomyces nodosus
BGC0002071.2	0.61	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0000351.5	0.58	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0001363.5	0.57	NRPS, PKS	ralsolamycin	Ralstonia solanacearum GMI1000
BGC0001844.4	0.55	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IE242_RS25535: PT_FPPS_like

Domain 1 (57 - 341): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.20 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.67 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

Additional weak hits (25):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.50 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.54 out of 27.04

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.53 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.36 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.81 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.13 out of 29.65

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.38 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.20 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.74 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.42 out of 26.06

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.21 out of 20.01

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.08 out of 24.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.98 out of 28.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.94 out of 23.43

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.48 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.20 out of 32.93

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.24 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.24 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 8514 - 124332:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - Pro - D-X) + (Gly - D-Tyr - Asn) + (Thr - X - Thr - D-Gly) + (fatty_acid)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 8514 - 87315:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - Pro - D-X) + (Gly - D-Tyr - Asn) + (Thr - X - Thr - D-Gly) + (fatty_acid)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 54053 - 96846:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - X - Thr - D-Gly) + (fatty_acid)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

IE242_RS25500: Leu - Pro - X

Search NORINE for peptide: strict or relaxed

AMP-binding (462..864): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LEHAFDAAVWEMLIIVGGEINAYGPTEATVAASI
Nearest Stachelhaus code(s):: Leu DALLIGAVAK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1527..1936): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHTFDVSAQESYAAQAGEHNHYGPTESHVVTGT
Nearest Stachelhaus code(s):: Pro DVQYAAHVVK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2593..2990): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSQSFDAAFWEALIAVGGEVNAYGPTEATVAATM
Nearest Stachelhaus code(s):: Leu DAMLAGAVAK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

IE242_RS25505: Gly - Tyr - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (464..861): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FDMTFDIAGLEVQALVGGETNVYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1524..1917): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGYAFDAAFAEKTILVAGEVNAYGPTETTVCATI
Nearest Stachelhaus code(s):: Tyr DAATLAAVAK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (3071..3464): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YQASFDMAVTSG-AVIGGEVNEYGPTEATVGCAV
Nearest Stachelhaus code(s):: Asn DMTKVGEVGK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

IE242_RS25515: Thr - X - Thr - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (465..879): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1542..1939): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FDGAFDAVNYEVHLLAGGDRDTYGPTETTSFATN
Nearest Stachelhaus code(s):: Hpg DAYHLGLLCK (71% 8Å match); Dhpg DAYHGGTLCK (71% 8Å match); Val DAYWLGGTFK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2603..3017): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3677..4073): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FDMTFDIAGLELQALTGGETNLYGPTETTIWSTV
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

IE242_RS25560: fatty_acid

CAL_domain (39..447): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 18.7
Acetyl-CoA: 12.8
AHBA: 5.3
shikimic_acid: 0.0
NH2: 0.0

IE242_RS25575: mal

PKS_AT (8..295): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 87.0
Methoxymalonyl-CoA: 60.5
Methylmalonyl-CoA: 49.3
CHC-CoA: 27.2
Propionyl-CoA: 26.7
trans-1,2-CPDA: 25.4
2-Methylbutyryl-CoA: 24.7
Ethylmalonyl-CoA: 23.7
inactive: 18.9
fatty_acid: 12.2
Acetyl-CoA: 11.9
Isobutyryl-CoA: 9.1
Benzoyl-CoA: 7.8
3-Methylbutyryl-CoA: 0.0

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVW01000012.1 - Region 2 - RiPP-like

Download region SVG

Location: 174,186 - 185,505 nt. (total: 11,320 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IE242_RS25980: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

IE242_RS26000: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000674.5	0.44	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0000496.5	0.37	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000498.5	0.36	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.36	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0002387.2	0.34	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000306.5	0.34	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0000565.5	0.33	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002663.2	0.33	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0002303.3	0.32	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0000529.5	0.32	ribosomal	microbisporicin A2	Microbispora corallina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000674.5	0.44	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0000496.5	0.37	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000498.5	0.36	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.36	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0002387.2	0.34	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000306.5	0.34	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0000565.5	0.33	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002663.2	0.33	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0002303.3	0.32	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0000529.5	0.32	ribosomal	microbisporicin A2	Microbispora corallina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 17.96 out of 23.79

