GCF_014650795.1 - 33 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_BMVQ01000001.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	hglE-KS,T1PKS	15,043	68,019
Region 1.2	terpene	101,373	129,610	High	isorenieratene	terpene
Region 1.3	lanthipeptide-class-i	185,912	210,470
Region 1.4	NRP-metallophore,NRPS	430,936	489,278	High	coelichelin	NRPS:Type I
Region 1.5	terpene-precursor	534,808	557,343
Region 1.6	RiPP-like	727,456	737,671	Low	informatipeptin	ribosomal:RiPP:Lanthipeptide
Region 1.7	T3PKS	1,190,186	1,231,388	High	flaviolin/1,3,6,8-tetrahydroxynaphthalene	PKS

NZ_BMVQ01000002.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	NI-siderophore	251,523	281,307	High	desferrioxamin B/desferrioxamine E	other:other
Region 2.2	melanin	354,795	365,364

NZ_BMVQ01000004.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	butyrolactone	1	7,948	Low	coelimycin P1	PKS:Type I
Region 4.2	NI-siderophore	31,422	62,629
Region 4.3	terpene	216,139	238,319	High	geosmin	terpene:Sesquiterpene
Region 4.4	RiPP-like	250,509	261,825
Region 4.5	NRPS-like,T1PKS,prodigiosin	416,839	469,638	High	undecylprodigiosin	NRPS:Type I+PKS
Region 4.6	NI-siderophore	536,846	566,606	Low	kinamycin	PKS

NZ_BMVQ01000005.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	thioamide-NRP,NRPS	54,454	108,626	Low	nogalamycin	PKS
Region 5.2	lanthipeptide-class-iii	382,697	405,393	High	SapB	ribosomal:RiPP:Lanthipeptide

NZ_BMVQ01000007.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	indole	117,993	139,120	High	5-dimethylallylindole-3-acetonitrile	other:other
Region 7.2	T3PKS,NRP-metallophore,NRPS,terpene	328,546	403,019	High	coelibactin	NRPS:Type I

NZ_BMVQ01000008.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	ectoine	73,881	84,279	High	ectoine	other:other

NZ_BMVQ01000009.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	T2PKS	71,647	144,189	Medium	spore pigment	PKS
Region 9.2	terpene-precursor	176,973	198,133
Region 9.3	terpene	207,153	228,238	High	albaflavenone	terpene
Region 9.4	T2PKS	331,713	388,943	High	actinorhodin	PKS:Type II aromatic

NZ_BMVQ01000012.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	NRPS	223,742	255,978	Low	CDA1b/CDA2a/CDA2b/CDA3a/CDA3b/CDA4a/CDA4b	NRPS:Type I

NZ_BMVQ01000014.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	lanthipeptide-class-i	151,834	172,123

NZ_BMVQ01000017.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	T3PKS	1	33,919	High	germicidin	other:other

NZ_BMVQ01000025.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 25.1	other	27,756	67,734

NZ_BMVQ01000028.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 28.1	terpene	14,488	41,238	High	hopene	terpene

NZ_BMVQ01000029.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 29.1	hydrogen-cyanide,T1PKS	16,903	53,561	Medium	coelimycin P1	PKS:Type I

NZ_BMVQ01000031.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 31.1	NRPS	1	34,716	Low	CDA1b/CDA2a/CDA2b/CDA3a/CDA3b/CDA4a/CDA4b	NRPS:Type I

NZ_BMVQ01000046.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 46.1	NRPS	1	6,474

NZ_BMVQ01000053.1 (Streptomyces anthocyanicus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 53.1	NRPS	1	2,907

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	hglE-KS,T1PKS	15,043	68,019
Region 1.2	terpene	101,373	129,610	High	isorenieratene	terpene
Region 1.3	lanthipeptide-class-i	185,912	210,470
Region 1.4	NRP-metallophore,NRPS	430,936	489,278	High	coelichelin	NRPS:Type I
Region 1.5	terpene-precursor	534,808	557,343
Region 1.6	RiPP-like	727,456	737,671	Low	informatipeptin	ribosomal:RiPP:Lanthipeptide
Region 1.7	T3PKS	1,190,186	1,231,388	High	flaviolin/1,3,6,8-tetrahydroxynaphthalene	PKS
Region 2.1	NI-siderophore	251,523	281,307	High	desferrioxamin B/desferrioxamine E	other:other
Region 2.2	melanin	354,795	365,364
Region 4.1	butyrolactone	1	7,948	Low	coelimycin P1	PKS:Type I
Region 4.2	NI-siderophore	31,422	62,629
Region 4.3	terpene	216,139	238,319	High	geosmin	terpene:Sesquiterpene
Region 4.4	RiPP-like	250,509	261,825
Region 4.5	NRPS-like,T1PKS,prodigiosin	416,839	469,638	High	undecylprodigiosin	NRPS:Type I+PKS
Region 4.6	NI-siderophore	536,846	566,606	Low	kinamycin	PKS
Region 5.1	thioamide-NRP,NRPS	54,454	108,626	Low	nogalamycin	PKS
Region 5.2	lanthipeptide-class-iii	382,697	405,393	High	SapB	ribosomal:RiPP:Lanthipeptide
Region 7.1	indole	117,993	139,120	High	5-dimethylallylindole-3-acetonitrile	other:other
Region 7.2	T3PKS,NRP-metallophore,NRPS,terpene	328,546	403,019	High	coelibactin	NRPS:Type I
Region 8.1	ectoine	73,881	84,279	High	ectoine	other:other
Region 9.1	T2PKS	71,647	144,189	Medium	spore pigment	PKS
Region 9.2	terpene-precursor	176,973	198,133
Region 9.3	terpene	207,153	228,238	High	albaflavenone	terpene
Region 9.4	T2PKS	331,713	388,943	High	actinorhodin	PKS:Type II aromatic
Region 12.1	NRPS	223,742	255,978	Low	CDA1b/CDA2a/CDA2b/CDA3a/CDA3b/CDA4a/CDA4b	NRPS:Type I
Region 14.1	lanthipeptide-class-i	151,834	172,123
Region 17.1	T3PKS	1	33,919	High	germicidin	other:other
Region 25.1	other	27,756	67,734
Region 28.1	terpene	14,488	41,238	High	hopene	terpene
Region 29.1	hydrogen-cyanide,T1PKS	16,903	53,561	Medium	coelimycin P1	PKS:Type I
Region 31.1	NRPS	1	34,716	Low	CDA1b/CDA2a/CDA2b/CDA3a/CDA3b/CDA4a/CDA4b	NRPS:Type I
Region 46.1	NRPS	1	6,474
Region 53.1	NRPS	1	2,907

No secondary metabolite regions were found in these records:: NZ_BMVQ01000003.1 (Streptomyces anthocyanicus); NZ_BMVQ01000006.1 (Streptomyces anthocyanicus); NZ_BMVQ01000010.1 (Streptomyces anthocyanicus); NZ_BMVQ01000011.1 (Streptomyces anthocyanicus); NZ_BMVQ01000013.1 (Streptomyces anthocyanicus); NZ_BMVQ01000015.1 (Streptomyces anthocyanicus); NZ_BMVQ01000016.1 (Streptomyces anthocyanicus); NZ_BMVQ01000018.1 (Streptomyces anthocyanicus); NZ_BMVQ01000019.1 (Streptomyces anthocyanicus); NZ_BMVQ01000020.1 (Streptomyces anthocyanicus); NZ_BMVQ01000021.1 (Streptomyces anthocyanicus); NZ_BMVQ01000022.1 (Streptomyces anthocyanicus); NZ_BMVQ01000023.1 (Streptomyces anthocyanicus); NZ_BMVQ01000024.1 (Streptomyces anthocyanicus); NZ_BMVQ01000026.1 (Streptomyces anthocyanicus); NZ_BMVQ01000027.1 (Streptomyces anthocyanicus); NZ_BMVQ01000030.1 (Streptomyces anthocyanicus); NZ_BMVQ01000032.1 (Streptomyces anthocyanicus); NZ_BMVQ01000033.1 (Streptomyces anthocyanicus); NZ_BMVQ01000034.1 (Streptomyces anthocyanicus); NZ_BMVQ01000035.1 (Streptomyces anthocyanicus); NZ_BMVQ01000036.1 (Streptomyces anthocyanicus); NZ_BMVQ01000037.1 (Streptomyces anthocyanicus); NZ_BMVQ01000038.1 (Streptomyces anthocyanicus); NZ_BMVQ01000039.1 (Streptomyces anthocyanicus); NZ_BMVQ01000040.1 (Streptomyces anthocyanicus); NZ_BMVQ01000041.1 (Streptomyces anthocyanicus); NZ_BMVQ01000042.1 (Streptomyces anthocyanicus); NZ_BMVQ01000043.1 (Streptomyces anthocyanicus); NZ_BMVQ01000044.1 (Streptomyces anthocyanicus); NZ_BMVQ01000045.1 (Streptomyces anthocyanicus); NZ_BMVQ01000047.1 (Streptomyces anthocyanicus); NZ_BMVQ01000048.1 (Streptomyces anthocyanicus); NZ_BMVQ01000049.1 (Streptomyces anthocyanicus); NZ_BMVQ01000050.1 (Streptomyces anthocyanicus); NZ_BMVQ01000051.1 (Streptomyces anthocyanicus); NZ_BMVQ01000052.1 (Streptomyces anthocyanicus); NZ_BMVQ01000054.1 (Streptomyces anthocyanicus); NZ_BMVQ01000055.1 (Streptomyces anthocyanicus); NZ_BMVQ01000056.1 (Streptomyces anthocyanicus); NZ_BMVQ01000057.1 (Streptomyces anthocyanicus); NZ_BMVQ01000058.1 (Streptomyces anthocyanicus); NZ_BMVQ01000059.1 (Streptomyces anthocyanicus); NZ_BMVQ01000060.1 (Streptomyces anthocyanicus); NZ_BMVQ01000061.1 (Streptomyces anthocyanicus); NZ_BMVQ01000062.1 (Streptomyces anthocyanicus); NZ_BMVQ01000063.1 (Streptomyces anthocyanicus); NZ_BMVQ01000064.1 (Streptomyces anthocyanicus); NZ_BMVQ01000065.1 (Streptomyces anthocyanicus)