Confidence: medium

Additional weak hits (3):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.08 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.63 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_BMVW01000012.1 - Region 3 - terpene

Download region SVG

Location: 223,448 - 245,700 nt. (total: 22,253 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE242_RS26230: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: glucanase peptidase protease

IE242_RS26235: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

IE242_RS26260: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

IE242_RS26270: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

Lyases: cyclase

IE242_RS26250: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

IE242_RS26220: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.84	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.61	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002191.2	0.58	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.57	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.84	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.61	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002191.2	0.58	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.57	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

IE242_RS26250: T1TS + T1TS

Domain 1 (2 - 325): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (369 - 719): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.49 out of 30.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.60 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description

NZ_BMVW01000013.1 - Region 1 - T3PKS

Download region SVG

Location: 92,209 - 133,294 nt. (total: 41,086 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase reductase

IE242_RS26930: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE242_RS26940: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE242_RS26960: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

IE242_RS26975: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

IE242_RS26985: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE242_RS26990: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE242_RS26995: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acetyltransferase acyltransferase aminotransferase

IE242_RS26850: acyltransferase

smcogs: SMCOG1141: acyltransferase

IE242_RS26860: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

IE242_RS27050: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: deformylase

IE242_RS26920: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: synthase

IE242_RS26945: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.85	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.75	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.64	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001310.5	0.63	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001078.5	0.47	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0000281.3	0.47	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000860.3	0.46	other (other)	ectoine	Methylarcula marina
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.85	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.75	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.64	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001310.5	0.63	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001078.5	0.47	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0000281.3	0.47	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000860.3	0.46	other (other)	ectoine	Methylarcula marina
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.52 out of 23.79

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.79 out of 29.51

Confidence: medium

Additional weak hits (10):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.97 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.41 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.46 out of 26.85

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.68 out of 30.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.45 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.71 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.13 out of 27.04

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.81 out of 30.98

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism

NZ_BMVW01000013.1 - Region 2 - T1PKS,azoxy-crosslink

Download region SVG

Location: 190,268 - 242,340 nt. (total: 52,073 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
azoxy-crosslink: (azdH and LPG_synthase_C and azdO and vlmB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

IE242_RS27345: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

IE242_RS27370: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

IE242_RS27375: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE242_RS27470: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

Transferases: aminotransferase

IE242_RS27415: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: esterase

IE242_RS27385: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

IE242_RS27365: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase synthase

IE242_RS27350: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE242_RS27355: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE242_RS27435: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IE242_RS27445: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001275.3	0.53	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001268.4	0.46	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000016.4	0.39	other (other)	amphotericin B	Streptomyces nodosus
BGC0002381.3	0.37	PKS, other (other)	tambjamine BE-18591	Streptomyces albus subsp. albus
BGC0002711.2	0.37	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000852.5	0.34	other (other)	ectoine	Sporosarcina pasteurii
BGC0000856.3	0.32	other (other)	ectoine	Methylophaga thalassica
BGC0000858.3	0.32	other (other)	ectoine	Methylobacter marinus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.96 out of 23.79

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.22 out of 27.18

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 32.38 out of 32.38

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 27.98 out of 32.38

Confidence: medium

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 28.54 out of 32.93

Confidence: medium

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 28.54 out of 32.93

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.50 out of 23.79

Confidence: medium

Additional weak hits (11):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 25.23 out of 32.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.10 out of 28.14

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.11 out of 32.38

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.70 out of 23.43

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.60 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.30 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 190267 - 242340:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 190267 - 236819:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (redmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

IE242_RS27350: X

AMP-binding (20..445): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VGIMHAGGLSYQLVIYGGAAQIYGSSETGNFATC
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

IE242_RS27355: mal

PKS_AT (600..884): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 180.1
inactive: 107.5
Methylmalonyl-CoA: 65.8
Methoxymalonyl-CoA: 60.5
Isobutyryl-CoA: 42.1
Propionyl-CoA: 39.3
Benzoyl-CoA: 36.1
Ethylmalonyl-CoA: 32.1
2-Methylbutyryl-CoA: 23.0
CHC-CoA: 21.3
trans-1,2-CPDA: 17.1
Acetyl-CoA: 12.8
fatty_acid: 12.4
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CsoR	Copper-responsive repressor
IolR	Regulator of the inositol catabolism
NrdR	Represses ribonucleotide reductase encoding genes
RicR	Copper-responsive regulator

NZ_BMVW01000016.1 - Region 1 - NAPAA

Download region SVG

Location: 1 - 32,811 nt. (total: 32,811 nt) Show pHMM detection rules used

Region on contig edge.

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE242_RS29615: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE242_RS29630: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Hydrolases: deaminase

IE242_RS29625: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Ligases: synthase

IE242_RS29620: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.71	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.65	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0002174.2	0.63	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.71	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.65	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0002174.2	0.63	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (8):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.32 out of 26.85

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.79 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.70 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.40 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.48 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.39 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.59 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 32811:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

IE242_RS29635: X

AMP-binding (245..649): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQSQCSVTGEVNAYGLTETSDDTNH
Nearest Stachelhaus code(s):: Dpr DIWQSTADDK (97% 8Å match); dnmeProp or Dab DIWQSTADDK (82% 8Å match); Asp DIWQSTADDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_BMVW01000016.1 - Region 2 - NI-siderophore,T1PKS

Download region SVG

Location: 170,529 - 221,839 nt. (total: 51,311 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE242_RS30345: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Transferases: acylase aminotransferase

IE242_RS30350: aminotransferase

smcogs: SMCOG1019: aminotransferase

IE242_RS30530: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Isomerases: mutase

IE242_RS30305: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

IE242_RS30515: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IE242_RS30520: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.31	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.31	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002274.2	0.29	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001254.3	0.28	PKS	ACT-Toxin II	Alternaria alternata
BGC0001273.3	0.27	PKS	asperlactone	Aspergillus ochraceus
BGC0001257.3	0.27	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001275.3	0.27	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.27	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.26	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000037.4	0.26	PKS	cichorine	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002274.2	0.63	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.28 out of 23.43

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.52 out of 23.79

Confidence: medium

Additional weak hits (9):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.84 out of 23.43

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.63 out of 36.54

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.32 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.54 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.37 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.82 out of 27.78

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.26 out of 27.18

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.98 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.24 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 170528 - 221839:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 197388 - 221839:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

IE242_RS30520: Acetyl-CoA

CAL_domain (45..500): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 48.2
fatty_acid: 19.2
shikimic_acid: 0.0
NH2: -1.3
AHBA: -2.8

IE242_RS30530: mal

PKS_AT (553..852): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 217.9
inactive: 118.4
Methoxymalonyl-CoA: 67.7
Methylmalonyl-CoA: 49.1
Isobutyryl-CoA: 39.9
Propionyl-CoA: 30.0
Benzoyl-CoA: 20.0
Acetyl-CoA: 17.6
Ethylmalonyl-CoA: 14.3
CHC-CoA: 10.1
trans-1,2-CPDA: 9.2
fatty_acid: 9.2
2-Methylbutyryl-CoA: 8.5
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
IolR	Regulator of the inositol catabolism

NZ_BMVW01000017.1 - Region 1 - terpene

Download region SVG

Location: 69,894 - 94,453 nt. (total: 24,560 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE242_RS30955: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Lyases: cyclase

IE242_RS30920: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthetase

IE242_RS30900: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.54	terpene	stellatic acid	Aspergillus stellatus
BGC0002309.2	0.48	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001210.5	0.41	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000541.5	0.40	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000552.3	0.40	ribosomal	SmbA, SmbB	Streptococcus mutans
BGC0000626.3	0.40	ribosomal	thuricin	Bacillus thuringiensis
BGC0000542.3	0.40	ribosomal	paenicidin B	Paenibacillus terrae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.54	terpene	stellatic acid	Aspergillus stellatus
BGC0002309.2	0.48	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001210.5	0.41	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000541.5	0.40	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000552.3	0.40	ribosomal	SmbA, SmbB	Streptococcus mutans
BGC0000626.3	0.40	ribosomal	thuricin	Bacillus thuringiensis
BGC0000542.3	0.40	ribosomal	paenicidin B	Paenibacillus terrae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IE242_RS30900: PT_FPPS_like