Compact view

NZ_BMVQ01000001.1 - Region 1 - T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 15,043 - 68,019 nt. (total: 52,977 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE283_RS00115: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE283_RS00130: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE283_RS00225: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

IE283_RS00170: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

IE283_RS00175: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Lyases: dehydratase

IE283_RS00165: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

IE283_RS00180: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.56	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002154.2	0.53	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001160.5	0.52	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001268.4	0.51	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000861.5	0.42	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0002648.2	0.42	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000862.3	0.42	other (other)	eicosapentaenoic acid	Shewanella pneumatophori

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001268.4	0.59	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000861.5	0.54	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0002648.2	0.54	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000862.3	0.54	other (other)	eicosapentaenoic acid	Shewanella pneumatophori

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.54 out of 26.33

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.84 out of 20.97

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 27.18 out of 30.12

Confidence: medium

Additional weak hits (22):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.81 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.75 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.55 out of 32.74

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.71 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.29 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.57 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.18 out of 32.74

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.99 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.79 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.46 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.90 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.37 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.15 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.83 out of 29.65

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.42 out of 27.04

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.24 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.13 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 15042 - 68019:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE283_RS00175: mal

PKS_AT (592..888): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 80.3
Methoxymalonyl-CoA: 30.8
Methylmalonyl-CoA: 24.7
inactive: 23.2
Propionyl-CoA: 12.9
2-Methylbutyryl-CoA: 10.3
fatty_acid: 7.6
Isobutyryl-CoA: 1.8
CHC-CoA: 0.9
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -3.2

IE283_RS00180: mxmal

PKS_AT (968..1194): mxmal

ATSignature: (unknown)

No matches above 50%

minowa: Methoxymalonyl-CoA

Prediction, score:

Methoxymalonyl-CoA: 29.2
Methylmalonyl-CoA: 26.5
Malonyl-CoA: 22.1
Ethylmalonyl-CoA: 13.7
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
Propionyl-CoA: -0.2
2-Methylbutyryl-CoA: -4.3

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
OsdR	Development and stress management regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BMVQ01000001.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 101,373 - 129,610 nt. (total: 28,238 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE283_RS00495: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

IE283_RS00525: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

IE283_RS00560: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: methyltransferase

IE283_RS00515: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

IE283_RS00490: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.82	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.75	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.74	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.70	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.70	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.82	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.75	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.74	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.70	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.70	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

IE283_RS00490: PT_FPPS_like

Domain 1 (57 - 353): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

IE283_RS00500: PT_phytoene_like

Domain 1 (16 - 311): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

IE283_RS00520: Lycopene_cycl

Domain 1 (10 - 384): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 28.31 out of 30.12

Confidence: strong

Additional weak hits (3):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.70 out of 27.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.32 out of 20.01

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_BMVQ01000001.1 - Region 3 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 185,912 - 210,470 nt. (total: 24,559 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IE283_RS00845: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

IE283_RS00865: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

IE283_RS00930: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: acetyltransferase

IE283_RS00855: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

Hydrolases: hydrolase

IE283_RS00885: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase dehydratase

IE283_RS00895: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

IE283_RS00900: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Translocases: transporter

IE283_RS00915: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.56	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.55	ribosomal	penisin	Paenibacillus ehimensis
BGC0002316.2	0.50	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000541.5	0.48	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.48	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000560.5	0.47	ribosomal	subtilomycin	Bacillus subtilis
BGC0000506.4	0.46	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000559.4	0.46	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000544.4	0.45	ribosomal	planosporicin	Planomonospora alba

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.56	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.55	ribosomal	penisin	Paenibacillus ehimensis
BGC0002316.2	0.50	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000541.5	0.48	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.48	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000560.5	0.47	ribosomal	subtilomycin	Bacillus subtilis
BGC0000506.4	0.46	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000559.4	0.46	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000544.4	0.45	ribosomal	planosporicin	Planomonospora alba

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for IE283_RS00895

IE283_RS00890

Leader:

MRTEIVLSHEAPELDLDLDLRVSDLPEQA

Core:

ASFGEGTFTSPSSYAIGTRCPICC

Core with dehydrations:

ADhaFGEGDhbFDhbDhaPDhaDhaYAIGDhbRCysPICysCys

antiSMASH-DB 4.0 matches for IE283_RS00890

100.0%

NZ_BMVQ01000001.1and 4 others:

NZ_BMWI01000001.1 Lanthipeptides: IE253_RS05465_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS01285_lanthipeptideNZ_GG657756.1 Lanthipeptides: SSPG_RS36720_lanthipeptideNZ_LT629768.1 Lanthipeptides: BLU60_RS01655_lanthipeptide

Lanthipeptides: IE283_RS00890_lanthipeptide

1

ASFGEGTFTSPSSYAIGTRCPICC

24

ASFGEGTFTSPSSYAIGTRCPICC

1

ASFGEGTFTSPSSYAIGTRCPICC

24

95.8%

NZ_BEWD01000004.1:

Lanthipeptides: Sru02f_RS16280_lanthipeptide

1

ASFGEGTFTSPSSYAIGTRCPICC

24

A FGEGTFTSPSSYAIGTRCPICC

1

AQFGEGTFTSPSSYAIGTRCPICC

24

91.7%

NZ_BMUN01000001.1and 9 others:

NZ_CP012382.1 Lanthipeptides: SAM23877_RS36835_lanthipeptideNZ_CP012949.1 Lanthipeptides: SAM40697_RS33360_lanthipeptideNZ_CP027299.1 Lanthipeptides: C1N79_RS34825_lanthipeptideNZ_CP039123.1 Lanthipeptides: E5N77_RS35110_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33410_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33410_lanthipeptideNZ_JACWAA010000001.1 Lanthipeptides: ICA23_RS00945_lanthipeptideNZ_KZ195574.1 Lanthipeptides: B9W62_RS39030_lanthipeptideNZ_MQUH01000030.1 Lanthipeptides: BSZ07_RS37165_lanthipeptide

Lanthipeptides: IE238_RS00870_lanthipeptide

2

SFGEGTFTSPSSYAIGTRCPICC

24

SFG+GTFTSPSSYAIGTRCPICC

2

SFGQGTFTSPSSYAIGTRCPICC

24

with 16 more sequence matches

Only the first 10 are displayed here.

87.5%

NZ_CP054939.1and 2 others:

NZ_FKJH01000076.1 Lanthipeptides: STEPF7_RS31605_lanthipeptideNZ_GG657758.1 Lanthipeptides: SSRG_RS36710_lanthipeptide

Lanthipeptides: HUT14_RS33610_lanthipeptide

2

SFGEGTFTSPSSYAIGTRCPICC

24

SFG+GT+TSPSSYAIGTRCPICC

2

SFGQGTYTSPSSYAIGTRCPICC

24

83.3%

NZ_CP043959.1and 5 others:

NZ_CP104864.1 Lanthipeptides: N7E53_RS01070_lanthipeptideNZ_JMLN01000003.1 Lanthipeptides: BR33_RS35695_lanthipeptideNZ_KL503830.1 Lanthipeptides: DJ64_RS34550_lanthipeptideNZ_VIUV01000001.1 Lanthipeptides: FB570_RS00565_lanthipeptideNZ_WUUF01000042.1 Lanthipeptides: GSE51_RS09870_lanthipeptide

Lanthipeptides: F3L20_RS18420_lanthipeptide

2

SFGEGTFTSPSSYAIGTRCPICC

24

SFG+GT+TSPSSYAIGTRCP+CC

2

SFGQGTYTSPSSYAIGTRCPVCC

24

79.2%

NZ_KB891308.1and 2 others:

NZ_KZ819159.1 Lanthipeptides: DBP19_RS30055_lanthipeptideNZ_RCOL01000001.1 Lanthipeptides: STAN_RS32200_lanthipeptide

Lanthipeptides: B061_RS37915_lanthipeptide

3

FGEGTFTSPSSYAIGTRCPICC

24

FG GT+TSPSSYAIGTRCP+CC

2

FGAGTYTSPSSYAIGTRCPVCC

23

75.0%

NZ_CP058273.1:

Lanthipeptides: AY578_RS00390_lanthipeptide

4

GEGTFTSPSSYAIGTRCPICC

24

G+GT+TSPSSYAIGTRCP+CC

1

GQGTYTSPSSYAIGTRCPVCC

21

75.0%

NZ_NNBO01000011.1:

Lanthipeptides: CG736_RS24265_lanthipeptide

6

GTFTSPSSYAIGTRCPICC

24

GTFTSPSSYAIGTRCP+CC

1

GTFTSPSSYAIGTRCPVCC

19

70.8%

NZ_CP113837.1and 1 other:

NZ_LISX01000001.1 Lanthipeptides: AMK19_RS02530_lanthipeptide

Lanthipeptides: OU787_RS28205_lanthipeptide

6

GTFTSPSSYAIGTRCPICC

24

GT+TSPSSYAIGTRCP+CC

1

GTYTSPSSYAIGTRCPVCC

19

66.7%

NZ_KK853997.1:

Lanthipeptides: KCH_RS38645_lanthipeptide

9

TSPSSYAIGTRCPICC

24

TSPSSYAIGTRCPICC

1

TSPSSYAIGTRCPICC

16

62.5%

NZ_NNBP01000006.1:

Lanthipeptides: CG747_RS11965_lanthipeptide

9

TSPSSYAIGTRCPICC

24

TSPSSYAIGTRCP CC

1

TSPSSYAIGTRCPTCC

16

45.8%

NZ_CP050693.1:

Lanthipeptides: HC362_RS33495_lanthipeptide

3

FGEGTFTSPSSYAIGTRCPICC

24

F G +TSPS+Y G+ C +CC

1

FASGGYTSPSTY--GSPCNLCC

20

29.6%

NZ_BIFH01000040.1:

Lanthipeptides: EMA17_RS40630_lanthipeptide

4

GEGTFTSPSSYAIGTRCPICC

24

G SPS+ + +RC +CC

6

GASVTLSPSTRGVQSRCWVCC

26

MIBiG 4.0 matches for IE283_RS00890

20.8%

BGC0000503.5 (cinA):

Lanthipeptide: cinnamycin

2

SFGEGTFT

9

SFG TF

6

SFGPFTFV

13

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.84 out of 30.12

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

Additional weak hits (7):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.32 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.88 out of 33.14

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.04 out of 30.11

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

IE283_RS00890 - Class I

Cleavage pHMM score: -8.70

RODEO score: 18

Monoisotopic mass: 2328.1 Da

Molecular weight: 2329.6 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2347.6 Da N = 1; 2365.6 Da N = 2; 2383.7 Da N = 3; 2401.7 Da N = 4

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 158 - 241; Score: 72.8

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
OsdR	Development and stress management regulator

NZ_BMVQ01000001.1 - Region 4 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 430,936 - 489,278 nt. (total: 58,343 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE283_RS02015: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

IE283_RS02080: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: formyltransferase kinase

IE283_RS02020: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

IE283_RS02070: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: esterase phosphatase

IE283_RS01915: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

IE283_RS01975: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

Ligases: ligase

IE283_RS01985: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000325.5	1.58	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0000357.5	0.69	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.58	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.58	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.57	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.57	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000325.5	0.93	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 26.21 out of 28.19

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 35.53 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.30 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 36.53

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 27.18 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (34):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.69 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.74 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.48 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.43 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.77 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.43 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.80 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.48 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 25.75

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.88 out of 19.26

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.05 out of 27.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.77 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.07 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.78 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.93 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.02 out of 31.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 39.62

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.18 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.89 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.75 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.02 out of 27.04

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.39 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.24 out of 36.53

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.39 out of 36.53

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.72 out of 30.98

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.74 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.81 out of 29.65

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.62 out of 26.12

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.07 out of 26.85

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.81 out of 39.62

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 430935 - 489278:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn - D-Thr - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE283_RS01985: Fo-OH-Orn - Thr - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (142..540): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISINELYLWCGGEYHGYGPAETTIGVSH
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1627..2041): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTHFDFAVWEGNQIFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3062..3464): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DmdR1	Iron(II)-dependent repressor
NtrC	Nitrogen regulatory protein C
OsdR	Development and stress management regulator
ZuR variant 1	Zinc-responsive repressor

NZ_BMVQ01000001.1 - Region 5 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 534,808 - 557,343 nt. (total: 22,536 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase

IE283_RS02380: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Ligases: synthetase

IE283_RS02350: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

IE283_RS02360: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.43	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.39	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001456.3	0.38	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000644.3	0.37	terpene	carotenoid	Dietzia sp. CQ4
BGC0001227.3	0.37	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.37	terpene	carotenoid	Streptomyces avermitilis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.43	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.39	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001456.3	0.38	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000644.3	0.37	terpene	carotenoid	Dietzia sp. CQ4
BGC0001227.3	0.37	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.37	terpene	carotenoid	Streptomyces avermitilis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IE283_RS02350: PT_FPPS_like

Domain 1 (49 - 351): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

IE283_RS02360: PT_FPPS_like

Domain 1 (49 - 334): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.29 out of 23.79

Confidence: medium

Additional weak hits (3):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.29 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.37 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVQ01000001.1 - Region 6 - RiPP-like

Download region GenBank file

Download region SVG

Location: 727,456 - 737,671 nt. (total: 10,216 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.47	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0000484.5	0.39	ribosomal	glycocin F	Lactobacillus plantarum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.47	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0000484.5	0.39	ribosomal	glycocin F	Lactobacillus plantarum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

NZ_BMVQ01000001.1 - Region 7 - T3PKS

Download region GenBank file

Download region SVG

Location: 1,190,186 - 1,231,388 nt. (total: 41,203 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase reductase

IE283_RS05450: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE283_RS05455: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE283_RS05460: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE283_RS05470: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

IE283_RS05485: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

IE283_RS05500: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE283_RS05510: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase

IE283_RS05580: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: deformylase

IE283_RS05520: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: synthase

IE283_RS05495: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.99	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.75	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.64	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001310.5	0.63	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001948.3	0.55	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001078.5	0.47	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988
BGC0000281.3	0.47	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.99	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.75	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.64	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001310.5	0.63	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001948.3	0.55	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001078.5	0.47	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988
BGC0000281.3	0.47	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.56 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.19 out of 30.11

Confidence: medium

Additional weak hits (12):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.37 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.13 out of 21.55

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 30.11

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.12 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.03 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.63 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.66 out of 29.38

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.03 out of 27.04

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.35 out of 27.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.65 out of 23.43

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.53 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVQ01000002.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 251,523 - 281,307 nt. (total: 29,785 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE283_RS07610: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

IE283_RS07630: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE283_RS07655: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: carboxylase transferase

IE283_RS07640: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

IE283_RS07645: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Lyases: decarboxylase

IE283_RS07615: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase

IE283_RS07635: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Translocases: transporter

IE283_RS07545: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000940.5	0.98	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.63	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002073.3	0.60	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000940.5	0.98	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.63	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002073.3	0.60	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.62 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 36.53 out of 36.53

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 26.66 out of 30.11

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.26 out of 23.43

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.94 out of 36.53

Confidence: medium

Additional weak hits (7):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.89 out of 32.74

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.83 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.00 out of 21.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.16 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.16 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVQ01000002.1 - Region 2 - melanin

Download region GenBank file

Download region SVG

Location: 354,795 - 365,364 nt. (total: 10,570 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE283_RS08035: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Transferases: glycosyltransferase

IE283_RS07990: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.92	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.68	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.42	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.41	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001959.4	0.36	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0001972.4	0.36	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000889.5	0.36	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.92	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.68	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.42	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.41	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001959.4	0.36	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0001972.4	0.36	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000889.5	0.36	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMVQ01000004.1 - Region 1 - butyrolactone

Download region GenBank file

Download region SVG

Location: 1 - 7,948 nt. (total: 7,948 nt) Show pHMM detection rules used

Region on contig edge.

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE283_RS12870: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	1.00	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.82	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.69	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.40	other (other)	bacilysin	Bacillus sp. CS93
BGC0002578.2	0.38	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000866.5	0.36	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002436.2	0.36	other (other)	coformycin	Streptomyces citricolor
BGC0001184.4	0.35	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002496.3	0.34	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	1.00	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.82	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.69	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.40	other (other)	bacilysin	Bacillus sp. CS93
BGC0002578.2	0.38	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000866.5	0.36	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002436.2	0.36	other (other)	coformycin	Streptomyces citricolor
BGC0001184.4	0.35	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002496.3	0.34	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

Additional weak hits (5):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.50 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.92 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.81 out of 29.65

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.20 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVQ01000004.1 - Region 2 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 31,422 - 62,629 nt. (total: 31,208 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

IE283_RS13085: aminotransferase

smcogs: SMCOG1019: aminotransferase

Translocases: transporter

IE283_RS13040: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000295.5	0.47	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002692.2	0.46	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002471.3	0.44	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000897.5	0.40	other (other)	dehydrophos	Streptomyces luridus
BGC0000285.5	0.40	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001868.4	0.40	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0000947.5	0.39	other (other)	vibrioferrin	Vibrio alginolyticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000295.5	0.47	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002692.2	0.46	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002471.3	0.44	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000897.5	0.40	other (other)	dehydrophos	Streptomyces luridus
BGC0000285.5	0.40	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001868.4	0.40	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0000947.5	0.39	other (other)	vibrioferrin	Vibrio alginolyticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.49 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

Additional weak hits (7):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.67 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.11 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.42 out of 26.85

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVQ01000004.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 216,139 - 238,319 nt. (total: 22,181 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucanase peptidase

IE283_RS13795: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

IE283_RS13805: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: cyclase

IE283_RS13820: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.97	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000849.4	0.46	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001197.5	0.45	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000850.5	0.41	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001285.5	0.37	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0000937.5	0.35	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001840.2	0.34	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.97	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000849.4	0.46	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001197.5	0.45	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000850.5	0.41	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001285.5	0.37	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0000937.5	0.35	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001840.2	0.34	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

IE283_RS13820: T1TS + T1TS

Domain 1 (1 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (327 - 695): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.84 out of 30.12

Confidence: medium

Additional weak hits (11):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.14 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.43 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.42 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.79 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.61 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.73 out of 26.85

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.22 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.45 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.15 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.22 out of 30.98

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVQ01000004.1 - Region 4 - RiPP-like

Download region GenBank file

Download region SVG

Location: 250,509 - 261,825 nt. (total: 11,317 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE283_RS13980: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: deacetylase

IE283_RS13935: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000306.5	0.34	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0000541.5	0.33	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0002303.3	0.33	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0000351.5	0.33	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0000498.5	0.32	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.32	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0002663.2	0.32	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0002387.2	0.32	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001928.2	0.31	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000565.5	0.31	ribosomal	goadsporin	Streptomyces sp. TP-A0584

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000306.5	0.34	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0000541.5	0.33	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0002303.3	0.33	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0000351.5	0.33	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0000498.5	0.32	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.32	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0002663.2	0.32	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0002387.2	0.32	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001928.2	0.31	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000565.5	0.31	ribosomal	goadsporin	Streptomyces sp. TP-A0584

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.56 out of 20.47

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 27.49 out of 30.12

Confidence: strong

Additional weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.62 out of 30.22

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.16 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.09 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.84 out of 21.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.58 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.83 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVQ01000004.1 - Region 5 - NRPS-like,T1PKS,prodigiosin

Download region GenBank file

Download region SVG

Location: 416,839 - 469,638 nt. (total: 52,800 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
prodigiosin: (PPDK_N and AMP-binding and PP-binding and PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE283_RS14770: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase acyltransferase methyltransferase

IE283_RS14670: acyltransferase

smcogs: SMCOG1141: acyltransferase

IE283_RS14690: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE283_RS14750: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase

IE283_RS14695: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

IE283_RS14700: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

IE283_RS14705: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE283_RS14710: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE283_RS14715: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

IE283_RS14725: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IE283_RS14735: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE283_RS14775: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: permease transport

IE283_RS14640: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

IE283_RS14665: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001063.5	2.77	NRPS, PKS	undecylprodigiosin	Streptomyces coelicolor A3(2)
BGC0000091.5	1.27	PKS	marineosin A, marineosin B	Streptomyces sp. CNQ-617
BGC0002090.3	1.17	NRPS, PKS	undecylprodigiosin, metacycloprodigiosin	Streptomyces griseoaurantiacus
BGC0001164.3	1.12	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	1.12	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001641.4	0.92	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001273.3	0.92	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.91	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.90	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.90	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001063.5	0.97	NRPS, PKS	undecylprodigiosin	Streptomyces coelicolor A3(2)
BGC0000091.5	0.74	PKS	marineosin A, marineosin B	Streptomyces sp. CNQ-617
BGC0002090.3	0.71	NRPS, PKS	undecylprodigiosin, metacycloprodigiosin	Streptomyces griseoaurantiacus
BGC0001164.3	0.70	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.70	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.96 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.79 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.04 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.59 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.65 out of 23.43

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 416838 - 469638:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2 - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE283_RS14705: NH2 - mal

CAL_domain (51..499): NH2

minowa: NH2

Prediction, score:

NH2: 118.5
fatty_acid: 37.5
AHBA: 6.5
shikimic_acid: 0.0
Acetyl-CoA: -1.6

PKS_AT (1307..1611): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 154.0
inactive: 97.4
Methoxymalonyl-CoA: 77.4
Methylmalonyl-CoA: 71.9
Ethylmalonyl-CoA: 44.1
Propionyl-CoA: 36.9
Isobutyryl-CoA: 31.3
2-Methylbutyryl-CoA: 26.1
Benzoyl-CoA: 25.3
CHC-CoA: 24.8
Acetyl-CoA: 13.9
trans-1,2-CPDA: 13.7
3-Methylbutyryl-CoA: 12.5
fatty_acid: 9.7

IE283_RS14710: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (16..427): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWAAFDLSTFDTYSLFAGEYNLYGPTETNVCTYH
Nearest Stachelhaus code(s):: Pro DLFYLALVCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_BMVQ01000004.1 - Region 6 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 536,846 - 566,606 nt. (total: 29,761 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE283_RS15135: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

IE283_RS15175: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

IE283_RS15130: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002692.2	0.51	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002633.2	0.49	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002683.2	0.49	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002470.2	0.48	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000853.3	0.45	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.45	other (ectoine)	ectoine	Streptomyces sp.
BGC0000919.5	0.43	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0000841.5	0.42	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate, clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0001713.5	0.42	other (other)	ochrobactin	Ochrobactrum anthropi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002692.2	0.51	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002633.2	0.49	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002683.2	0.49	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002470.2	0.48	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000853.3	0.45	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.45	other (ectoine)	ectoine	Streptomyces sp.
BGC0000919.5	0.43	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0000841.5	0.42	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate, clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0001713.5	0.42	other (other)	ochrobactin	Ochrobactrum anthropi

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.37 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.70 out of 20.97

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 25.90 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 26.06 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.14 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

Additional weak hits (8):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.25 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.71 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.47 out of 30.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.35 out of 27.04

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.93 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NZ_BMVQ01000005.1 - Region 1 - NRPS,thioamide-NRP

Download region GenBank file

Download region SVG

Location: 54,454 - 108,626 nt. (total: 54,173 nt) Show pHMM detection rules used

thioamide-NRP: (ATP-grasp and AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE283_RS15785: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

IE283_RS15820: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

IE283_RS15825: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

IE283_RS15860: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: peptidase phosphatase

IE283_RS15835: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

IE283_RS15840: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Lyases: decarboxylase lyase

IE283_RS15800: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

IE283_RS15805: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase

IE283_RS15770: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE283_RS15775: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.41 out of 23.79

Confidence: medium

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 28.65 out of 30.98

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.71 out of 36.53

Confidence: medium

Additional weak hits (9):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.34 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.01 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.37 out of 29.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.99 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.53 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.62 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.95 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 54453 - 108626:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE283_RS15770: X

AMP-binding (9..399): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GWLTITNLVREWMVFCSSDFNVYGLTEA-LYSTY
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

IE283_RS15775: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (551..953): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDMSFDLSAFDGNTLLSGDVALGGATEASIWSNY
Nearest Stachelhaus code(s):: Cys DLFNLSLIWK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
NuR	Nickel-responsive regulator

NZ_BMVQ01000005.1 - Region 2 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 382,697 - 405,393 nt. (total: 22,697 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase

IE283_RS16990: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.96	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.68	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.59	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.55	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000563.4	0.52	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.96	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.68	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.59	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.55	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000563.4	0.52	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for IE283_RS17030

IE283_RS17035

Leader:

MNLFDLQSMETPKEEAMGDVE

Core:

TGSRASLLLCGDSSLSITTCN

Core with dehydrations:

DhbGDhaRADhaLLLCysGDDhaDhaLDhaIDhbDhbCysN

antiSMASH-DB 4.0 matches for IE283_RS17035

100.0%

NZ_BBOK01000011.1and 23 others:

NZ_BEWD01000001.1 Lanthipeptides: Sru02f_RS01660_lanthipeptideNZ_BMSL01000016.1 Lanthipeptides: IE215_RS23330_lanthipeptideNZ_BMUC01000023.1 Lanthipeptides: IE172_RS32210_lanthipeptideNZ_BMVQ01000005.1 Lanthipeptides: IE283_RS17035_lanthipeptideNZ_BMWI01000025.1 Lanthipeptides: IE253_RS33945_lanthipeptideNZ_CP012382.1 Lanthipeptides: SAM23877_RS30085_lanthipeptideNZ_CP012949.1 Lanthipeptides: SAM40697_RS29010_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS34495_lanthipeptideNZ_CP043959.1 Lanthipeptides: F3L20_RS19105_lanthipeptideNZ_CP045547.1 Lanthipeptides: GEV49_RS05730_lanthipeptideNZ_CP054939.1 Lanthipeptides: HUT14_RS29815_lanthipeptideNZ_CP094918.1 Lanthipeptides: MTR79_RS16715_lanthipeptideNZ_GG657756.1 Lanthipeptides: SSPG_RS05020_lanthipeptideNZ_JAAIFS010000001.1 Lanthipeptides: GUR47_RS02255_lanthipeptideNZ_KZ195574.1 Lanthipeptides: B9W62_RS05695_lanthipeptideNZ_LT629768.1 Lanthipeptides: BLU60_RS34110_lanthipeptideNZ_MQUH01000025.1 Lanthipeptides: BSZ07_RS33280_lanthipeptideNZ_RAII01000001.1 Lanthipeptides: EBH12_RS10360_lanthipeptideNZ_RSEG01000006.1 Lanthipeptides: EIA57_RS12710_lanthipeptideNZ_SOAV01000001.1 Lanthipeptides: EV562_RS04520_lanthipeptideNZ_VIUV01000020.1 Lanthipeptides: FB570_RS34060_lanthipeptideNZ_WHZR01000001.1 Lanthipeptides: STPH1_RS04005_lanthipeptideNZ_WXVT01000001.1 Lanthipeptides: STPH2_RS03995_lanthipeptide

Lanthipeptides: APK71_RS25550_lanthipeptide

1

TGSRASLLLCGDSSLSITTCN

21

TGSRASLLLCGDSSLSITTCN

1

TGSRASLLLCGDSSLSITTCN

21

95.2%

NC_018750.1and 67 others:

NC_018750.1 Lanthipeptides: SVEN_RS32110_lanthipeptideNZ_BBNO01000003.1 Lanthipeptides: TU31_RS37940_lanthipeptideNZ_BMTO01000007.1 Lanthipeptides: IE136_RS15615_lanthipeptideNZ_BMUN01000001.1 Lanthipeptides: IE238_RS00740_lanthipeptideNZ_CP009754.1 Lanthipeptides: NI25_RS05015_lanthipeptideNZ_CP015866.1 Lanthipeptides: Spa2297_RS27800_lanthipeptideNZ_CP017157.1 Lanthipeptides: SL103_RS15895_lanthipeptideNZ_CP019457.1 Lanthipeptides: BXT88_RS03410_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS35355_lanthipeptideNZ_CP019779.1 Lanthipeptides: STRMOE7_RS03775_lanthipeptideNZ_CP023691.1 Lanthipeptides: CP981_RS03050_lanthipeptideNZ_CP023700.1 Lanthipeptides: CP969_RS04700_lanthipeptideNZ_CP027299.1 Lanthipeptides: C1N79_RS34970_lanthipeptideNZ_CP029042.1 Lanthipeptides: DDE74_RS03525_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029541.1 Lanthipeptides: DKG71_RS05245_lanthipeptideNZ_CP034353.1 Lanthipeptides: D1J63_RS04900_lanthipeptideNZ_CP039123.1 Lanthipeptides: E5N77_RS35250_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS09720_lanthipeptideNZ_CP046905.1 Lanthipeptides: GPZ77_RS32930_lanthipeptideNZ_CP047140.1 Lanthipeptides: GLX30_RS11420_lanthipeptideNZ_CP050976.1 Lanthipeptides: HEP86_RS04470_lanthipeptideNZ_CP054920.1 Lanthipeptides: HUT15_RS04615_lanthipeptideNZ_CP060825.1 Lanthipeptides: IAG43_RS32355_lanthipeptideNZ_CP074111.1 Lanthipeptides: KE639_RS31630_lanthipeptideNZ_CP084681.1 Lanthipeptides: KI385_RS00885_lanthipeptideNZ_CP085300.1 Lanthipeptides: LJA35_RS05220_lanthipeptideNZ_CP086217.1 Lanthipeptides: LJ741_RS03435_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS09690_lanthipeptideNZ_CP098437.1 Lanthipeptides: NCG97_RS34740_lanthipeptideNZ_CP099468.1 Lanthipeptides: NFX46_RS16770_lanthipeptideNZ_CP101137.1 Lanthipeptides: M6G08_RS24535_lanthipeptideNZ_CP102609.1 Lanthipeptides: NUT86_RS03980_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33560_lanthipeptideNZ_CP114202.1 Lanthipeptides: STRLI_RS35870_lanthipeptideNZ_CP114203.1 Lanthipeptides: STRNI_RS37360_lanthipeptideNZ_CP114205.1 Lanthipeptides: STRTU_RS33380_lanthipeptideNZ_JACHJE010000006.1 Lanthipeptides: FHS32_RS15850_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACWAA010000001.1 Lanthipeptides: ICA23_RS00800_lanthipeptideNZ_JAFEJA010000002.1 Lanthipeptides: JE024_RS34830_lanthipeptideNZ_JAGPYC010000033.1 Lanthipeptides: KBZ00_RS31440_lanthipeptideNZ_JAHLXF010000022.1 Lanthipeptides: KQY13_RS30555_lanthipeptideNZ_JAIHBQ010000001.1 Lanthipeptides: K4902_RS04515_lanthipeptideNZ_JAJJMU010000026.1 Lanthipeptides: LOC25_RS31275_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAPKNL010000004.1 Lanthipeptides: OSI21_RS07750_lanthipeptideNZ_JH993790.1 Lanthipeptides: STRVIR_RS0131905_lanthipeptideNZ_KN039948.1 Lanthipeptides: FM21_RS29525_lanthipeptideNZ_LIPF01000004.1 Lanthipeptides: AMK11_RS16660_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVX01000004.1 Lanthipeptides: AMK29_RS15650_lanthipeptideNZ_LIWB01000010.1 Lanthipeptides: AMK33_RS24360_lanthipeptideNZ_MPOH02000012.1 Lanthipeptides: BM536_RS17150_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_RAIF01000032.1 Lanthipeptides: EBH09_RS35480_lanthipeptideNZ_SOPG01000008.1 Lanthipeptides: E0I08_RS17090_lanthipeptide

Lanthipeptides: SVEN_RS32110_lanthipeptide

1

TGSRASLLLCGDSSLSITTCN

21

TGSRASLLLCGDSSLS+TTCN

1

TGSRASLLLCGDSSLSVTTCN

21

95.2%

NZ_GG657758.1and 1 other:

NZ_JACHEM010000005.1 Lanthipeptides: HNQ79_RS11445_lanthipeptide

Lanthipeptides: SSRG_RS03855_lanthipeptide

1

TGSRASLLLCGDSSLSITTCN

21

+GSRASLLLCGDSSLSITTCN

1

SGSRASLLLCGDSSLSITTCN

21

with 71 more sequence matches

Only the first 10 are displayed here.

90.5%

NZ_BMSV01000002.1and 18 others:

NZ_BMTP01000009.1 Lanthipeptides: IE109_RS18470_lanthipeptideNZ_CP007699.2 Lanthipeptides: T261_RS39185_lanthipeptideNZ_CP020042.1 Lanthipeptides: B4U46_RS32710_lanthipeptideNZ_CP023202.1 Lanthipeptides: SXIN_RS23100_lanthipeptideNZ_CP023692.1 Lanthipeptides: CP980_RS04735_lanthipeptideNZ_CP028158.1 Lanthipeptides: C6361_RS04660_lanthipeptideNZ_CP028159.1 Lanthipeptides: C6W10_RS01185_lanthipeptideNZ_CP034279.1 Lanthipeptides: EIZ62_RS28660_lanthipeptideNZ_CP102332.1 Lanthipeptides: NRO40_RS01140_lanthipeptideNZ_FNHI01000003.1 Lanthipeptides: BLT82_RS06465_lanthipeptideNZ_JADMLH010000003.1 Lanthipeptides: IT780_RS09875_lanthipeptideNZ_JAGGOI010000031.1 Lanthipeptides: J7E87_RS22160_lanthipeptideNZ_JAGPXX010000007.1 Lanthipeptides: KBZ10_RS10785_lanthipeptideNZ_JAPNLM010000003.1 Lanthipeptides: OTB16_RS07305_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIYH01000004.1 Lanthipeptides: AMK26_RS17765_lanthipeptideNZ_NBCN01000003.1 Lanthipeptides: BKD26_RS06570_lanthipeptide

Lanthipeptides: IE106_RS06150_lanthipeptide

2

GSRASLLLCGDSSLSITTCN

21

GSRASLLLCGDSSLS+TTCN

1

GSRASLLLCGDSSLSVTTCN

20

90.5%

NZ_BMTU01000009.1and 1 other:

NZ_JACHJI010000005.1 Lanthipeptides: FHS37_RS15430_lanthipeptide

Lanthipeptides: IE118_RS22890_lanthipeptide

1

TGSRASLLLCGDSSLSITTCN

21

+GSRASLLLCGDSSLS+TTCN

1

SGSRASLLLCGDSSLSVTTCN

21

90.5%

NZ_BNCA01000002.1and 1 other:

NZ_CP049782.1 Lanthipeptides: G7Z12_RS34445_lanthipeptide

Lanthipeptides: IE314_RS02760_lanthipeptide

1

TGSRASLLLCGDSSLSITTCN

21

TGSRASLLLCGDSSLS++TCN

1

TGSRASLLLCGDSSLSVSTCN

21

85.7%

NZ_CP036455.1:

Lanthipeptides: EKD16_RS17975_lanthipeptide

2

GSRASLLLCGDSSLSITTCN

21

GS ASLLLCGDSSLS+TTCN

2

GSEASLLLCGDSSLSLTTCN

21

85.7%

NZ_CP048835.1:

Lanthipeptides: C8250_RS00390_lanthipeptide

2

GSRASLLLCGDSSLSITTCN

21

GSRASLLLCG+SSLS+TTCN

2

GSRASLLLCGNSSLSVTTCN

21

85.7%

NZ_QGGR01000008.1:

Lanthipeptides: BC793_RS19230_lanthipeptide

2

GSRASLLLCGDSSLSITTCN

21

GS+ASLLLCGDSSLS+TTCN

2

GSQASLLLCGDSSLSVTTCN

21

83.3%

NZ_BMVE01000003.1and 22 others:

NZ_BMVL01000005.1 Lanthipeptides: IE257_RS16230_lanthipeptideNZ_CM002280.1 Lanthipeptides: M877_RS44575_lanthipeptideNZ_CP011664.1 Lanthipeptides: M444_RS30240_lanthipeptideNZ_CP018047.1 Lanthipeptides: BBN63_RS03065_lanthipeptideNZ_CP020039.1 Lanthipeptides: B4U39_RS34445_lanthipeptideNZ_CP020555.1 Lanthipeptides: B6R96_RS03515_lanthipeptideNZ_CP023701.1 Lanthipeptides: CP968_RS29065_lanthipeptideNZ_CP029189.1 Lanthipeptides: DEJ51_RS31910_lanthipeptideNZ_CP030286.1 Lanthipeptides: DRB89_RS16930_lanthipeptideNZ_CP033581.1 Lanthipeptides: EES41_RS31595_lanthipeptideNZ_CP034350.1 Lanthipeptides: D1J60_RS32970_lanthipeptideNZ_CP043638.1 Lanthipeptides: F1D59_RS34930_lanthipeptideNZ_CP048397.1 Lanthipeptides: SSPS47_RS31455_lanthipeptideNZ_CP115936.1 Lanthipeptides: PET44_RS28650_lanthipeptideNZ_CP116355.1 Lanthipeptides: KPP03845_RS32700_lanthipeptideNZ_JAFLQY010000003.1 Lanthipeptides: J0X20_RS29030_lanthipeptideNZ_JAINUL010000001.1 Lanthipeptides: K7B10_RS06210_lanthipeptideNZ_JANAVF010000017.1 Lanthipeptides: NLX94_RS31205_lanthipeptideNZ_LIVP01000027.1 Lanthipeptides: AMK15_RS28680_lanthipeptideNZ_LWLD01000038.1 Lanthipeptides: A6A28_RS28600_lanthipeptideNZ_ML123038.1 Lanthipeptides: EES37_RS30340_lanthipeptideNZ_NNBM01000002.1 Lanthipeptides: CG724_RS07855_lanthipeptide

Lanthipeptides: IE248_RS10435_lanthipeptide

2

GSRASLLLCGDSSLSITTCN

21

GSRASLLLCGDSSLSITTCN

5

GSRASLLLCGDSSLSITTCN

24

81.0%

NZ_CP024087.1and 1 other:

NZ_JAAALO010000001.1 Lanthipeptides: GVV04_RS02250_lanthipeptide

Lanthipeptides: CSH63_RS05810_lanthipeptide

5

ASLLLCGDSSLSITTCN

21

ASLLLCGDSSLSITTCN

1

ASLLLCGDSSLSITTCN

17

81.0%

NZ_CP077658.1:

Lanthipeptides: KQY30_RS33045_lanthipeptide

2

GSRASLLLCGDSSLSITTCN

21

SRASLLLCGDSSLS+ TCN

1

ASRASLLLCGDSSLSVVTCN

20

81.0%

NZ_CP092183.1:

Lanthipeptides: COUCH_RS09775_lanthipeptide

4

RASLLLCGDSSLSITTCN

21

RASLLLCGDSSLS+TTCN

1

RASLLLCGDSSLSVTTCN

18

MIBiG 4.0 matches for IE283_RS17035

54.5%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

1

TGSRASLLLCGDSSLSITTCN

21

TGS+ SLL+C SSLS+ C

1

TGSQVSLLVCEYSSLSVVLCT

21

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (9):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.40 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.07 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.66 out of 21.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.31 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.41 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.96 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.47 out of 24.78

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

IE283_RS17035 - Class III

Cleavage pHMM score: 32.20

RODEO score: 0

Monoisotopic mass: 1954.0 Da

Molecular weight: 1955.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1973.2 Da N = 1; 1991.2 Da N = 2; 2009.2 Da N = 3; 2027.3 Da N = 4; 2045.3 Da N = 5; 2063.3 Da N = 6

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_BMVQ01000007.1 - Region 1 - indole

Download region GenBank file

Download region SVG

Location: 117,993 - 139,120 nt. (total: 21,128 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

IE283_RS19910: isochorismatase

smcogs: SMCOG1027: isochorismatase

Ligases: ligase

IE283_RS19980: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002128.3	0.96	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001294.5	0.47	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001483.4	0.44	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001840.2	0.41	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001887.3	0.38	ribosomal	huazacin	Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
BGC0002701.2	0.38	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0002710.2	0.38	NRPS	metachelin C, metachelin A, metachelin A-CE, metachelin B, dimerumic acid 11-mannoside, dimerumic acid	Metarhizium robertsii ARSEF 23
BGC0001592.5	0.37	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002128.3	0.96	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001294.5	0.47	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001483.4	0.44	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001840.2	0.41	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001887.3	0.38	ribosomal	huazacin	Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
BGC0002701.2	0.38	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0002710.2	0.38	NRPS	metachelin C, metachelin A, metachelin A-CE, metachelin B, dimerumic acid 11-mannoside, dimerumic acid	Metarhizium robertsii ARSEF 23
BGC0001592.5	0.37	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.75 out of 23.05

Confidence: medium

Additional weak hits (14):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.55 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.48 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.43 out of 35.63

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.25 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.89 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.52 out of 29.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.13 out of 32.74

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.86 out of 27.18

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.71 out of 26.85

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.77 out of 24.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.74 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_BMVQ01000007.1 - Region 2 - NRP-metallophore,NRPS,T3PKS,terpene

Download region GenBank file

Download region SVG

Location: 328,546 - 403,019 nt. (total: 74,474 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase synthase

IE283_RS20895: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

IE283_RS20900: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

IE283_RS20955: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE283_RS20965: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

IE283_RS20975: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

IE283_RS20990: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

IE283_RS21075: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE283_RS21105: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

IE283_RS20995: Methylation

MITE: MITE0000155Methylation (identity: 68.70%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

IE283_RS21145: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase synthase

IE283_RS20965: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

IE283_RS21080: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase

IE283_RS21140: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Isomerases: isomerase

IE283_RS21100: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

IE283_RS21000: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

IE283_RS21050: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE283_RS21055: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000324.5	2.10	NRPS	coelibactin	Streptomyces coelicolor A3(2)
BGC0000282.3	1.65	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000658.3	1.56	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	1.27	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0001833.4	0.88	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.88	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.88	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.88	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.88	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.88	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000324.5	0.95	NRPS	coelibactin	Streptomyces coelicolor A3(2)
BGC0000658.3	0.85	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000282.3	0.81	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

IE283_RS21140: T1TS

Domain 1 (1 - 434): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.15 out of 23.79

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.21 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.69 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.49 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (29):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.12 out of 29.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.23 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.16 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.70 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.43 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.09 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.36 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.23 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.76 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.54 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.96 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.10 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.73 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.51 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.03 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.00 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.16 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.57 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.83 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.04 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.26 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.75 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.75 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.12 out of 27.04

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 328545 - 403019:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - Cys) + (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 328545 - 369748:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - Cys) + (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 339690 - 403019:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - Cys) + (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE283_RS21050: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..456): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NACLFAFACPGGSLQVGGAQQVFGMAEGLINLTR
Nearest Stachelhaus code(s):: Sal ALPSQGVLNK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

IE283_RS21055: Thr - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (571..966): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: arg (Arg)
Single AA prediction:: arg (Arg)

Stachelhaus prediction details:

Stachelhaus sequence:: TAMSFDLATWDTQCLLGGDVALGGMTEAAVHSTV
Nearest Stachelhaus code(s):: Thr DLWQLGLVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1632..2028): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNTLVSGDVAMGGATEAAIWSNT
Nearest Stachelhaus code(s):: Cys DLYNLSMIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

IE283_RS21060: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (544..942): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDIAFDLSVYDGNSLISGDVSLGGATEGSIWSIA
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_BMVQ01000008.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 73,881 - 84,279 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

IE283_RS21710: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

IE283_RS21720: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

IE283_RS21735: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.84	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.84	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (5):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.99 out of 28.14

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.76 out of 25.88

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_BMVQ01000009.1 - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 71,647 - 144,189 nt. (total: 72,543 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE283_RS23755: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IE283_RS23890: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

IE283_RS23905: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: cyclase decarboxylase

IE283_RS23715: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

IE283_RS23785: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

IE283_RS23790: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Ligases: synthase

IE283_RS23705: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

IE283_RS23770: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE283_RS23775: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.74	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.70	PKS	spore pigment	Streptomyces avermitilis
BGC0000215.5	0.69	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.59	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.59	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000883.5	0.57	other (other)	arginomycin	Streptomyces arginensis
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0000275.4	0.54	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001366.5	0.53	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.74	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.70	PKS	spore pigment	Streptomyces avermitilis
BGC0000215.5	0.69	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.59	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.59	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000883.5	0.57	other (other)	arginomycin	Streptomyces arginensis
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0000275.4	0.54	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001366.5	0.53	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

Additional weak hits (14):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.36 out of 26.85

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.34 out of 30.22

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.05 out of 30.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.16 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.94 out of 27.78

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.84 out of 32.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.14 out of 21.84

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.93 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.90 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.47 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.29 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.79 out of 35.63

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 71646 to 144189
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

IE283_RS23675: MET (Score: 24.6; E-value: 2.7e-08)
IE283_RS23755: OXY (Score: 243.9; E-value: 8.1e-75)
IE283_RS23765: CYC C5-C18 (Score: 218.4; E-value: 5.6e-68)
IE283_RS23770: KS (Score: 712.5; E-value: 3.7e-217)
IE283_RS23775: CLF (Score: 554.5; E-value: 3.1e-169)
IE283_RS23780: ACP (Score: 73.9; E-value: 1.8e-23)
IE283_RS23785: CYC C9-C14 (Score: 250.4; E-value: 1.1e-77)
IE283_RS23790: CYC C4-C21/C2-C23|C2-C19 (Score: 155.3; E-value: 1e-48)
IE283_RS23890: KR (Score: 115.7; E-value: 6.5e-36)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BMVQ01000009.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 176,973 - 198,133 nt. (total: 21,161 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

IE283_RS24105: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

IE283_RS24140: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000948.5	0.44	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001605.3	0.38	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000664.5	0.37	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000948.5	0.44	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001605.3	0.38	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000664.5	0.37	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IE283_RS24140: PT_FPPS_like

Domain 1 (95 - 384): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.09 out of 23.43

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.36 out of 25.31

Confidence: medium

Additional weak hits (11):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.37 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.50 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.74 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.94 out of 29.65

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.47 out of 32.38

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.81 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.89 out of 23.43

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
ToxT	Regulator of MSHA biosynthesis

NZ_BMVQ01000009.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 207,153 - 228,238 nt. (total: 21,086 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE283_RS24275: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: deformylase

IE283_RS24285: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: cyclase

IE283_RS24280: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	1.00	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0000650.3	0.36	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000678.5	0.36	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002012.4	0.34	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0001315.3	0.34	terpene	cucurbitacin C	Cucumis sativus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	1.00	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0000650.3	0.36	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000678.5	0.36	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002012.4	0.34	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0001315.3	0.34	terpene	cucurbitacin C	Cucumis sativus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

IE283_RS24280: T1TS

Domain 1 (4 - 339): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 25.12 out of 27.18

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.22 out of 27.04

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.77 out of 23.79

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.21 out of 27.18

Confidence: medium

Additional weak hits (3):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.19 out of 30.22

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
NrdR	Represses ribonucleotide reductase encoding genes

NZ_BMVQ01000009.1 - Region 4 - T2PKS

Download region GenBank file

Download region SVG

Location: 331,713 - 388,943 nt. (total: 57,231 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IE283_RS24920: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE283_RS24945: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

IE283_RS24975: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE283_RS25005: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

IE283_RS25030: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE283_RS25040: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE283_RS25045: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

IE283_RS25060: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: methyltransferase

IE283_RS24935: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: back translocase hydrolase

IE283_RS24850: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

IE283_RS24950: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase

IE283_RS24955: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

IE283_RS24965: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

IE283_RS24970: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

IE283_RS24985: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000194.5	0.98	PKS	actinorhodin	Streptomyces coelicolor A3(2)
BGC0000231.5	0.69	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000272.3	0.64	PKS	spore pigment	Streptomyces collinus
BGC0002276.2	0.59	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000275.4	0.59	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0001197.5	0.56	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000234.5	0.56	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000271.5	0.56	PKS	spore pigment	Streptomyces avermitilis
BGC0001513.3	0.56	PKS	anthrabenzoxocinone	Actinobacteria bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000194.5	0.98	PKS	actinorhodin	Streptomyces coelicolor A3(2)
BGC0000231.5	0.69	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000272.3	0.64	PKS	spore pigment	Streptomyces collinus
BGC0002276.2	0.59	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000275.4	0.59	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0001197.5	0.56	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000234.5	0.56	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000271.5	0.56	PKS	spore pigment	Streptomyces avermitilis
BGC0001513.3	0.56	PKS	anthrabenzoxocinone	Actinobacteria bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

Additional weak hits (12):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.74 out of 29.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.15 out of 32.74

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.00 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.83 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.44 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.80 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.26 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 331712 to 388943
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 7 (Score: 743.5; E-value: 1.2e-226)
Product class(es):: benzoisochromanequinone
Product molecular weight(s):: acetyl-CoA_7: 342 Da

IE283_RS24920: KR (Score: 128.7; E-value: 6.9e-40)
IE283_RS24935: MET (Score: 32.7; E-value: 9.8e-11)
IE283_RS24950: CYC C5-C14 (Score: 467.9; E-value: 2.9e-143)
IE283_RS24955: CYC C7-C12 (Score: 401.8; E-value: 3.6e-123)
IE283_RS24960: ACP (Score: 114.2; E-value: 5e-36)
IE283_RS24965: CLF 7 (Score: 743.5; E-value: 1.2e-226)
IE283_RS24970: KS (Score: 768.2; E-value: 4.5e-234)
IE283_RS24975: KR C9 (Score: 438.4; E-value: 1.9e-134)
IE283_RS25005: OXY (Score: 40.5; E-value: 4.2e-13)
IE283_RS25010: DIMER (Score: 426.8; E-value: 8.7e-131)
IE283_RS25045: KR (Score: 159.4; E-value: 3.1e-49)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVQ01000012.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 223,742 - 255,978 nt. (total: 32,237 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase methyltransferase

IE283_RS29365: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE283_RS29425: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: ligase

IE283_RS29440: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.67	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.67	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (11):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.04 out of 21.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.28 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.75 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.14 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.38 out of 36.53

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.77 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.56 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.34 out of 32.93

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.46 out of 35.63

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.36 out of 27.18

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.33 out of 29.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 223741 - 255978:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - Thr - D-Trp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE283_RS29440: Ser - Thr - Trp

Search NORINE for peptide: strict or relaxed

AMP-binding (475..887): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEHNLYGPTEAAVDVTY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match); Ala or Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1661..2084): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVSH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2746..3147): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: trp (Trp)

Stachelhaus prediction details:

Stachelhaus sequence:: LIFLFDASFWEMSLVVGAELNSYGPTETTVCSTM
Nearest Stachelhaus code(s):: Trp DAWSVGSVCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_BMVQ01000014.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 151,834 - 172,123 nt. (total: 20,290 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

IE283_RS30960: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase dehydratase

IE283_RS30965: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

IE283_RS30970: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000544.4	0.47	ribosomal	planosporicin	Planomonospora alba
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0000560.5	0.43	ribosomal	subtilomycin	Bacillus subtilis
BGC0002635.2	0.42	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0002120.3	0.41	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000529.5	0.34	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000796.3	0.25	saccharide	S-layer glycan	Paenibacillus alvei
BGC0000197.5	0.23	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000106.5	0.21	PKS	naphthomycin A	Streptomyces sp. CS

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000544.4	0.47	ribosomal	planosporicin	Planomonospora alba
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0000560.5	0.43	ribosomal	subtilomycin	Bacillus subtilis
BGC0002635.2	0.42	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0002120.3	0.41	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000529.5	0.34	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000796.3	0.25	saccharide	S-layer glycan	Paenibacillus alvei
BGC0000197.5	0.23	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000106.5	0.21	PKS	naphthomycin A	Streptomyces sp. CS