Domain 1 (71 - 349): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

IE242_RS30920: T1TS

Domain 1 (12 - 315): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (11):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.03 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.78 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.61 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.78 out of 27.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.07 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.67 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.39 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.35 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_BMVW01000017.1 - Region 2 - ectoine

Download region SVG

Location: 108,137 - 118,547 nt. (total: 10,411 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

IE242_RS31015: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

IE242_RS31030: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

IE242_RS31040: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.60	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.60	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMVW01000018.1 - Region 1 - terpene

Download region SVG

Location: 85,496 - 106,581 nt. (total: 21,086 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

IE242_RS31815: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

IE242_RS31830: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: cyclase

IE242_RS31820: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.80	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.80	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000918.3	0.40	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001782.3	0.38	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0002657.2	0.37	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0001760.5	0.33	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970
BGC0000709.5	0.31	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0000595.3	0.30	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002571.2	0.30	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.80	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.80	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000918.3	0.40	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001782.3	0.38	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0002657.2	0.37	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0001760.5	0.33	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970
BGC0000709.5	0.31	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0000595.3	0.30	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002571.2	0.30	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

IE242_RS31820: T1TS

Domain 1 (6 - 355): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.23 out of 23.79

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.63 out of 27.04

Confidence: medium

Additional weak hits (8):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.07 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.36 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.30 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.77 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.73 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.06 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.44 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVW01000020.1 - Region 1 - lassopeptide

Download region SVG

Location: 29,997 - 52,511 nt. (total: 22,515 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

IE242_RS38720: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: cyclase

IE242_RS33105: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Translocases: transporter

IE242_RS33155: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002053.3	0.73	ribosomal	ulleungdin	Streptomyces sp.
BGC0001539.4	0.73	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001506.5	0.73	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002074.2	0.72	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001507.3	0.71	ribosomal	anantin C	Streptomyces olindensis
BGC0001493.5	0.63	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0002318.2	0.62	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus
BGC0001552.3	0.60	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.59	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002053.3	0.73	ribosomal	ulleungdin	Streptomyces sp.
BGC0001539.4	0.73	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001506.5	0.73	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002074.2	0.72	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001507.3	0.71	ribosomal	anantin C	Streptomyces olindensis
BGC0001493.5	0.63	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0002318.2	0.62	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus
BGC0001552.3	0.60	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.59	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.37 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.99 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.03 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.56 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.87 out of 28.19

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 3 - 87; Score: 84.5; RRE type: Lasso_Fused_RRE; Location: 4 - 60; Score: 26.1

TFBS definitions

Regulator	Description

NZ_BMVW01000020.1 - Region 2 - T1PKS

Download region SVG

Location: 81,965 - 129,518 nt. (total: 47,554 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE242_RS33355: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

IE242_RS33400: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

IE242_RS33335: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

IE242_RS33280: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.73	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.73	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 25.31

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.03 out of 23.43

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.34 out of 23.43

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.02 out of 21.84

Confidence: medium

Additional weak hits (11):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.51 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.82 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 20.17 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.68 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.27 out of 28.19

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.60 out of 30.11

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 81964 - 129518:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

IE242_RS33335: pk

PKS_AT (553..848): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 58.3%; Propionyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 103.9
Methoxymalonyl-CoA: 94.4
Malonyl-CoA: 76.4
Ethylmalonyl-CoA: 66.1
Propionyl-CoA: 46.7
Isobutyryl-CoA: 45.8
2-Methylbutyryl-CoA: 41.6
Benzoyl-CoA: 37.3
trans-1,2-CPDA: 30.6
CHC-CoA: 29.7
fatty_acid: 27.9
Acetyl-CoA: 26.9
inactive: 21.5
3-Methylbutyryl-CoA: 11.5

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CatR	H2O2-responsive repressor
MexT	Global virulence regulator

NZ_BMVW01000021.1 - Region 1 - terpene

Download region SVG

Location: 1 - 18,725 nt. (total: 18,725 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE242_RS33500: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

IE242_RS33535: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: transferase

IE242_RS33540: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Ligases: synthetase

IE242_RS33495: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.70	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000645.3	0.48	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000664.5	0.47	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.70	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000645.3	0.48	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000664.5	0.47	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

IE242_RS33490: T2TS

Domain 1 (25 - 656): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

IE242_RS33495: PT_FPPS_like

Domain 1 (79 - 372): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

IE242_RS33505: PT_phytoene_like

Domain 1 (17 - 306): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

IE242_RS33510: PT_phytoene_like

Domain 1 (17 - 287): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (4):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.42 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.98 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_BMVW01000023.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 32,671 nt. (total: 32,671 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE242_RS34400: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE242_RS34405: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE242_RS34410: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: esterase

IE242_RS34435: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: synthase

IE242_RS34395: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000041.3	0.61	PKS	oronofacic acid	Pseudomonas syringae
BGC0000059.5	0.59	PKS	filipin	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000016.4	0.57	other (other)	amphotericin B	Streptomyces nodosus
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.56	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002032.4	0.56	PKS	pentamycin	Streptomyces sp. S816
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000041.3	0.61	PKS	oronofacic acid	Pseudomonas syringae
BGC0000059.5	0.59	PKS	filipin	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000016.4	0.57	other (other)	amphotericin B	Streptomyces nodosus
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.56	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002032.4	0.56	PKS	pentamycin	Streptomyces sp. S816
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.64 out of 23.79

Confidence: medium

Additional weak hits (5):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.23 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.88 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.68 out of 31.73

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.84 out of 30.98

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.95 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 32671:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal - pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

IE242_RS34395: mal - pk

PKS_AT (562..837): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 226.7
inactive: 119.0
Methoxymalonyl-CoA: 70.5
Methylmalonyl-CoA: 66.0
Propionyl-CoA: 38.7
Ethylmalonyl-CoA: 32.9
Acetyl-CoA: 26.8
Benzoyl-CoA: 23.0
CHC-CoA: 20.5
Isobutyryl-CoA: 18.6
trans-1,2-CPDA: 14.7
2-Methylbutyryl-CoA: 14.5
fatty_acid: 13.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (2071..2368): pk

ATSignature: Methoxymalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%; Methylmalonyl-CoA: 75.0%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 197.2
Methylmalonyl-CoA: 183.0
Methoxymalonyl-CoA: 165.0
2-Methylbutyryl-CoA: 123.3
trans-1,2-CPDA: 122.3
Propionyl-CoA: 114.5
CHC-CoA: 93.9
Isobutyryl-CoA: 88.4
Malonyl-CoA: 88.1
Benzoyl-CoA: 73.1
Acetyl-CoA: 50.2
fatty_acid: 41.2
3-Methylbutyryl-CoA: 36.3
inactive: 32.5

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_BMVW01000026.1 - Region 1 - T1PKS,T3PKS,guanidinotides

Download region SVG

Location: 17,469 - 76,960 nt. (total: 59,492 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
guanidinotides: (pgm1 and pgm_amidino)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE242_RS35570: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE242_RS35640: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

Transferases: aminotransferase methyltransferase

IE242_RS35580: aminotransferase

smcogs: SMCOG1019: aminotransferase

IE242_RS35615: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Lyases: dehydratase hydratase

IE242_RS35540: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

IE242_RS35585: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

IE242_RS35590: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

IE242_RS35690: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

IE242_RS35595: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

IE242_RS35695: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001633.3	0.59	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001148.5	0.43	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0000282.3	0.42	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002034.3	0.38	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0001276.3	0.33	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001849.4	0.33	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0001275.3	0.33	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001606.3	0.33	PKS	gibepyrone-A	Fusarium fujikuroi IMI 58289
BGC0001244.3	0.33	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001647.3	0.32	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.67	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001633.3	0.63	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.60	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.60	PKS	ACT-Toxin II	Alternaria alternata
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.87 out of 28.19

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (11):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.47 out of 30.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.36 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.12 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.24 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.53 out of 33.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.56 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.88 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.52 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.76 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 17468 - 76960:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 43536 - 76960:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

IE242_RS35695: pk

PKS_AT (535..832): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 70.8%; CE-Malonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 108.8
Methoxymalonyl-CoA: 93.0
Malonyl-CoA: 85.6
Ethylmalonyl-CoA: 65.5
Isobutyryl-CoA: 59.9
Propionyl-CoA: 48.0
trans-1,2-CPDA: 40.7
CHC-CoA: 35.4
2-Methylbutyryl-CoA: 30.9
Benzoyl-CoA: 23.3
fatty_acid: 22.4
Acetyl-CoA: 21.0
inactive: 18.1
3-Methylbutyryl-CoA: 2.8

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_BMVW01000030.1 - Region 1 - RiPP-like

Download region SVG

Location: 22,672 - 34,054 nt. (total: 11,383 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.76	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0002073.3	0.42	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.42	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002531.3	0.41	NRPS	cepaciachelin	Burkholderia ambifaria AMMD

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.76	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0002073.3	0.42	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.42	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002531.3	0.41	NRPS	cepaciachelin	Burkholderia ambifaria AMMD

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

NZ_BMVW01000034.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 21,517 nt. (total: 21,517 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

IE242_RS37155: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

IE242_RS37160: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

IE242_RS37165: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE242_RS37170: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 21517:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (ccmal - pk) + (ccmal)
Non-colinear ordering:: IE242_RS37155 + IE242_RS37160 + IE242_RS37165

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

IE242_RS37155: mal

PKS_AT (0..157): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 102.5
inactive: 61.5
Methoxymalonyl-CoA: 18.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

IE242_RS37160: mal - pk

PKS_AT (586..863): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 205.6
inactive: 88.9
Methoxymalonyl-CoA: 61.3
Methylmalonyl-CoA: 59.2
Propionyl-CoA: 31.9
Acetyl-CoA: 27.1
Ethylmalonyl-CoA: 26.4
Benzoyl-CoA: 16.4
CHC-CoA: 12.2
Isobutyryl-CoA: 11.9
2-Methylbutyryl-CoA: 8.6
trans-1,2-CPDA: 7.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2314..2609): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 187.0
Methylmalonyl-CoA: 184.3
Methoxymalonyl-CoA: 154.2
2-Methylbutyryl-CoA: 142.2
trans-1,2-CPDA: 120.1
Propionyl-CoA: 108.1
Isobutyryl-CoA: 86.8
CHC-CoA: 83.1
Malonyl-CoA: 77.7
Benzoyl-CoA: 53.9
Acetyl-CoA: 41.7
3-Methylbutyryl-CoA: 31.5
inactive: 24.6
fatty_acid: 18.8

IE242_RS37165: mal

PKS_AT (603..883): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 207.3
inactive: 103.9
Methoxymalonyl-CoA: 55.8
Methylmalonyl-CoA: 47.3
Acetyl-CoA: 31.0
Propionyl-CoA: 26.3
Benzoyl-CoA: 15.3
CHC-CoA: 13.7
Ethylmalonyl-CoA: 12.9
trans-1,2-CPDA: 12.7
2-Methylbutyryl-CoA: 9.4
fatty_acid: 8.9
Isobutyryl-CoA: 7.9
3-Methylbutyryl-CoA: 0.0

NZ_BMVW01000035.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 13,932 nt. (total: 13,932 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

IE242_RS37175: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0002229.2	0.58	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0000170.3	0.56	PKS	yanuthone D	Aspergillus niger ATCC 1015
BGC0000068.5	0.55	PKS	geldanamycin	Streptomyces hygroscopicus
BGC0002615.2	0.55	terpene	4-oxomacrophorin A, macrophorin A, 5'-epimacrophorin B	Penicillium terrestre
BGC0000120.5	0.54	PKS	patulin	Penicillium expansum
BGC0000122.5	0.53	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000118.5	0.51	PKS	pactamycin	Streptomyces pactum
BGC0001213.5	0.51	PKS	nataxazole	Streptomyces sp. Tu 6176
BGC0000112.5	0.51	PKS	neocarzinostatin	Streptomyces carzinostaticus subsp. neocarzinostaticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0002229.2	0.58	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0000170.3	0.56	PKS	yanuthone D	Aspergillus niger ATCC 1015
BGC0000068.5	0.55	PKS	geldanamycin	Streptomyces hygroscopicus
BGC0002615.2	0.55	terpene	4-oxomacrophorin A, macrophorin A, 5'-epimacrophorin B	Penicillium terrestre
BGC0000120.5	0.54	PKS	patulin	Penicillium expansum
BGC0000122.5	0.53	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000118.5	0.51	PKS	pactamycin	Streptomyces pactum
BGC0001213.5	0.51	PKS	nataxazole	Streptomyces sp. Tu 6176
BGC0000112.5	0.51	PKS	neocarzinostatin	Streptomyces carzinostaticus subsp. neocarzinostaticus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 13932:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

IE242_RS37175: mal - mal

PKS_AT (1315..1595): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.3
inactive: 110.3
Methoxymalonyl-CoA: 62.2
Methylmalonyl-CoA: 53.5
Acetyl-CoA: 30.7
Propionyl-CoA: 29.4
Ethylmalonyl-CoA: 28.2
Benzoyl-CoA: 18.5
CHC-CoA: 16.7
2-Methylbutyryl-CoA: 14.6
Isobutyryl-CoA: 12.6
fatty_acid: 10.8
trans-1,2-CPDA: 9.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (3052..3332): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 212.9
inactive: 109.5
Methoxymalonyl-CoA: 59.1
Methylmalonyl-CoA: 51.8
Propionyl-CoA: 29.2
Acetyl-CoA: 25.9
Ethylmalonyl-CoA: 19.6
Benzoyl-CoA: 16.4
CHC-CoA: 12.9
2-Methylbutyryl-CoA: 12.3
Isobutyryl-CoA: 10.7
trans-1,2-CPDA: 10.4
fatty_acid: 8.6
3-Methylbutyryl-CoA: 0.0

NZ_BMVW01000036.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 11,482 nt. (total: 11,482 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

IE242_RS37180: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002171.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002749.2	0.51	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000043.5	0.50	PKS	curacin A	Moorea producens 19L
BGC0000122.5	0.49	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000143.5	0.49	PKS	salinomycin	Streptomyces albus
BGC0001235.4	0.48	NRPS, PKS	antalid	Polyangium spumosum
BGC0000041.3	0.47	PKS	oronofacic acid	Pseudomonas syringae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002171.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002749.2	0.51	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000043.5	0.50	PKS	curacin A	Moorea producens 19L
BGC0000122.5	0.49	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000143.5	0.49	PKS	salinomycin	Streptomyces albus
BGC0001235.4	0.48	NRPS, PKS	antalid	Polyangium spumosum
BGC0000041.3	0.47	PKS	oronofacic acid	Pseudomonas syringae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 11482:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal - ohmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

IE242_RS37180: mal - mal

PKS_AT (1299..1575): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 206.4
inactive: 103.4
Methoxymalonyl-CoA: 60.0
Methylmalonyl-CoA: 50.9
Propionyl-CoA: 28.4
Acetyl-CoA: 24.8
Ethylmalonyl-CoA: 18.4
Benzoyl-CoA: 18.3
CHC-CoA: 15.6
2-Methylbutyryl-CoA: 13.8
trans-1,2-CPDA: 11.6
Isobutyryl-CoA: 9.7
fatty_acid: 7.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (2804..3091): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 206.6
inactive: 115.1
Methoxymalonyl-CoA: 67.1
Methylmalonyl-CoA: 55.1
Propionyl-CoA: 35.1
Ethylmalonyl-CoA: 23.8
2-Methylbutyryl-CoA: 19.6
Benzoyl-CoA: 18.1
Isobutyryl-CoA: 17.7
trans-1,2-CPDA: 13.8
Acetyl-CoA: 13.7
CHC-CoA: 10.3
fatty_acid: 7.3
3-Methylbutyryl-CoA: 0.0