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (2):

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.02 out of 27.18

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.36 out of 28.19

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 113 - 204; Score: 61.1

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMVQ01000017.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 1 - 33,919 nt. (total: 33,919 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Isomerases: mutase

IE283_RS32420: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthase

IE283_RS32430: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001454.5	0.87	other (other)	germicidin	Streptomyces argillaceus
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002699.2	0.40	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0001660.3	0.40	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001579.4	0.39	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000527.5	0.39	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0002346.3	0.39	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000503.5	0.38	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002490.2	0.38	other (other)	yersinopine	Yersinia pestis CO92

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001454.5	0.87	other (other)	germicidin	Streptomyces argillaceus
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002699.2	0.40	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0001660.3	0.40	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001579.4	0.39	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000527.5	0.39	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0002346.3	0.39	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000503.5	0.38	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002490.2	0.38	other (other)	yersinopine	Yersinia pestis CO92

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.99 out of 20.97

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.91 out of 27.04

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.47 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.76 out of 27.04

Confidence: medium

Additional weak hits (10):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.99 out of 27.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.33 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.03 out of 23.43

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.67 out of 30.22

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.00 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.26 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.09 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.79 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.23 out of 30.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
DasR	N-acetylglucosamine dependent repressor

NZ_BMVQ01000025.1 - Region 1 - other

Download region GenBank file

Download region SVG

Location: 27,756 - 67,734 nt. (total: 39,979 nt) Show pHMM detection rules used

Region on contig edge.

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase protease

IE283_RS36165: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

IE283_RS36220: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

IE283_RS36305: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

IE283_RS36250: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000597.4	0.49	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000595.3	0.42	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000523.3	0.41	ribosomal	lactocin S	Lactobacillus sakei
BGC0001660.3	0.40	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001882.3	0.40	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0001579.4	0.40	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001210.5	0.39	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001364.3	0.39	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002635.2	0.39	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000597.4	0.49	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000595.3	0.42	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000523.3	0.41	ribosomal	lactocin S	Lactobacillus sakei
BGC0001660.3	0.40	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001882.3	0.40	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0001579.4	0.40	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001210.5	0.39	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001364.3	0.39	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002635.2	0.39	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.18 out of 27.55

Confidence: medium

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.05 out of 22.40

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 25.43 out of 29.51

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 22.86 out of 26.12

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.75 out of 27.55

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.19 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.29 out of 30.11

Confidence: medium

Additional weak hits (12):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.89 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.74 out of 32.74

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.34 out of 36.54

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.67 out of 30.22

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.43 out of 32.93

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.97 out of 24.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 32.93

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.59 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.01 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.00 out of 30.98

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.71 out of 27.18

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CatR	H2O2-responsive repressor
CelR	Cellobiose uptake repressor
DosR	Hypoxia stress response regulator
GnfM	Regulator of nitrogen-fixation genes
HypR	L-hydroxyproline utilization repressor
LuxO	Repressor of luminescence

NZ_BMVQ01000028.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 14,488 - 41,238 nt. (total: 26,751 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE283_RS37000: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

IE283_RS37035: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: aminotransferase transferase

IE283_RS36995: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

IE283_RS37070: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Ligases: synthase synthetase

IE283_RS37040: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

IE283_RS37065: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.99	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000664.5	0.52	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.99	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000664.5	0.52	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

IE283_RS37025: PT_phytoene_like

Domain 1 (19 - 285): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

IE283_RS37030: PT_phytoene_like

Domain 1 (7 - 299): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

IE283_RS37040: PT_FPPS_like

Domain 1 (60 - 352): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

IE283_RS37045: T2TS

Domain 1 (32 - 657): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.55 out of 32.93

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.89 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.23 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.46 out of 29.51

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_BMVQ01000029.1 - Region 1 - T1PKS,hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 16,903 - 53,561 nt. (total: 36,659 nt) Show pHMM detection rules used

Region on contig edge.

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase reductase

IE283_RS37275: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

IE283_RS37285: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

IE283_RS37320: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE283_RS37325: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

IE283_RS37350: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Transferases: aminotransferase transferase

IE283_RS37310: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

IE283_RS37335: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: esterase hydrolase

IE283_RS37295: thioesterase

smcogs: SMCOG1004: thioesterase

IE283_RS37345: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000038.5	0.57	PKS	coelimycin P1	Streptomyces coelicolor A3(2)
BGC0000016.4	0.45	other (other)	amphotericin B	Streptomyces nodosus
BGC0002345.2	0.43	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0001273.3	0.41	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.41	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.41	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000849.4	0.31	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001276.3	0.29	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000850.5	0.27	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002477.3	0.27	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000038.5	0.72	PKS	coelimycin P1	Streptomyces coelicolor A3(2)
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000016.4	0.55	other (other)	amphotericin B	Streptomyces nodosus
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000866.5	0.52	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0001987.2	0.48	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0002477.3	0.48	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.25 out of 18.46

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.34 out of 23.79

Confidence: medium

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 22.40

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (9):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.98 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.35 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.74 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.41 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.37 out of 32.93

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 16902 - 53561:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 21482 - 53561:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE283_RS37355: mal - mal - mal

PKS_AT (548..829): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 209.2
inactive: 103.5
Methoxymalonyl-CoA: 75.4
Methylmalonyl-CoA: 68.4
Isobutyryl-CoA: 37.8
2-Methylbutyryl-CoA: 31.3
Benzoyl-CoA: 30.9
Acetyl-CoA: 30.9
Propionyl-CoA: 29.8
Ethylmalonyl-CoA: 28.1
fatty_acid: 20.5
CHC-CoA: 16.6
3-Methylbutyryl-CoA: 15.4
trans-1,2-CPDA: 15.0

PKS_AT (1549..1846): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 203.5
inactive: 97.1
Methoxymalonyl-CoA: 72.9
Methylmalonyl-CoA: 61.7
Isobutyryl-CoA: 41.7
Propionyl-CoA: 30.9
Ethylmalonyl-CoA: 16.8
Acetyl-CoA: 16.8
2-Methylbutyryl-CoA: 14.2
Benzoyl-CoA: 13.3
3-Methylbutyryl-CoA: 9.0
fatty_acid: 8.4
CHC-CoA: 3.9
trans-1,2-CPDA: 0.0

PKS_AT (3286..3585): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 207.6
inactive: 105.9
Methoxymalonyl-CoA: 62.0
Methylmalonyl-CoA: 50.9
Propionyl-CoA: 30.8
Ethylmalonyl-CoA: 17.7
Isobutyryl-CoA: 16.7
2-Methylbutyryl-CoA: 15.7
Acetyl-CoA: 15.4
Benzoyl-CoA: 11.6
CHC-CoA: 9.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
HypR	L-hydroxyproline utilization repressor
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BMVQ01000031.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 34,716 nt. (total: 34,716 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE283_RS37610: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Hydrolases: hydrolase

IE283_RS37680: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

IE283_RS37605: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE283_RS37615: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IE283_RS37685: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE283_RS37690: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000315.5	0.79	NRPS	CDA1b, CDA2a, CDA2b, CDA3a, CDA3b, CDA4a, CDA4b	Streptomyces coelicolor A3(2)
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000426.5	0.71	NRPS	sevadicin	Paenibacillus larvae
BGC0001133.4	0.70	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000315.5	0.79	NRPS	CDA1b, CDA2a, CDA2b, CDA3a, CDA3b, CDA4a, CDA4b	Streptomyces coelicolor A3(2)
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000426.5	0.71	NRPS	sevadicin	Paenibacillus larvae
BGC0001133.4	0.70	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.32 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.81 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.51 out of 29.38

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 34716:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - D-Asn) + (Glu - Trp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE283_RS37685: Glu - Trp

Search NORINE for peptide: strict or relaxed

AMP-binding (467..874): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FHCSFDQSVGSAKGTLGGEVNVYGPTEATGHCLE
Nearest Stachelhaus code(s):: Glu DQGKTGVGHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1541..1936): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: trp (Trp)

Stachelhaus prediction details:

Stachelhaus sequence:: LIFLFDGGFWEMAIVVAAERNSYGPTETTVCATM
Nearest Stachelhaus code(s):: Trp DGWAVASVCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

IE283_RS37690: Gly - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (609..989): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FDMTFDIAGLELQALVGGETNLYGPTEATIWATA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1681..2087): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YVSSFDLTVTGAKAVLGGELNEYGPTETIVGCTT
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (100% 8Å match); OH-Asn DLTKVGEVGK (79% 8Å match); Trp DLTKVGEVGK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_BMVQ01000046.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 6,474 nt. (total: 6,474 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

IE283_RS39065: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE283_RS39070: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.62	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.62	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 6474:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Hpg)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE283_RS39070: Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (760..1193): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDHAFDVSCYEVHLLTGGDRHLYGPTETTLCVTQ
Nearest Stachelhaus code(s):: Hpg DVYHLGLLCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_BMVQ01000053.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,907 nt. (total: 2,907 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

IE283_RS39260: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains