GCF_014650355.1 - 52 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_BMUU01000001.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS-like,nucleoside	94,031	135,752
Region 1.2	NRPS	139,855	218,429
Region 1.3	t3nrps-iterative	338,756	384,555	Low	gausemycin A/gausemycin B	NRPS:Type I+saccharide
Region 1.4	lanthipeptide-class-iv	502,608	525,280	High	venezuelin	ribosomal:RiPP:Lanthipeptide
Region 1.5	terpene-precursor	673,310	694,362
Region 1.6	other	700,974	742,494
Region 1.7	terpene-precursor	802,143	823,240
Region 1.8	terpene,hserlactone	885,410	907,014
Region 1.9	NRPS	935,897	987,901	Low	coelibactin	NRPS:Type I
Region 1.10	atropopeptide	1,004,422	1,025,733
Region 1.11	NRPS-like,NRPS	1,047,873	1,094,793	High	antipain	NRPS:Type I
Region 1.12	melanin	1,126,561	1,136,950	Low	melanin	other:other
Region 1.13	terpene	1,147,767	1,168,840	High	pristinol	terpene
Region 1.14	other	1,218,368	1,259,741

NZ_BMUU01000002.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	NRPS,oligosaccharide,T2PKS,PKS-like,azole-containing-RiPP	493,521	571,230	Medium	aureonuclemycin	PKS

NZ_BMUU01000003.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	T3PKS	6,117	47,208	High	naringenin	PKS:Type III
Region 3.2	T1PKS	67,141	110,995	Low	rubiginone A2/rubiginone J/rubiginone K/rubiginone L/rubiginone M/rubiginone N/ochromycinone/rubiginone B2	PKS
Region 3.3	melanin	265,388	275,906

NZ_BMUU01000005.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	NRPS-like	1	31,323
Region 5.2	terpene	64,879	91,446	High	hopene	terpene
Region 5.3	NAPAA	141,644	175,591

NZ_BMUU01000006.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	NRPS,T3PKS	1	46,812	Low	actinomycin D	NRPS:Type I
Region 6.2	lanthipeptide-class-iv,NRPS-like,NRPS,betalactone	72,725	163,521	High	class IV lanthipeptide/SflA	ribosomal:RiPP
Region 6.3	T3PKS,azole-containing-RiPP	175,487	236,870	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 6.4	lanthipeptide-class-ii	260,883	283,738
Region 6.5	RiPP-like	391,873	403,810
Region 6.6	terpene	541,414	557,778	High	2-methylisoborneol	terpene

NZ_BMUU01000007.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	ectoine	78,747	89,151	High	ectoine	other:other

NZ_BMUU01000009.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	terpene	69,909	92,368	Low	TVA-YJ-2	ribosomal:RiPP

NZ_BMUU01000010.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	NRPS,RiPP-like	1	64,967	Low	14-hydroxyisochainin	PKS:Modular type I
Region 10.2	NRP-metallophore,NRPS	93,696	152,199	High	coelichelin	NRPS:Type I
Region 10.3	NI-siderophore	262,700	295,655	Low	kinamycin	PKS

NZ_BMUU01000011.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	terpene	63,595	84,548
Region 11.2	RiPP-like	164,911	175,138

NZ_BMUU01000013.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	butyrolactone,PKS-like,amglyccycl	222,701	254,178

NZ_BMUU01000014.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	CDPS	140,887	161,582	Low	BD-12	NRPS:Type I

NZ_BMUU01000015.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	lassopeptide	44,992	67,486
Region 15.2	indole	117,948	139,204	Low	Azodyrecin A/Azodyrecin B/Azodyrecin C	other:other
Region 15.3	T1PKS	146,667	192,596	Low	camporidine A/camporidine B	other:other+PKS

NZ_BMUU01000019.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	NRPS-like,hydrogen-cyanide	1	35,965

NZ_BMUU01000021.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	terpene-precursor	4,447	25,478

NZ_BMUU01000026.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	butyrolactone	15,675	26,610

NZ_BMUU01000028.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 28.1	butyrolactone	20,314	30,459	Low	iminimycin A/iminimycin B	PKS+other:other

NZ_BMUU01000034.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 34.1	NRPS	1	12,258

NZ_BMUU01000036.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 36.1	NRPS	1	10,154	Low	hormaomycin/hormaomycin A1/hormaomycin A2/hormaomycin A3/hormaomycin A4/hormaomycin A5/hormaomycin A6	NRPS:Type I

NZ_BMUU01000038.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 38.1	NRPS	1	7,717

NZ_BMUU01000040.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 40.1	NRPS	1	5,664

NZ_BMUU01000043.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 43.1	NRPS	1	3,668	High	rhizomide A/rhizomide B/rhizomide C	NRPS:Type I

NZ_BMUU01000044.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 44.1	NRPS	1	3,029

NZ_BMUU01000045.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 45.1	NRPS	1	2,681

NZ_BMUU01000046.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 46.1	NRPS	1	2,633

NZ_BMUU01000047.1 (Streptomyces xanthochromogenes)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 47.1	NRPS	1	2,565

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS-like,nucleoside	94,031	135,752
Region 1.2	NRPS	139,855	218,429
Region 1.3	t3nrps-iterative	338,756	384,555	Low	gausemycin A/gausemycin B	NRPS:Type I+saccharide
Region 1.4	lanthipeptide-class-iv	502,608	525,280	High	venezuelin	ribosomal:RiPP:Lanthipeptide
Region 1.5	terpene-precursor	673,310	694,362
Region 1.6	other	700,974	742,494
Region 1.7	terpene-precursor	802,143	823,240
Region 1.8	terpene,hserlactone	885,410	907,014
Region 1.9	NRPS	935,897	987,901	Low	coelibactin	NRPS:Type I
Region 1.10	atropopeptide	1,004,422	1,025,733
Region 1.11	NRPS-like,NRPS	1,047,873	1,094,793	High	antipain	NRPS:Type I
Region 1.12	melanin	1,126,561	1,136,950	Low	melanin	other:other
Region 1.13	terpene	1,147,767	1,168,840	High	pristinol	terpene
Region 1.14	other	1,218,368	1,259,741
Region 2.1	NRPS,oligosaccharide,T2PKS,PKS-like,azole-containing-RiPP	493,521	571,230	Medium	aureonuclemycin	PKS
Region 3.1	T3PKS	6,117	47,208	High	naringenin	PKS:Type III
Region 3.2	T1PKS	67,141	110,995	Low	rubiginone A2/rubiginone J/rubiginone K/rubiginone L/rubiginone M/rubiginone N/ochromycinone/rubiginone B2	PKS
Region 3.3	melanin	265,388	275,906
Region 5.1	NRPS-like	1	31,323
Region 5.2	terpene	64,879	91,446	High	hopene	terpene
Region 5.3	NAPAA	141,644	175,591
Region 6.1	NRPS,T3PKS	1	46,812	Low	actinomycin D	NRPS:Type I
Region 6.2	lanthipeptide-class-iv,NRPS-like,NRPS,betalactone	72,725	163,521	High	class IV lanthipeptide/SflA	ribosomal:RiPP
Region 6.3	T3PKS,azole-containing-RiPP	175,487	236,870	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 6.4	lanthipeptide-class-ii	260,883	283,738
Region 6.5	RiPP-like	391,873	403,810
Region 6.6	terpene	541,414	557,778	High	2-methylisoborneol	terpene
Region 7.1	ectoine	78,747	89,151	High	ectoine	other:other
Region 9.1	terpene	69,909	92,368	Low	TVA-YJ-2	ribosomal:RiPP
Region 10.1	NRPS,RiPP-like	1	64,967	Low	14-hydroxyisochainin	PKS:Modular type I
Region 10.2	NRP-metallophore,NRPS	93,696	152,199	High	coelichelin	NRPS:Type I
Region 10.3	NI-siderophore	262,700	295,655	Low	kinamycin	PKS
Region 11.1	terpene	63,595	84,548
Region 11.2	RiPP-like	164,911	175,138
Region 13.1	butyrolactone,PKS-like,amglyccycl	222,701	254,178
Region 14.1	CDPS	140,887	161,582	Low	BD-12	NRPS:Type I
Region 15.1	lassopeptide	44,992	67,486
Region 15.2	indole	117,948	139,204	Low	Azodyrecin A/Azodyrecin B/Azodyrecin C	other:other
Region 15.3	T1PKS	146,667	192,596	Low	camporidine A/camporidine B	other:other+PKS
Region 19.1	NRPS-like,hydrogen-cyanide	1	35,965
Region 21.1	terpene-precursor	4,447	25,478
Region 26.1	butyrolactone	15,675	26,610
Region 28.1	butyrolactone	20,314	30,459	Low	iminimycin A/iminimycin B	PKS+other:other
Region 34.1	NRPS	1	12,258
Region 36.1	NRPS	1	10,154	Low	hormaomycin/hormaomycin A1/hormaomycin A2/hormaomycin A3/hormaomycin A4/hormaomycin A5/hormaomycin A6	NRPS:Type I
Region 38.1	NRPS	1	7,717
Region 40.1	NRPS	1	5,664
Region 43.1	NRPS	1	3,668	High	rhizomide A/rhizomide B/rhizomide C	NRPS:Type I
Region 44.1	NRPS	1	3,029
Region 45.1	NRPS	1	2,681
Region 46.1	NRPS	1	2,633
Region 47.1	NRPS	1	2,565

No secondary metabolite regions were found in these records:: NZ_BMUU01000004.1 (Streptomyces xanthochromogenes); NZ_BMUU01000008.1 (Streptomyces xanthochromogenes); NZ_BMUU01000012.1 (Streptomyces xanthochromogenes); NZ_BMUU01000016.1 (Streptomyces xanthochromogenes); NZ_BMUU01000017.1 (Streptomyces xanthochromogenes); NZ_BMUU01000018.1 (Streptomyces xanthochromogenes); NZ_BMUU01000020.1 (Streptomyces xanthochromogenes); NZ_BMUU01000022.1 (Streptomyces xanthochromogenes); NZ_BMUU01000023.1 (Streptomyces xanthochromogenes); NZ_BMUU01000024.1 (Streptomyces xanthochromogenes); NZ_BMUU01000025.1 (Streptomyces xanthochromogenes); NZ_BMUU01000027.1 (Streptomyces xanthochromogenes); NZ_BMUU01000029.1 (Streptomyces xanthochromogenes); NZ_BMUU01000030.1 (Streptomyces xanthochromogenes); NZ_BMUU01000031.1 (Streptomyces xanthochromogenes); NZ_BMUU01000032.1 (Streptomyces xanthochromogenes); NZ_BMUU01000033.1 (Streptomyces xanthochromogenes); NZ_BMUU01000035.1 (Streptomyces xanthochromogenes); NZ_BMUU01000037.1 (Streptomyces xanthochromogenes); NZ_BMUU01000039.1 (Streptomyces xanthochromogenes); NZ_BMUU01000041.1 (Streptomyces xanthochromogenes); NZ_BMUU01000042.1 (Streptomyces xanthochromogenes); NZ_BMUU01000048.1 (Streptomyces xanthochromogenes); NZ_BMUU01000049.1 (Streptomyces xanthochromogenes); NZ_BMUU01000050.1 (Streptomyces xanthochromogenes); NZ_BMUU01000051.1 (Streptomyces xanthochromogenes); NZ_BMUU01000052.1 (Streptomyces xanthochromogenes)

Compact view

NZ_BMUU01000001.1 - Region 1 - NRPS-like,nucleoside

Download region GenBank file

Download region SVG

Location: 94,031 - 135,752 nt. (total: 41,722 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
nucleoside: (LipM or LipV or LipU or TunD or pur6 or pur10 or nikJ or nikO or truD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase methyltransferase

IE233_RS00560: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

IE233_RS00595: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase

IE233_RS00615: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

smcogs: SMCOG1283: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

Lyases: hydratase

IE233_RS00650: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: ligase

IE233_RS00590: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

IE233_RS00500: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.54	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.53	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.52	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.52	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.52	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.51	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001250.4	0.51	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.51	NRPS	epichloenin A	Epichloe festucae
BGC0001128.4	0.51	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.51	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.54 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.47 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.40 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.56 out of 29.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 94030 - 135752:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS00590: Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (8..395): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: RVLTFDAVLWEGTGVLGGEANAYGPTETCVDAIV
Nearest Stachelhaus code(s):: Leu or Ile DVWTIGAVDK (59% 8Å match); Gln DAWQVGVVDK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_BMUU01000001.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 139,855 - 218,429 nt. (total: 78,575 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE233_RS00800: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase acyltransferase

IE233_RS00775: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

IE233_RS00790: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: hydrolase

IE233_RS00795: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

IE233_RS00825: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

IE233_RS00860: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: hydratase

IE233_RS00840: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

IE233_RS00785: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

IE233_RS00700: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.69	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.69	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.49 out of 27.04

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.12 out of 23.43

Confidence: medium

Additional weak hits (18):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.25 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.88 out of 26.85

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.51 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.86 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.11 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.66 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.35 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.56 out of 23.43

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.49 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.87 out of 30.98

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.21 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 139854 - 218429:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - D-Ala - D-Val - D-Ala - Leu) + (D-Orn - Thr - D-X - Val - D-Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS00785: Orn - Thr - X - Val - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (505..892): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAHAFDTSLEGLDLMLGGEYNFYGPTECTVDALS
Nearest Stachelhaus code(s):: Orn DTEDMGFVDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2007..2416): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LRTHFDFSVWEGNQVFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3071..3489): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDHAFDTSWEGLNVLVGGEVNMYGPTECTVDSVY
Nearest Stachelhaus code(s):: Lys DTEDMGYVDK (74% 8Å match); Orn DTEDMGYVDK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (4601..4981): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDSSFDASTFEAWLWTGGDVDGYGPTEATTFATS
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (5633..6014): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAAAFDASVLETLIIVGAEINSYGPTEATVVASW
Nearest Stachelhaus code(s):: Leu DALLIGAVVK (74% 8Å match); Leu or 3OH-Leu DALLIGAVVK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

IE233_RS00790: Leu - Ala - Val - Ala - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (32..414): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAASFDASVLEILIIVGAEINSYGPTEATIVATW
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (71% 8Å match); Leu DALLIGAVVK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1072..1470): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWTTFDVSVFECSSVLAGEVNAYGPTEATVYATA
Nearest Stachelhaus code(s):: Ala DVFSVAAVYK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2579..2973): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDASTYEVWLWTGGEVDGYGPTETTTFATR
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4089..4489): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFESSAVLAGERNIYGPTEATVYATA
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5599..5984): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAEAFDASVLEALLIVGADVNSYGPTEATVVATW
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (74% 8Å match); Leu DALLIGAVVK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BMUU01000001.1 - Region 3 - t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 338,756 - 384,555 nt. (total: 45,800 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IE233_RS01495: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE233_RS01535: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

IE233_RS01540: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE233_RS01585: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: aminotransferase methyltransferase

IE233_RS01455: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE233_RS01525: methyltransferase

smcogs: SMCOG1248: methyltransferase

IE233_RS01570: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Hydrolases: hydrolase

IE233_RS01450: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

IE233_RS01480: hydrolase

smcogs: SMCOG1179: hydrolase

Lyases: decarboxylase

IE233_RS01500: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase

IE233_RS01465: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE233_RS01505: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001843.2	0.51	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0002042.3	0.47	NRPS	anthelvencin A, anthelvencin B, anthelvencin C	Streptomyces venezuelae
BGC0002493.3	0.46	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000449.5	0.46	NRPS	tridecaptin	Paenibacillus terrae
BGC0002474.2	0.46	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001408.5	0.46	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000131.5	0.46	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0002527.2	0.46	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0002473.3	0.45	NRPS	propanochelin, butanochelin, pentanochelin	Acinetobacter bouvetii DSM 14964 = CIP 107468

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001843.2	0.51	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0002042.3	0.47	NRPS	anthelvencin A, anthelvencin B, anthelvencin C	Streptomyces venezuelae
BGC0002493.3	0.46	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000449.5	0.46	NRPS	tridecaptin	Paenibacillus terrae
BGC0002474.2	0.46	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001408.5	0.46	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000131.5	0.46	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0002527.2	0.46	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0002473.3	0.45	NRPS	propanochelin, butanochelin, pentanochelin	Acinetobacter bouvetii DSM 14964 = CIP 107468

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.83 out of 28.19

Confidence: medium

Additional weak hits (9):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.96 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.50 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.26 out of 39.62

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.37 out of 23.43

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.62 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.02 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.46 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.54 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

IE233_RS01505: X

AMP-binding (21..409): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VAIVFDYGLYQLPVTNTGAICMYGMSECKRITVA
Nearest Stachelhaus code(s):: Asp DYYPTTMRVK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
ZuR variant 1	Zinc-responsive repressor

NZ_BMUU01000001.1 - Region 4 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 502,608 - 525,280 nt. (total: 22,673 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

IE233_RS02150: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE233_RS02200: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: methyltransferase

IE233_RS02130: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000563.4	0.84	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.84	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002337.2	0.57	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0001579.4	0.54	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001660.3	0.53	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000503.5	0.49	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002346.3	0.49	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001779.5	0.49	ribosomal	siamycin	Streptomyces nodosus
BGC0000496.5	0.48	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000553.3	0.46	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000563.4	0.84	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.84	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002337.2	0.57	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0001579.4	0.54	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001660.3	0.53	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000503.5	0.49	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002346.3	0.49	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001779.5	0.49	ribosomal	siamycin	Streptomyces nodosus
BGC0000496.5	0.48	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000553.3	0.46	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (3):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.79 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.44 out of 35.63

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_BMUU01000001.1 - Region 5 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 673,310 - 694,362 nt. (total: 21,053 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE233_RS03010: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE233_RS03020: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: acetyltransferase

IE233_RS03025: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

Hydrolases: hydrolase

IE233_RS02935: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Ligases: synthetase

IE233_RS02980: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.53	terpene	stellatic acid	Aspergillus stellatus
BGC0000677.5	0.48	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002127.3	0.46	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001528.4	0.46	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0001659.3	0.44	terpene	mangicol A	Fusarium equiseti
BGC0001910.4	0.42	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.42	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.41	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002207.2	0.40	other (other)	psilocybin	Psilocybe cyanescens
BGC0001315.3	0.40	terpene	cucurbitacin C	Cucumis sativus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.53	terpene	stellatic acid	Aspergillus stellatus
BGC0000677.5	0.48	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002127.3	0.46	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001528.4	0.46	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0001659.3	0.44	terpene	mangicol A	Fusarium equiseti
BGC0001910.4	0.42	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.42	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.41	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002207.2	0.40	other (other)	psilocybin	Psilocybe cyanescens
BGC0001315.3	0.40	terpene	cucurbitacin C	Cucumis sativus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IE233_RS02980: PT_FPPS_like

Domain 1 (48 - 345): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.16 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.42 out of 23.79

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.15 out of 29.72

Confidence: medium

Additional weak hits (2):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.92 out of 25.75

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.36 out of 20.97

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUU01000001.1 - Region 6 - other

Download region GenBank file

Download region SVG

Location: 700,974 - 742,494 nt. (total: 41,521 nt) Show pHMM detection rules used

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucosidase hydrolase

IE233_RS03100: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

IE233_RS03240: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Translocases: transporter

IE233_RS03070: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002285.2	0.54	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001810.3	0.44	PKS	trehangelin	Polymorphospora rubra
BGC0002700.2	0.41	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001364.3	0.40	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001779.5	0.40	ribosomal	siamycin	Streptomyces nodosus
BGC0002690.2	0.40	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001962.3	0.40	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000527.5	0.39	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002285.2	0.54	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001810.3	0.44	PKS	trehangelin	Polymorphospora rubra
BGC0002700.2	0.41	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001364.3	0.40	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001779.5	0.40	ribosomal	siamycin	Streptomyces nodosus
BGC0002690.2	0.40	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001962.3	0.40	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000527.5	0.39	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.05 out of 22.40

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (13):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.09 out of 26.12

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.90 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.85 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.78 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.97 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.61 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.49 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.68 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.12 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.19 out of 35.63

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.57 out of 20.01

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.27 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
HypR	L-hydroxyproline utilization repressor
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUU01000001.1 - Region 7 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 802,143 - 823,240 nt. (total: 21,098 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE233_RS03560: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: acetyltransferase methyltransferase

IE233_RS03485: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE233_RS03500: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

IE233_RS03525: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Lyases: hydratase

IE233_RS03555: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: synthetase

IE233_RS03535: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001529.5	0.42	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000666.5	0.42	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000665.5	0.42	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000815.4	0.40	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000905.5	0.39	other (other)	heme D1	Heliobacillus mobilis
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001529.5	0.42	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000666.5	0.42	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000665.5	0.42	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000815.4	0.40	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000905.5	0.39	other (other)	heme D1	Heliobacillus mobilis
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IE233_RS03535: PT_FPPS_like

Domain 1 (73 - 341): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.41 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (3):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.86 out of 27.18

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

NZ_BMUU01000001.1 - Region 8 - hserlactone,terpene

Download region GenBank file

Download region SVG

Location: 885,410 - 907,014 nt. (total: 21,605 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
hserlactone: Autoind_synth

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE233_RS03885: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IE233_RS03930: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: hydratase

IE233_RS03925: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000244.4	0.31	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0001928.2	0.27	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000584.5	0.24	ribosomal	colicin V	Escherichia coli
BGC0000616.4	0.24	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000528.5	0.23	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001863.4	0.22	ribosomal, terpene	bacillicn CER074	Bacillus mycoides
BGC0002635.2	0.22	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000221.5	0.22	PKS	erdacin	uncultured soil bacterium V167
BGC0001723.5	0.21	PKS	oviedomycin	Streptomyces antibioticus
BGC0002133.3	0.21	ribosomal	group 1 methanobactin	Methylosinus sp. LW3

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000244.4	0.46	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0001928.2	0.42	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000584.5	0.40	ribosomal	colicin V	Escherichia coli
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000528.5	0.39	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001863.4	0.38	ribosomal, terpene	bacillicn CER074	Bacillus mycoides
BGC0002635.2	0.38	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000221.5	0.37	PKS	erdacin	uncultured soil bacterium V167
BGC0001723.5	0.37	PKS	oviedomycin	Streptomyces antibioticus
BGC0002133.3	0.37	ribosomal	group 1 methanobactin	Methylosinus sp. LW3

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Terpene

Glossary

No acronyms to display

NZ_BMUU01000001.1 - Region 9 - NRPS

Download region GenBank file

Download region SVG

Location: 935,897 - 987,901 nt. (total: 52,005 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

IE233_RS04065: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

IE233_RS04070: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE233_RS04075: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE233_RS04125: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

IE233_RS04180: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase aminotransferase methyltransferase

IE233_RS04085: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

IE233_RS04135: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

IE233_RS04190: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase hydrolase

IE233_RS04130: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IE233_RS04170: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

IE233_RS04090: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS04095: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS04145: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE233_RS04150: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS04155: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000412.5	0.63	NRPS	pyochelin	Pseudomonas aeruginosa PAO1
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000412.5	0.63	NRPS	pyochelin	Pseudomonas aeruginosa PAO1
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.17 out of 23.79

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

Additional weak hits (7):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.25 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.81 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.23 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.54 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.56 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.00 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 935896 - 987901:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - Cys) + (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS04090: X

AMP-binding (33..433): X

nrpys: Hqa

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NACTAALGCPGGTLQVGSSTQWYGIGEGLLTHTR
Nearest Stachelhaus code(s):: Hqa ALPTQGWLTK (76% 8Å match); COOH-Qui ALPTQGWLTK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

IE233_RS04095: X

AMP-binding (25..417): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NVILHDMGVGCGATVVGAELPAYGLAEATLAVTG
Nearest Stachelhaus code(s):: Trp DAGIVGACAK (41% 8Å match); Phe DAGALGACAK (38% 8Å match)
Stachelhaus code match:: 70% (weak)

IE233_RS04150: Ser - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (554..934): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TALSFDLSVYDGNCLLGGDAGLGGTTETAIHSTV
Nearest Stachelhaus code(s):: Ser DLYNLGLIHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1595..1988): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNTLVSGDVALGGATEAAIWSNY
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

IE233_RS04155: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (533..926): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDIAFDLSVYDGNSLLSGDTSLGGATEASIWSIL
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUU01000001.1 - Region 10 - atropopeptide

Download region GenBank file

Download region SVG

Location: 1,004,422 - 1,025,733 nt. (total: 21,312 nt) Show pHMM detection rules used

atropopeptide: atropopeptide_p450

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE233_RS04375: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

IE233_RS04390: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE233_RS04395: Biaryl bond formation

MITE: MITE0000172Biaryl bond formation (identity: 67.70%)
smcogs: SMCOG1034: cytochrome P450

Transferases: acyltransferase methyltransferase

IE233_RS04360: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE233_RS04425: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: esterase

IE233_RS04420: putative esterase

smcogs: SMCOG1104: putative esterase

Ligases: oxygenase

IE233_RS04395: Biaryl bond formation

MITE: MITE0000172Biaryl bond formation (identity: 67.70%)
smcogs: SMCOG1034: cytochrome P450

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002751.2	0.61	ribosomal	Amyxirubin B	Amycolatopsis xylanica
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000660.5	0.53	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000677.5	0.49	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001223.5	0.47	other (other)	hydroxysporine	uncultured bacterium
BGC0001224.5	0.47	other (other)	reductasporine	uncultured bacterium
BGC0002651.2	0.46	terpene	sordaricin B	Rosellinia necatrix
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002751.2	0.61	ribosomal	Amyxirubin B	Amycolatopsis xylanica
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000660.5	0.53	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000677.5	0.49	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001223.5	0.47	other (other)	hydroxysporine	uncultured bacterium
BGC0001224.5	0.47	other (other)	reductasporine	uncultured bacterium
BGC0002651.2	0.46	terpene	sordaricin B	Rosellinia necatrix
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUU01000001.1 - Region 11 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1,047,873 - 1,094,793 nt. (total: 46,921 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase methyltransferase

IE233_RS04605: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE233_RS04680: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Ligases: ligase

IE233_RS04685: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS04690: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS04695: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE233_RS04700: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE233_RS04715: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002051.2	1.08	NRPS	antipain	Streptomyces sp.
BGC0001249.5	0.84	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001570.5	0.70	NRPS	deimino-antipain	Streptomyces albulus
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002051.2	0.81	NRPS	antipain	Streptomyces sp.
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001570.5	0.68	NRPS	deimino-antipain	Streptomyces albulus
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 24.67 out of 29.72

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.33 out of 26.85

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (14):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.32 out of 26.12

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.89 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.83 out of 30.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.33 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.41 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.64 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.12 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 23.43

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.03 out of 30.22

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.45 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.99 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 14, location 1047872 - 1094793:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (X) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 15, location 1047872 - 1089669:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (X) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 16, location 1051604 - 1094793:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (X) + (Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS04685: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (12..401): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LAPSFDGSTFESFFVVGGEVNGYGPTETTTFATA
Nearest Stachelhaus code(s):: Val DAFFVGGTFK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

IE233_RS04690: X

AMP-binding (37..439): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: pip (Hpr)

Stachelhaus prediction details:

Stachelhaus sequence:: LWYIFDPHLLEAVSMVGGDHNAYGPAEATVVTTT
Nearest Stachelhaus code(s):: Phe DPLVVGAVVK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

IE233_RS04695: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (467..863): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HGAAFDVALEEPNLVLGGELNVYGVTEAAISSTV
Nearest Stachelhaus code(s):: Arg DVENVGVISK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
NtrC	Nitrogen regulatory protein C
RutR	Regulator of the pyrimidine and purine metabolism

NZ_BMUU01000001.1 - Region 12 - melanin

Download region GenBank file

Download region SVG

Location: 1,126,561 - 1,136,950 nt. (total: 10,390 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000912.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.78	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000908.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000909.3	0.63	other (other)	melanin	Streptomyces avermitilis
BGC0000911.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001579.4	0.41	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000662.5	0.40	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.37	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001210.5	0.37	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000498.5	0.37	ribosomal	bovicin HJ50	Streptococcus equinus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000912.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.78	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000908.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000909.3	0.63	other (other)	melanin	Streptomyces avermitilis
BGC0000911.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001579.4	0.41	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000662.5	0.40	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.37	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001210.5	0.37	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000498.5	0.37	ribosomal	bovicin HJ50	Streptococcus equinus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.75 out of 20.97

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.03 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (7):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.59 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.58 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.85 out of 23.43

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.60 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.38 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUU01000001.1 - Region 13 - terpene

Download region GenBank file

Download region SVG

Location: 1,147,767 - 1,168,840 nt. (total: 21,074 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase hydratase

IE233_RS05070: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

IE233_RS05095: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

IE233_RS05100: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS05115: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001746.3	0.80	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000683.3	0.76	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.55	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.55	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002128.3	0.47	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0000674.5	0.44	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0000933.3	0.44	other (other)	xiamenmycin A	Streptomyces xiamenensis
BGC0002518.3	0.42	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0000649.3	0.42	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001746.3	0.80	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000683.3	0.76	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.55	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.55	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002128.3	0.47	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0000674.5	0.44	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0000933.3	0.44	other (other)	xiamenmycin A	Streptomyces xiamenensis
BGC0002518.3	0.42	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0000649.3	0.42	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene			C15	C1-C11	none

Genes with terpene domains:

IE233_RS05070: T1TS

Domain 1 (11 - 326): Type 1 terpene synthase

Subtype: Isoafricanol synthase type

Reactions:: FPP → sesquiterpene_C1-C11

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.55 out of 27.04

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

Additional weak hits (4):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.75 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.63 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.20 out of 30.11

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUU01000001.1 - Region 14 - other

Download region GenBank file

Download region SVG

Location: 1,218,368 - 1,259,741 nt. (total: 41,374 nt) Show pHMM detection rules used

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

IE233_RS05355: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE233_RS05500: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Hydrolases: dehalogenase

IE233_RS05345: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: lyase

IE233_RS05505: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002573.2	0.59	other (other)	phosphoramidon	Streptomyces mozunensis
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000844.5	0.53	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000678.5	0.50	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002103.2	0.46	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0002007.2	0.44	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002567.2	0.44	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0001184.4	0.43	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002000.4	0.42	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002573.2	0.59	other (other)	phosphoramidon	Streptomyces mozunensis
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000844.5	0.53	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000678.5	0.50	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002103.2	0.46	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0002007.2	0.44	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002567.2	0.44	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0001184.4	0.43	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002000.4	0.42	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.84 out of 26.85

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.25 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.00 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (6):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.40 out of 26.33

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.06 out of 26.06

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.61 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
DasR	N-acetylglucosamine dependent repressor
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUU01000002.1 - Region 1 - NRPS,PKS-like,T2PKS,azole-containing-RiPP,oligosaccharide

Download region GenBank file

Download region SVG

Location: 493,521 - 571,230 nt. (total: 77,710 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))
T2PKS: (t2ks and t2clf)
PKS-like: (t2pks2 or ksIII)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

IE233_RS07710: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

IE233_RS07735: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IE233_RS07835: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IE233_RS07845: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

IE233_RS07865: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE233_RS07950: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase aminotransferase glycosyltransferase transferase

IE233_RS07720: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

IE233_RS07745: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

IE233_RS07770: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

IE233_RS07780: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

IE233_RS07785: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

IE233_RS07795: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

IE233_RS07810: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

IE233_RS07815: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

IE233_RS07955: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: back translocase esterase

IE233_RS07890: thioesterase

smcogs: SMCOG1004: thioesterase

IE233_RS07965: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Lyases: cyclase dehydratase

IE233_RS07725: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

IE233_RS07740: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

IE233_RS07825: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

IE233_RS07840: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

IE233_RS07860: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: ligase synthase

IE233_RS07760: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS07790: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE233_RS07820: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IE233_RS07855: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS07880: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

IE233_RS07885: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE233_RS07945: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS07970: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	2.15	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001249.5	1.66	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002286.3	1.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002276.2	1.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001833.4	1.51	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002164.2	1.44	NRPS	peramine	Epichloe festucae
BGC0000234.5	1.39	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	1.31	PKS	oviedomycin	Streptomyces antibioticus
BGC0001128.4	1.30	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	1.25	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.78	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001249.5	0.74	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.71	NRPS	peramine	Epichloe festucae
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000278.3	0.68	PKS	urdamycin	Streptomyces fradiae
BGC0002276.2	0.67	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.67	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.11 out of 23.05

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 25.20 out of 29.72

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (12):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.64 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.99 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.30 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.16 out of 21.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 27.05 out of 39.62

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.54 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.97 out of 32.93

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

Type II PKS

TFBS Finder

Azole RiPPs

Predicted core structure(s)

For candidate cluster 1, location 493520 - 571230:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 493520 - 536679:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 498714 - 571230:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 502275 - 543340:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS07760: X

AMP-binding (21..419): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAIVFDYGLYQLPLTNTGASPMFGTTECKRITVL
Nearest Stachelhaus code(s):: 3S-Abu DYYPTTQRIK (74% 8Å match); Asp DYYPTTMRAK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

IE233_RS07790: X

AMP-binding (23..417): X

nrpys: Val, Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGAAWDGFTLDSFMSIGGEVNVYGPVECGAVVTA
Nearest Stachelhaus code(s):: Ile or Val DGLFVGIAVK (47% 8Å match)
Stachelhaus code match:: 80% (moderate)

IE233_RS07855: X

AMP-binding (16..405): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NQILHPMHLNS-YSASGGSFQGYGLAETSPLTHS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

IE233_RS07945: NH2

CAL_domain (36..464): NH2

minowa: NH2

Prediction, score:

NH2: 101.5
fatty_acid: 25.5
AHBA: 5.7
Acetyl-CoA: -3.4
shikimic_acid: -11.2

IE233_RS07970: X

AMP-binding (20..492): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MATP-----AHG------EFQ---------WAAG
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 10 - 108; Score: 63.9; RRE type: NHLP_CD_RRE; Location: 9 - 103; Score: 59.4; RRE type: Cyanobactin_D_RRE; Location: 8 - 85; Score: 55.0

Type II PKS gene cluster prediction details

Cluster section:: 498714 to 571230
Starter unit(s):: malonamyl-CoA (Score: 441.0; E-value: 8.12e-153)
Malonyl elongations:: 8|9 (Score: 676.8; E-value: 2e-206)
Product class(es):: anthracycline
aureolic acid
tetracycline
Product molecular weight(s):: malonamyl-CoA_8: 1459 Da
malonamyl-CoA_9: 1501 Da

IE233_RS07735: OXY (Score: 439.6; E-value: 3.7e-134)
IE233_RS07770: GT (Score: 414.0; E-value: 1.8e-126)
IE233_RS07780: GT (Score: 332.0; E-value: 1.6e-101)
IE233_RS07785: GT (Score: 359.4; E-value: 7.2e-110)
IE233_RS07795: GT (Score: 352.3; E-value: 1.1e-107)
IE233_RS07810: GT (Score: 307.8; E-value: 3.4e-94)
IE233_RS07815: GT (Score: 206.8; E-value: 1.7e-63)
IE233_RS07835: OXY (Score: 178.5; E-value: 5.8e-55)
IE233_RS07840: CYC C7-C12 (Score: 146.7; E-value: 1.7e-45)
IE233_RS07845: KR (Score: 41.1; E-value: 3.8e-13)
IE233_RS07855: LIG (Score: 524.4; E-value: 5.9e-160); LIG ELQ83297.1_Oxytetracycline_malonamyl-CoA (Score: 441.0; E-value: 8.12e-153)
IE233_RS07860: CYC C7-C12 (Score: 451.0; E-value: 3.8e-138)
IE233_RS07865: KR C9 (Score: 470.3; E-value: 3.5e-144)
IE233_RS07870: CYC C1-C18|C2-C19 (Score: 200.1; E-value: 3.1e-62)
IE233_RS07875: ACP (Score: 112.6; E-value: 1.6e-35)
IE233_RS07880: CLF 8|9 (Score: 676.8; E-value: 2e-206)
IE233_RS07885: KS (Score: 756.9; E-value: 1.2e-230)
IE233_RS07895: CYC C5-C14/C3-C16 (Score: 448.2; E-value: 1.9e-137)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
NtrC	Nitrogen regulatory protein C

Core peptide predictions

No core peptides found.

NZ_BMUU01000003.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 6,117 - 47,208 nt. (total: 41,092 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE233_RS10030: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE233_RS10065: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: aminotransferase

IE233_RS10080: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase

IE233_RS10060: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Isomerases: isomerase

IE233_RS10085: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: synthase

IE233_RS10000: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

IE233_RS10025: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

IE233_RS10090: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.83	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000902.4	0.67	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.60	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0002031.3	0.59	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0002127.3	0.59	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002284.3	0.50	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002458.3	0.50	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000844.5	0.48	other (other)	clavulanic acid	Streptomyces clavuligerus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.83	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000902.4	0.67	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.60	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0002031.3	0.59	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0002127.3	0.59	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002284.3	0.50	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002458.3	0.50	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000844.5	0.48	other (other)	clavulanic acid	Streptomyces clavuligerus

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

Additional weak hits (10):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.19 out of 23.43

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.93 out of 27.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.04 out of 27.04

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.35 out of 27.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.75 out of 35.63

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.31 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.81 out of 26.85

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_BMUU01000003.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 67,141 - 110,995 nt. (total: 43,855 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE233_RS10225: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

IE233_RS10285: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase acyltransferase methyltransferase

IE233_RS10200: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE233_RS10255: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

IE233_RS10295: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase hydrolase

IE233_RS10205: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IE233_RS10290: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IE233_RS10305: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

IE233_RS10375: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.67	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.67	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0000662.5	0.50	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002240.3	0.48	PKS	BAB, BAA	Metarhizium anisopliae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.67	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.67	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0000662.5	0.50	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002240.3	0.48	PKS	BAB, BAA	Metarhizium anisopliae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (16):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.36 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.00 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.36 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.08 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.73 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.21 out of 30.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.19 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.86 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.39 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.21 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.19 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.43 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.45 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.58 out of 24.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.95 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 67140 - 110995:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS10295: mmal

PKS_AT (545..839): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 79.2%; Malonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 172.4
Ethylmalonyl-CoA: 163.0
Methoxymalonyl-CoA: 141.9
Malonyl-CoA: 102.3
2-Methylbutyryl-CoA: 99.5
trans-1,2-CPDA: 93.5
Propionyl-CoA: 92.2
Isobutyryl-CoA: 85.4
Benzoyl-CoA: 75.9
Acetyl-CoA: 68.0
CHC-CoA: 67.0
3-Methylbutyryl-CoA: 36.4
fatty_acid: 32.9
inactive: 27.8

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_BMUU01000003.1 - Region 3 - melanin

Download region GenBank file

Download region SVG

Location: 265,388 - 275,906 nt. (total: 10,519 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE233_RS11220: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.81	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002043.3	0.48	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.34	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.34	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.33	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.81	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002043.3	0.48	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.34	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.34	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.33	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.66 out of 30.22

Confidence: medium

Additional weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.07 out of 30.22

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.76 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.42 out of 31.73

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator

NZ_BMUU01000005.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 31,323 nt. (total: 31,323 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE233_RS15710: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE233_RS15745: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: PPTase

IE233_RS15665: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: hydrolase

IE233_RS15675: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

IE233_RS15680: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

IE233_RS15660: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001302.5	0.48	other (other)	lomofungin	Streptomyces lomondensis
BGC0000893.5	0.48	NRPS	chloramphenicol	Streptomyces venezuelae ATCC 10712
BGC0002474.2	0.48	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0000936.5	0.47	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1
BGC0000343.5	0.47	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001868.4	0.46	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001444.5	0.46	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0000019.5	0.44	PKS	angolamycin	Streptomyces eurythermus
BGC0002561.3	0.44	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0001850.4	0.44	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001302.5	0.48	other (other)	lomofungin	Streptomyces lomondensis
BGC0000893.5	0.48	NRPS	chloramphenicol	Streptomyces venezuelae ATCC 10712
BGC0002474.2	0.48	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0000936.5	0.47	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1
BGC0000343.5	0.47	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001868.4	0.46	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001444.5	0.46	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0000019.5	0.44	PKS	angolamycin	Streptomyces eurythermus
BGC0002561.3	0.44	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0001850.4	0.44	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (10):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.29 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.18 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.21 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.57 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.10 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.51 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.40 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.61 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.91 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 31323:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS15660: X

AMP-binding (81..514): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GWSMHVAGHSSNSLTETADVNLLG-----GHVAW
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUU01000005.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 64,879 - 91,446 nt. (total: 26,568 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE233_RS15965: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

IE233_RS16000: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

IE233_RS15935: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

IE233_RS16005: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Ligases: synthase synthetase

IE233_RS15940: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

IE233_RS15960: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.75	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001248.3	0.74	terpene	clavaric acid	Hypholoma sublateritium
BGC0000647.3	0.58	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.75	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001248.3	0.74	terpene	clavaric acid	Hypholoma sublateritium
BGC0000647.3	0.58	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

IE233_RS15955: T2TS

Domain 1 (29 - 654): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

IE233_RS15960: PT_FPPS_like

Domain 1 (76 - 368): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

IE233_RS15970: PT_phytoene_like

Domain 1 (16 - 300): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

IE233_RS15975: PT_phytoene_like

Domain 1 (11 - 286): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

Additional weak hits (7):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.81 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.12 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.36 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.87 out of 30.97

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.51 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
MexT	Global virulence regulator

NZ_BMUU01000005.1 - Region 3 - NAPAA

Download region GenBank file

Download region SVG

Location: 141,644 - 175,591 nt. (total: 33,948 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase synthase

IE233_RS16310: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS16380: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000948.5	0.53	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0002535.2	0.48	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0001873.3	0.44	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001679.3	0.41	NRPS	N-Acetyltryptophan	Aspergillus nidulans FGSC A4
BGC0002208.3	0.41	NRPS	oxepinamide F	Aspergillus ustus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000948.5	0.53	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0002535.2	0.48	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0001873.3	0.44	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001679.3	0.41	NRPS	N-Acetyltryptophan	Aspergillus nidulans FGSC A4
BGC0002208.3	0.41	NRPS	oxepinamide F	Aspergillus ustus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.55 out of 18.46

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

Additional weak hits (7):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.60 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.80 out of 30.11

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.48 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.58 out of 28.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.54 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 141643 - 175591:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS16310: X

AMP-binding (24..398): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIVGGEWNTYGPTETTVVATA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUU01000006.1 - Region 1 - NRPS,T3PKS

Download region GenBank file

Download region SVG

Location: 1 - 46,812 nt. (total: 46,812 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE233_RS18265: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE233_RS18285: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE233_RS18320: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase

IE233_RS18345: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: dehalogenase glucanase hydrolase

IE233_RS18275: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

IE233_RS18290: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

IE233_RS18400: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: lyase

IE233_RS18410: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

IE233_RS18205: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE233_RS18210: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS18315: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.50	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002135.2	0.35	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001928.2	0.33	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001135.5	0.33	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002496.3	0.33	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001261.3	0.33	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.31	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.31	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.31	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.31	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.38 out of 29.72

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

Additional weak hits (9):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.22 out of 32.74

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.91 out of 30.25

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.09 out of 29.51

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.46 out of 27.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.78 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.93 out of 27.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.14 out of 30.22

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.69 out of 32.74

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 46812:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 25115:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS18205: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (464..893): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LASHFDFSVWEGNQVFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

IE233_RS18210: X

AMP-binding (24..367): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ERHNHNMGVSGHYGVSGGESPVYGVTEIGLIAGD
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
NtrC	Nitrogen regulatory protein C

NZ_BMUU01000006.1 - Region 2 - NRPS,NRPS-like,betalactone,lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 72,725 - 163,521 nt. (total: 90,797 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

IE233_RS18595: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

IE233_RS18655: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE233_RS18830: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: esterase hydrolase

IE233_RS18685: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

IE233_RS18815: thioesterase

smcogs: SMCOG1004: thioesterase

IE233_RS18825: thioesterase

smcogs: SMCOG1004: thioesterase

IE233_RS18845: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

IE233_RS18915: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: cyclase decarboxylase lyase

IE233_RS18565: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

IE233_RS18785: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

IE233_RS18950: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: ligase synthase

IE233_RS18760: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS18780: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS18840: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS18850: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS18860: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Translocases: permease

IE233_RS18820: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	1.49	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	1.31	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	1.27	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	1.24	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	1.22	NRPS	enniatin	Fusarium equiseti
BGC0002164.2	1.22	NRPS	peramine	Epichloe festucae
BGC0001641.4	1.22	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	1.18	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	1.17	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	1.17	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.80	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0001249.5	0.74	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for IE233_RS18565

allorf_073512_073652

Leader:

MPTSWCHGTGRRAPAHRALMAPWADGTMKAA

Core:

SITCALSHGARGNHG

Core with dehydrations:

DhaIDhbCysALDhaHGARGNHG

antiSMASH-DB 4.0 matches for allorf_073512_073652

100.0%

NZ_BMUU01000006.1and 1 other:

NZ_BMUU01000006.1 Lanthipeptides: allorf_073512_073652_lanthipeptide

Lanthipeptides: allorf_073512_073652_lanthipeptide

1

SITCALSHGARGNHG

15

SITCALSHGARGNHG

1

SITCALSHGARGNHG

15

33.3%

NZ_RDBM01000037.1:

Lanthipeptides: allorf_1290918_1291067_lanthipeptide

3

TCALSHGARGNH

14

TC+ S G RG+H

5

TCSRSGGPRGDH

16

22.7%

NZ_CP010407.1and 2 others:

NZ_CP010407.1 Lanthipeptides: allorf_8464007_8464123_lanthipeptideNZ_CP010407.1 Lanthipeptides: allorf_8464007_8464123_lanthipeptide

Lanthipeptides: allorf_8464007_8464123_lanthipeptide

4

CALSHGARGNH

14

C+++HGAR +

11

CSVAHGARSSR

21

allorf_085886_086011

Leader:

MRRSIIADSRTGA

Core:

SAKSLRCLRRPDRVRLPGPAGRRNMHDT

Core with dehydrations:

DhaAKDhaLRCysLRRPDRVRLPGPAGRRNMHDDhb

antiSMASH-DB 4.0 matches for allorf_085886_086011

100.0%

NZ_BMUU01000006.1and 1 other:

NZ_BMUU01000006.1 Lanthipeptides: allorf_085886_086011_lanthipeptide

Lanthipeptides: allorf_085886_086011_lanthipeptide

1

SAKSLRCLRRPDRVRLPGPAGRRNMHDT

28

SAKSLRCLRRPDRVRLPGPAGRRNMHDT

1

SAKSLRCLRRPDRVRLPGPAGRRNMHDT

28

28.1%

NZ_BMUU01000006.1and 1 other:

NZ_BMUU01000006.1 Lanthipeptides: allorf_085899_086063_lanthipeptide

Lanthipeptides: allorf_085899_086063_lanthipeptide

7

CLRRPDRVRLPGPAG

21

C RPDR + GPAG

2

CGARPDRGAVHGPAG

16

25.0%

NZ_SLWS01000002.1and 3 others:

NZ_SLWS01000002.1 Lanthipeptides: allorf_0484545_0484631_lanthipeptideNZ_SLWS01000002.1 Lanthipeptides: allorf_0484545_0484631_lanthipeptideNZ_SLWS01000002.1 Lanthipeptides: allorf_0484545_0484631_lanthipeptide

Lanthipeptides: allorf_0484545_0484631_lanthipeptide

7

CLRRPDRVRLP

17

C PD VRLP

4

CPWSPDSVRLP

14

allorf_085899_086063

Leader:

MRLWLVGVTTREVHRTHVMYHA

Core:

YCGARPDRGAVHGPAGGGIAETSRRLRSGSPR

Core with dehydrations:

YCysGARPDRGAVHGPAGGGIAEDhbDhaRRLRDhaGDhaPR

antiSMASH-DB 4.0 matches for allorf_085899_086063

100.0%

NZ_BMUU01000006.1and 1 other:

NZ_BMUU01000006.1 Lanthipeptides: allorf_085899_086063_lanthipeptide

Lanthipeptides: allorf_085899_086063_lanthipeptide

1

YCGARPDRGAVHGPAGGGIAETSRRLRSGSPR

32

YCGARPDRGAVHGPAGGGIAETSRRLRSGSPR

1

YCGARPDRGAVHGPAGGGIAETSRRLRSGSPR

32

28.1%

NZ_BMUU01000006.1and 1 other:

NZ_BMUU01000006.1 Lanthipeptides: allorf_085886_086011_lanthipeptide

Lanthipeptides: allorf_085886_086011_lanthipeptide

2

CGARPDRGAVHGPAG

16

C RPDR + GPAG

7

CLRRPDRVRLPGPAG

21

28.1%

NZ_JALBFU010000008.1:

Lanthipeptides: allorf_86167_86340_lanthipeptide

14

PAGGGIAETSRRLRSGSPR

32

PA G+A R+ SG+PR

6

PARHGLALPPTRIASGAPR

24

with 1 more sequence matches

12.8%

NZ_LIVW01000004.1:

Lanthipeptides: allorf_696351_696575_lanthipeptide

1

YCGARPDRG

9

+C ARPD+G

15

FCVARPDQG

23

allorf_085962_086081

Leader:

MYGSPVRPGAAICMIHNMCTMHFS

Core:

RCHPNEPQPQSGGPA

Core with dehydrations:

RCysHPNEPQPQDhaGGPA

antiSMASH-DB 4.0 matches for allorf_085962_086081

100.0%

NZ_BMUU01000006.1and 1 other:

NZ_BMUU01000006.1 Lanthipeptides: allorf_085962_086081_lanthipeptide

Lanthipeptides: allorf_085962_086081_lanthipeptide

1

RCHPNEPQPQSGGPA

15

RCHPNEPQPQSGGPA

1

RCHPNEPQPQSGGPA

15

31.6%

NZ_CP011420.1:

Lanthipeptides: allorf_2444072_2444176_lanthipeptide

1

RCHPNEPQPQ

10

RC EP+PQ

2

RCSTAEPRPQ

11

16.7%

NZ_BBYJ01000018.1and 2 others:

NZ_BBZG01000001.1 Lanthipeptides: ASC57_RS06310_lanthipeptideNZ_FOBF01000002.1 Lanthipeptides: BMX74_RS05765_lanthipeptide

Lanthipeptides: AWQ71_RS24055_lanthipeptide

1

RCHPNEPQ

8

RC P +PQ

19

RCFPGQPQ

26

Lanthipeptide(s) for IE233_RS18585

allorf_073512_073652

Leader:

MPTSWCHGTGRRAPAHRALMAPWADGTMKAA

Core:

SITCALSHGARGNHG

Core with dehydrations:

DhaIDhbCysALDhaHGARGNHG

antiSMASH-DB 4.0 matches for allorf_073512_073652

100.0%

NZ_BMUU01000006.1and 1 other:

NZ_BMUU01000006.1 Lanthipeptides: allorf_073512_073652_lanthipeptide

Lanthipeptides: allorf_073512_073652_lanthipeptide

1

SITCALSHGARGNHG

15

SITCALSHGARGNHG

1

SITCALSHGARGNHG

15

33.3%

NZ_RDBM01000037.1:

Lanthipeptides: allorf_1290918_1291067_lanthipeptide

3

TCALSHGARGNH

14

TC+ S G RG+H

5

TCSRSGGPRGDH

16

22.7%

NZ_CP010407.1and 2 others:

NZ_CP010407.1 Lanthipeptides: allorf_8464007_8464123_lanthipeptideNZ_CP010407.1 Lanthipeptides: allorf_8464007_8464123_lanthipeptide

Lanthipeptides: allorf_8464007_8464123_lanthipeptide

4

CALSHGARGNH

14

C+++HGAR +

11

CSVAHGARSSR

21

allorf_085886_086011

Leader:

MRRSIIADSRTGA

Core:

SAKSLRCLRRPDRVRLPGPAGRRNMHDT

Core with dehydrations:

DhaAKDhaLRCysLRRPDRVRLPGPAGRRNMHDDhb

antiSMASH-DB 4.0 matches for allorf_085886_086011

100.0%

NZ_BMUU01000006.1and 1 other:

NZ_BMUU01000006.1 Lanthipeptides: allorf_085886_086011_lanthipeptide

Lanthipeptides: allorf_085886_086011_lanthipeptide

1

SAKSLRCLRRPDRVRLPGPAGRRNMHDT

28

SAKSLRCLRRPDRVRLPGPAGRRNMHDT

1

SAKSLRCLRRPDRVRLPGPAGRRNMHDT

28

28.1%

NZ_BMUU01000006.1and 1 other:

NZ_BMUU01000006.1 Lanthipeptides: allorf_085899_086063_lanthipeptide

Lanthipeptides: allorf_085899_086063_lanthipeptide

7

CLRRPDRVRLPGPAG

21

C RPDR + GPAG

2

CGARPDRGAVHGPAG

16

25.0%

NZ_SLWS01000002.1and 3 others:

NZ_SLWS01000002.1 Lanthipeptides: allorf_0484545_0484631_lanthipeptideNZ_SLWS01000002.1 Lanthipeptides: allorf_0484545_0484631_lanthipeptideNZ_SLWS01000002.1 Lanthipeptides: allorf_0484545_0484631_lanthipeptide

Lanthipeptides: allorf_0484545_0484631_lanthipeptide

7

CLRRPDRVRLP

17

C PD VRLP

4

CPWSPDSVRLP

14

allorf_085899_086063

Leader:

MRLWLVGVTTREVHRTHVMYHA

Core:

YCGARPDRGAVHGPAGGGIAETSRRLRSGSPR

Core with dehydrations:

YCysGARPDRGAVHGPAGGGIAEDhbDhaRRLRDhaGDhaPR

antiSMASH-DB 4.0 matches for allorf_085899_086063

100.0%

NZ_BMUU01000006.1and 1 other:

NZ_BMUU01000006.1 Lanthipeptides: allorf_085899_086063_lanthipeptide

Lanthipeptides: allorf_085899_086063_lanthipeptide

1

YCGARPDRGAVHGPAGGGIAETSRRLRSGSPR

32

YCGARPDRGAVHGPAGGGIAETSRRLRSGSPR

1

YCGARPDRGAVHGPAGGGIAETSRRLRSGSPR

32

28.1%

NZ_BMUU01000006.1and 1 other:

NZ_BMUU01000006.1 Lanthipeptides: allorf_085886_086011_lanthipeptide

Lanthipeptides: allorf_085886_086011_lanthipeptide

2

CGARPDRGAVHGPAG

16

C RPDR + GPAG

7

CLRRPDRVRLPGPAG

21

28.1%

NZ_JALBFU010000008.1:

Lanthipeptides: allorf_86167_86340_lanthipeptide

14

PAGGGIAETSRRLRSGSPR

32

PA G+A R+ SG+PR

6

PARHGLALPPTRIASGAPR

24

with 1 more sequence matches

12.8%

NZ_LIVW01000004.1:

Lanthipeptides: allorf_696351_696575_lanthipeptide

1

YCGARPDRG

9

+C ARPD+G

15

FCVARPDQG

23

allorf_085962_086081

Leader:

MYGSPVRPGAAICMIHNMCTMHFS

Core:

RCHPNEPQPQSGGPA

Core with dehydrations:

RCysHPNEPQPQDhaGGPA

antiSMASH-DB 4.0 matches for allorf_085962_086081

100.0%

NZ_BMUU01000006.1and 1 other:

NZ_BMUU01000006.1 Lanthipeptides: allorf_085962_086081_lanthipeptide

Lanthipeptides: allorf_085962_086081_lanthipeptide

1

RCHPNEPQPQSGGPA

15

RCHPNEPQPQSGGPA

1

RCHPNEPQPQSGGPA

15

31.6%

NZ_CP011420.1:

Lanthipeptides: allorf_2444072_2444176_lanthipeptide

1

RCHPNEPQPQ

10

RC EP+PQ

2

RCSTAEPRPQ

11

16.7%

NZ_BBYJ01000018.1and 2 others:

NZ_BBZG01000001.1 Lanthipeptides: ASC57_RS06310_lanthipeptideNZ_FOBF01000002.1 Lanthipeptides: BMX74_RS05765_lanthipeptide

Lanthipeptides: AWQ71_RS24055_lanthipeptide

1

RCHPNEPQ

8

RC P +PQ

19

RCFPGQPQ

26

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.37 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.46 out of 27.04

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (11):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.23 out of 27.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.01 out of 36.54

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.14 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.42 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.48 out of 28.14

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.74 out of 27.18

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.65 out of 27.18

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.75 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.66 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

allorf_073512_073652 - Class II

Cleavage pHMM score: -5.40

RODEO score: 0

Monoisotopic mass: 1425.7 Da

Molecular weight: 1426.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1444.6 Da N = 1; 1462.6 Da N = 2

allorf_085886_086011 - Class II

Cleavage pHMM score: -4.80

RODEO score: 0

Monoisotopic mass: 3160.7 Da

Molecular weight: 3162.6 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3180.7 Da N = 1; 3198.7 Da N = 2

allorf_085899_086063 - Class II

Cleavage pHMM score: -6.50

RODEO score: 0

Monoisotopic mass: 3191.7 Da

Molecular weight: 3193.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3211.5 Da N = 1; 3229.5 Da N = 2; 3247.6 Da N = 3

allorf_085962_086081 - Class II

Cleavage pHMM score: -6.00

RODEO score: 0

Monoisotopic mass: 1555.7 Da

Molecular weight: 1556.7 Da

Number of bridges: 1

allorf_073512_073652 - Class II

Cleavage pHMM score: -5.40

RODEO score: 0

Monoisotopic mass: 1425.7 Da

Molecular weight: 1426.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1444.6 Da N = 1; 1462.6 Da N = 2

allorf_085886_086011 - Class II

Cleavage pHMM score: -4.80

RODEO score: 0

Monoisotopic mass: 3160.7 Da

Molecular weight: 3162.6 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3180.7 Da N = 1; 3198.7 Da N = 2

allorf_085899_086063 - Class II

Cleavage pHMM score: -6.50

RODEO score: 0

Monoisotopic mass: 3191.7 Da

Molecular weight: 3193.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3211.5 Da N = 1; 3229.5 Da N = 2; 3247.6 Da N = 3

allorf_085962_086081 - Class II

Cleavage pHMM score: -6.00

RODEO score: 0

Monoisotopic mass: 1555.7 Da

Molecular weight: 1556.7 Da

Number of bridges: 1

Predicted core structure(s)

For candidate cluster 5, location 94798 - 163521:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asp) + (Ser) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 94798 - 136661:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 99235 - 145382:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asp) + (Ser) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 121766 - 163521:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asp) + (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS18760: X

AMP-binding (38..421): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAIAFDVAQEEPQLVIGGEINGYGPTETVVTCTA
Nearest Stachelhaus code(s):: Arg DVENVGGITK (68% 8Å match); OH-Orn DGEVVGGVTK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

IE233_RS18780: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (471..875): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAIDVSH
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

IE233_RS18840: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (22..384): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LCRAYDGWWFDRLLFSGGEVNLYGPTEATFATHH
Nearest Stachelhaus code(s):: Leu DAFLHGLTAK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

IE233_RS18850: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (23..408): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDHAFDGCITEWKTINGGGHNAYGLTETTVCNLL
Nearest Stachelhaus code(s):: Asp DLTKIGAVNK (47% 8Å match); OH-Asp or OMe-Asp DLTKIGAVNK (44% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

NZ_BMUU01000006.1 - Region 3 - T3PKS,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 175,487 - 236,870 nt. (total: 61,384 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

IE233_RS19060: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

IE233_RS19065: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

IE233_RS19105: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

Transferases: methyltransferase sulfhydrylase

IE233_RS19045: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

IE233_RS19110: Methylation

MITE: MITE0000155Methylation (identity: 70.10%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Hydrolases: amidase hydrolase

IE233_RS19030: amidase

smcogs: SMCOG1105: amidase

IE233_RS19140: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

IE233_RS19195: amidase

smcogs: SMCOG1105: amidase

Lyases: dehydratase

IE233_RS19215: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Ligases: synthase

IE233_RS19115: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.98	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.43	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001077.4	0.36	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0001647.3	0.30	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0000603.5	0.29	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0001964.2	0.26	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0000904.5	0.24	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0001145.5	0.24	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000874.5	0.24	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0001146.5	0.24	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.82	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001145.5	0.58	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001146.5	0.57	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001640.3	0.55	ribosomal	kocurin	Kocuria rosea
BGC0001860.4	0.54	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000613.5	0.54	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000603.5	0.52	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0002311.3	0.52	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0001077.4	0.50	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.79 out of 20.97

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.15 out of 24.78

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 26.64 out of 30.11

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.96 out of 27.04

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (11):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.17 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.78 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.31 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.54 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.29 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.18 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.38 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.76 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.46 out of 29.65

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Detailed domain annotation

Selected features only

Show module domains

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 0 - 81; Score: 43.8; RRE type: Heterocycloanthracin_C_RRE; Location: 7 - 91; Score: 40.1; RRE type: Thiopeptide_F_RRE; Location: 5 - 86; Score: 46.3; RRE type: Heterocycloanthracin_C_RRE; Location: 10 - 89; Score: 33.9

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor
LexA variant 2	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_BMUU01000006.1 - Region 4 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 260,883 - 283,738 nt. (total: 22,856 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IE233_RS19515: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

IE233_RS19520: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Lyases: cyclase

IE233_RS19475: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002704.2	0.46	ribosomal	archalan β	Halorussus salinus
BGC0002703.2	0.45	ribosomal	archalan α	Halorussus salinus
BGC0000528.5	0.43	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000554.4	0.42	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000503.5	0.40	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002698.2	0.39	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000527.5	0.36	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0002707.2	0.35	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0001865.4	0.30	PKS	elsinochrome C	Parastagonospora nodorum SN15
BGC0001338.4	0.28	PKS	citrinin	Monascus ruber

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002704.2	0.46	ribosomal	archalan β	Halorussus salinus
BGC0002703.2	0.45	ribosomal	archalan α	Halorussus salinus
BGC0000528.5	0.43	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000554.4	0.42	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000503.5	0.40	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002698.2	0.39	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000527.5	0.36	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0002707.2	0.35	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0001865.4	0.30	PKS	elsinochrome C	Parastagonospora nodorum SN15
BGC0001338.4	0.28	PKS	citrinin	Monascus ruber

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for IE233_RS19475

IE233_RS19455

Leader:

MRMRTTLAA

Core:

GALAIAAVLGSTGTALAHDRDDHHSGGETSACGSFAGAGGGHAAWGSGCMHSQWEGMYPGRGFHHRLNGF

Core with dehydrations:

GALAIAAVLGDhaDhbGDhbALAHDRDDHHDhaGGEDhbDhaACysGDhaFAGAGGGHAAWGDhaGCysMHDhaQWEGMYPGRGFHHRLNGF

antiSMASH-DB 4.0 matches for IE233_RS19455

100.0%

NZ_BMUU01000006.1:

Lanthipeptides: IE233_RS19455_lanthipeptide

1

GALAIAAVLGSTGTALAHDRDDHHSGGETSACGSFAGAGGGHAAWGSGCMHSQWEGMYPGRGFHHRLNGF

70

GALAIAAVLGSTGTALAHDRDDHHSGGETSACGSFAGAGGGHAAWGSGCMHSQWEGMYPGRGFHHRLNGF

1

GALAIAAVLGSTGTALAHDRDDHHSGGETSACGSFAGAGGGHAAWGSGCMHSQWEGMYPGRGFHHRLNGF

70

98.6%

NZ_BMUZ01000004.1and 1 other:

NZ_CP070373.1 Lanthipeptides: GWQ54_RS15650_lanthipeptide

Lanthipeptides: IE267_RS12160_lanthipeptide

1

GALAIAAVLGSTGTALAHDRDDHHSGGETSACGSFAGAGGGHAAWGSGCMHSQWEGMYPGRGFHHRLNGF

70

GALAIAAVLGSTGTALAHDRDDHHSGGETSACGSFAGAGGGHAAWGSGCMHSQWEG YPGRGFHHRLNGF

1

GALAIAAVLGSTGTALAHDRDDHHSGGETSACGSFAGAGGGHAAWGSGCMHSQWEGRYPGRGFHHRLNGF

70

97.1%

NZ_NNBJ01000008.1:

Lanthipeptides: CG740_RS17870_lanthipeptide

1

GALAIAAVLGSTGTALAHDRDDHHSGGETSACGSFAGAGGGHAAWGSGCMHSQWEGMYPGRGFHHRLNGF

70

GALAIAAVLGSTGTALAHDRDDHHS GE SACGSFAGAGGGHAAWGSGCMHSQWEGMYPGRGFHHRLNGF

1

GALAIAAVLGSTGTALAHDRDDHHSRGENSACGSFAGAGGGHAAWGSGCMHSQWEGMYPGRGFHHRLNGF

70

with 5 more sequence matches

12.9%

NZ_FOLM01000004.1and 1 other:

NZ_FOLM01000004.1 Lanthipeptides: BM242_RS10130_lanthipeptide

Lanthipeptides: BM242_RS10130_lanthipeptide

16

LAHDRDDHHSGGETSACGSFAGAGG

40

L +D DD+ + SAC + GG

1

LLNDTDDNCTSTCQSACSNSTCIGG

25

11.4%

NZ_JANFNS010000003.1:

Lanthipeptides: NOM90_RS11325_lanthipeptide

29

TSACGSFAGAGGGHAAWGSGC

49

T CG F G G G + C

8

TPVCGFFVGVGIGAIISATAC

28

10.0%

NZ_CP012109.1:

Lanthipeptides: allorf_4714567_4714800_lanthipeptide

42

HAAWGSGCMHS

52

HAA G C+HS

7

HAASGRNCLHS

17

8.6%

NZ_CP049223.1and 4 others:

NZ_CP049225.1 Lanthipeptides: G6Z85_RS06555_lanthipeptideNZ_CP049228.1 Lanthipeptides: G6Z83_RS06555_lanthipeptideNZ_JAKWZB010000003.1 Lanthipeptides: MMO78_RS01405_lanthipeptideNZ_PNGO01000002.1 Lanthipeptides: CJ224_RS02730_lanthipeptide

Lanthipeptides: G6Z86_RS06445_lanthipeptide

54

WEGMYPGRGFHHRLNGF

70

W+G+ P R+N F

4

WQGVLPTVSHECRMNSF

20

7.1%

NZ_CP044492.1and 3 others:

NZ_CP066294.2 Lanthipeptides: IGS65_RS08185_lanthipeptideNZ_FNUH01000004.1 Lanthipeptides: BLU50_RS05815_lanthipeptideNZ_FOGM01000011.1 Lanthipeptides: BMX20_RS07220_lanthipeptide

Lanthipeptides: FSA31_RS00605_lanthipeptide

54

WEGMYPGRGFHHRLNGF

70

W+G+ P + R+N +

4

WQGVVPTVSYECRMNSW

20

MIBiG 4.0 matches for IE233_RS19455

7.1%

BGC0002120.3 (NQE92413.1):

Lanthipeptide: nocathioamide A

21

DDHHSGGETSACGSFAG

37

DD S AC + +

29

DDESSRPAAPACHTLSS

45

IE233_RS19480

Leader:

MPQTSVPASAVLNAWLSGAESAYG

Core:

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

Core with dehydrations:

QLNPAGPLYVGGAAAEAALDhbDDhaDhaDDhaLYGFCysDhaDhaPDhaGDhaHGDhaWCysCys

antiSMASH-DB 4.0 matches for IE233_RS19480

100.0%

NZ_BMUU01000006.1and 2 others:

NZ_BMUZ01000004.1 Lanthipeptides: IE267_RS12185_lanthipeptideNZ_CP070373.1 Lanthipeptides: GWQ54_RS15625_lanthipeptide

Lanthipeptides: IE233_RS19480_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

97.6%

NZ_NNBJ01000008.1:

Lanthipeptides: CG740_RS17895_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

QLNPAGPLYVGGAAAEA LTDSSDSLYGFCSSPSGSHGSWCC

1

QLNPAGPLYVGGAAAEAGLTDSSDSLYGFCSSPSGSHGSWCC

42

97.6%

NZ_VISR01000021.1and 1 other:

NZ_VISR01000021.1 Lanthipeptides: FB157_RS31330_lanthipeptide

Lanthipeptides: FB157_RS31330_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

QLNPAGPLYVGGAAAEAALTD SDSLYGFCSSPSGSHGSWCC

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

with 71 more sequence matches

Only the first 10 are displayed here.

95.2%

NZ_BMUQ01000012.1and 7 others:

NZ_CP041604.2 Lanthipeptides: FNV64_RS07000_lanthipeptideNZ_CP041610.2 Lanthipeptides: FNV62_RS03705_lanthipeptideNZ_CP041611.1 Lanthipeptides: FNV63_RS03970_lanthipeptideNZ_CP041613.2 Lanthipeptides: FNV68_RS05855_lanthipeptideNZ_CP041650.2 Lanthipeptides: FNV59_RS05275_lanthipeptideNZ_CP050974.1 Lanthipeptides: HEP84_RS02235_lanthipeptideNZ_KQ948493.1 Lanthipeptides: AQJ27_RS49365_lanthipeptide

Lanthipeptides: IE289_RS27575_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

Q NPAGPLYVGGAAAEAALTD SDSLYGFCSSPSGSHGSWCC

1

QTNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

95.2%

NZ_CP098485.1and 3 others:

NZ_CP098485.1 Lanthipeptides: NAT22_RS36135_lanthipeptideNZ_JACHJK010000003.1 Lanthipeptides: FHS34_RS11895_lanthipeptideNZ_JACHJK010000003.1 Lanthipeptides: FHS34_RS11895_lanthipeptide

Lanthipeptides: NAT22_RS36135_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

QLNPAGPLYVGGAAAEAALTD SDSLYGFCSSPSGS GSWCC

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

92.9%

NZ_BMVR01000007.1:

Lanthipeptides: IE274_RS20785_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

Q NPAGPLYVGG AAEAALTD SDSLYGFCSSPSGSHGSWCC

1

QPNPAGPLYVGGTAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

92.9%

NZ_CP023690.1and 1 other:

NZ_CP030771.1 Lanthipeptides: C9F11_RS41405_lanthipeptide

Lanthipeptides: CP982_RS40715_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

Q NPAGPLYVGG+AAEAALTD SDSLYGFCSSPSGSHGSWCC

1

QANPAGPLYVGGSAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

92.9%

NZ_CP032698.1:

Lanthipeptides: DWB77_RS04745_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

QLNPAGPLYVGG AAEAALTD SDSLYGFCSSPSGS GSWCC

1

QLNPAGPLYVGGTAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

92.9%

NZ_CP040916.1and 1 other:

NZ_RHGC01000002.1 Lanthipeptides: EJ355_RS11575_lanthipeptide

Lanthipeptides: FH965_RS39150_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

Q NPAGPLYVGG AAEAALTD SDSLYGFCSSPSGSHGSWCC

1

QANPAGPLYVGGTAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

92.9%

NZ_CP051010.1and 1 other:

NZ_FONR01000009.1 Lanthipeptides: BM303_RS25620_lanthipeptide

Lanthipeptides: HEP87_RS03725_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

+ NPAGPLYVGGAAAEAALTD SDSLYGFCSSPSGSHGSWCC

1

RTNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

92.9%

NZ_CP106798.1:

Lanthipeptides: N8I87_RS37365_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

Q+NPAGPLYVGGAAAEAALTD SDSLYGFCSSPSGS GSWCC

1

QINPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

92.9%

NZ_MQUS01000030.1:

Lanthipeptides: AV521_RS36555_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

Q NPAGPLYVGG AAEAALTD SDSLYGFCSSPSGSHGSWCC

1

QSNPAGPLYVGGTAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

90.5%

NZ_CP016279.1and 1 other:

NZ_CP016279.1 Lanthipeptides: AVL59_RS19575_lanthipeptide

Lanthipeptides: AVL59_RS19575_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

+LNPAGPLYVGG AAEAALTD SD+LYGFCSSPSGSHGSWCC

1

RLNPAGPLYVGGRAAEAALTDPSDALYGFCSSPSGSHGSWCC

42

IE233_RS19525

Leader:

MRMRTAIAAAALAVAGVLAGG

Core:

ASAVADAGAQGVAAHSPGVASGNLVQIPVHIPINICGNTISVAGALNPAAGTTCINS

Core with dehydrations:

ADhaAVADAGAQGVAAHDhaPGVADhaGNLVQIPVHIPINICysGNDhbIDhaVAGALNPAAGDhbDhbCysINDha

antiSMASH-DB 4.0 matches for IE233_RS19525

100.0%

NZ_BMUU01000006.1:

Lanthipeptides: IE233_RS19525_lanthipeptide

1

ASAVADAGAQGVAAHSPGVASGNLVQIPVHIPINICGNTISVAGALNPAAGTTCINS

57

ASAVADAGAQGVAAHSPGVASGNLVQIPVHIPINICGNTISVAGALNPAAGTTCINS

1

ASAVADAGAQGVAAHSPGVASGNLVQIPVHIPINICGNTISVAGALNPAAGTTCINS

57

98.2%

NZ_BMUZ01000004.1and 1 other:

NZ_CP070373.1 Lanthipeptides: GWQ54_RS15580_lanthipeptide

Lanthipeptides: IE267_RS12230_lanthipeptide

1

ASAVADAGAQGVAAHSPGVASGNLVQIPVHIPINICGNTISVAGALNPAAGTTCINS

57

ASAVADAGAQGVAAHSPGVASGNLVQIPVH+PINICGNTISVAGALNPAAGTTCINS

1

ASAVADAGAQGVAAHSPGVASGNLVQIPVHVPINICGNTISVAGALNPAAGTTCINS

57

19.3%

NZ_NNBJ01000008.1:

Lanthipeptides: CG740_RS17935_lanthipeptide

46

LNPAAGTTCINS

57

LNPAAGTTC+NS

1

LNPAAGTTCVNS

12

with 1 more sequence matches

14.0%

NZ_CP077072.1:

Lanthipeptides: allorf_4771891_4772103_lanthipeptide

16

SPGVASGNLVQIPVH

30

PG SGNL + P+H

18

RPGWGSGNLGRFPIH

32

MIBiG 4.0 matches for IE233_RS19525

8.8%

BGC0002120.3 (NQE92413.1):

Lanthipeptide: nocathioamide A

31

IPINICGNTISVAGALNPAA

50

+NI +++ + PAA

18

FDLNIIDSSMFDDESSRPAA

37

allorf_267084_267176

Leader:

MAPRRSSFARHPLGA

Core:

SAASWCRRAPGRTVT

Core with dehydrations:

DhaAADhaWCysRRAPGRDhbVDhb

antiSMASH-DB 4.0 matches for allorf_267084_267176

100.0%

NZ_BMUU01000006.1and 1 other:

NZ_BMUZ01000004.1 Lanthipeptides: allorf_264042_264134_lanthipeptide

Lanthipeptides: allorf_267084_267176_lanthipeptide

1

SAASWCRRAPGRTVT

15

SAASWCRRAPGRTVT

1

SAASWCRRAPGRTVT

15

33.3%

NZ_VANP01000002.1:

Lanthipeptides: allorf_010170_010304_lanthipeptide

5

WCRRAPGRTVT

15

WC+R P TVT

7

WCKRPPAPTVT

17

28.6%

NZ_CP073318.1:

Lanthipeptides: allorf_01120584_01120718_lanthipeptide

2

AASWCRRAPGRTV

14

A S C R P R +

5

ADSLCHRPPPRKI

17

with 2 more sequence matches

20.7%

NZ_CP021707.1:

Lanthipeptides: allorf_3956612_3956845_lanthipeptide

6

CRRAPGRT

13

C APGRT

8

CSEAPGRT

15

11.1%

NZ_CP095742.1:

Lanthipeptides: allorf_0682536_0682703_lanthipeptide

3

ASWCRRAPGRTVT

15

A+WC ++ G +T

21

AAWCEKSEGYNLT

33

allorf_274142_274369

Leader:

MTWRIRALLGESPGINCSADVLVAGG

Core:

QAGAGACRASIMPPPDSGAFAGIGSAPPPARTTGVPRISAPVTLAGFRI

Core with dehydrations:

QAGAGACysRADhaIMPPPDDhaGAFAGIGDhaAPPPARDhbDhbGVPRIDhaAPVDhbLAGFRI

antiSMASH-DB 4.0 matches for allorf_274142_274369

100.0%

NZ_BMUU01000006.1:

Lanthipeptides: allorf_274142_274369_lanthipeptide

1

QAGAGACRASIMPPPDSGAFAGIGSAPPPARTTGVPRISAPVTLAGFRI

49

QAGAGACRASIMPPPDSGAFAGIGSAPPPARTTGVPRISAPVTLAGFRI

1

QAGAGACRASIMPPPDSGAFAGIGSAPPPARTTGVPRISAPVTLAGFRI

49

98.0%

NZ_CP070373.1:

Lanthipeptides: allorf_3539637_3539864_lanthipeptide

1

QAGAGACRASIMPPPDSGAFAGIGSAPPPARTTGVPRISAPVTLAGFRI

49

QAGAGACRASIMPPPDSGAFAGIGSAPPPARTTGVPRIS PVTLAGFRI

1

QAGAGACRASIMPPPDSGAFAGIGSAPPPARTTGVPRISDPVTLAGFRI

49

95.9%

NZ_BMUZ01000004.1:

Lanthipeptides: allorf_271111_271338_lanthipeptide

1

QAGAGACRASIMPPPDSGAFAGIGSAPPPARTTGVPRISAPVTLAGFRI

49

QAG GACRASIMPPPDSGAFAGIGSAPPPARTTGVPRIS PVTLAGFRI

1

QAGVGACRASIMPPPDSGAFAGIGSAPPPARTTGVPRISDPVTLAGFRI

49

with 3 more sequence matches

19.4%

NZ_AP014940.1:

Lanthipeptides: allorf_3261946_3262173_lanthipeptide

13

PPPDSGAFAGIGSAPPPARTTGVPRISAPVTLAG

46

P P A A I A PP R + A L+G

19

PRPGRNARARIQEAMPPERWRWMREGRAKRGLSG

52

16.3%

NZ_CP051627.1:

Lanthipeptides: FOF52_RS15595_lanthipeptide

1

QAGAGACRASIMPP

14

GA AC +SI PP

10

NDGASACNSSIEPP

23

16.3%

NZ_FOGM01000011.1:

Lanthipeptides: allorf_00061_00258_lanthipeptide

27

PPPARTTGVPRISAPVTLA

45

PPP+RTT + +TL+

23

PPPSRTTAILVYHLKLTLS

41

MIBiG 4.0 matches for allorf_274142_274369

8.2%

BGC0000581.6 (AAD28494.1):

Lasso peptide: microcin J25

20

FAGIGS

25

F GIG+

10

FVGIGT

15

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.57 out of 26.33

Confidence: medium

Additional weak hits (5):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.82 out of 26.12

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.20 out of 30.11

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.49 out of 25.88

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.49 out of 25.88

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

IE233_RS19455 - Class II

Cleavage pHMM score: -4.20

RODEO score: 0

Monoisotopic mass: 6854.1 Da

Molecular weight: 6858.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 6876.4 Da N = 1; 6894.4 Da N = 2; 6912.4 Da N = 3; 6930.4 Da N = 4; 6948.5 Da N = 5; 6966.5 Da N = 6; 6984.5 Da N = 7

IE233_RS19480 - Class II

Cleavage pHMM score: -4.40

RODEO score: 0

Monoisotopic mass: 3970.8 Da

Molecular weight: 3973.3 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3991.3 Da N = 1; 4009.3 Da N = 2; 4027.3 Da N = 3; 4045.3 Da N = 4; 4063.4 Da N = 5; 4081.4 Da N = 6

IE233_RS19525 - Class II

Cleavage pHMM score: -3.80

RODEO score: 0

Monoisotopic mass: 5172.7 Da

Molecular weight: 5175.8 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 5193.8 Da N = 1; 5211.8 Da N = 2; 5229.8 Da N = 3; 5247.9 Da N = 4; 5265.9 Da N = 5; 5283.9 Da N = 6

allorf_267084_267176 - Class II

Cleavage pHMM score: -6.00

RODEO score: 0

Monoisotopic mass: 1545.8 Da

Molecular weight: 1546.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1564.8 Da N = 1; 1582.8 Da N = 2; 1600.8 Da N = 3

allorf_274142_274369 - Class II

Cleavage pHMM score: -4.30

RODEO score: 0

Monoisotopic mass: 4588.5 Da

Molecular weight: 4591.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4609.3 Da N = 1; 4627.3 Da N = 2; 4645.3 Da N = 3; 4663.3 Da N = 4; 4681.4 Da N = 5; 4699.4 Da N = 6

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator

NZ_BMUU01000006.1 - Region 5 - RiPP-like

Download region GenBank file

Download region SVG

Location: 391,873 - 403,810 nt. (total: 11,938 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.42	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000468.5	0.37	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.37	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.37	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.35	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000598.5	0.32	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001148.5	0.29	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0001561.4	0.28	NRPS	curacomycin	Streptomyces curacoi
BGC0001753.3	0.27	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.42	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000468.5	0.37	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.37	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.37	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.35	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000598.5	0.32	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001148.5	0.29	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0001561.4	0.28	NRPS	curacomycin	Streptomyces curacoi
BGC0001753.3	0.27	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.21 out of 35.63

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.19 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMUU01000006.1 - Region 6 - terpene

Download region GenBank file

Download region SVG

Location: 541,414 - 557,778 nt. (total: 16,365 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

IE233_RS20780: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

IE233_RS20775: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.87	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000565.5	0.34	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001221.5	0.32	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0002285.2	0.32	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002470.2	0.30	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001940.3	0.29	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.87	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000565.5	0.34	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001221.5	0.32	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0002285.2	0.32	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002470.2	0.30	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001940.3	0.29	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

IE233_RS20775: T1TS

Domain 1 (16 - 425): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.29 out of 27.55

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (1):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
DmdR1	Iron(II)-dependent repressor
GnfM	Regulator of nitrogen-fixation genes

NZ_BMUU01000007.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 78,747 - 89,151 nt. (total: 10,405 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

IE233_RS21230: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: aminotransferase

IE233_RS21195: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

IE233_RS21205: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.87	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.65	other (other)	ectoine	Methylomicrobium kenyense
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.87	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.65	other (other)	ectoine	Methylomicrobium kenyense
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.37 out of 23.79

Confidence: medium

Additional weak hits (10):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.11 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.47 out of 25.88

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.59 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.75 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.85 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.18 out of 20.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_BMUU01000009.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 69,909 - 92,368 nt. (total: 22,460 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: synthase

IE233_RS24715: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Hydrolases: synthase

IE233_RS24715: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Lyases: cyclase

IE233_RS24675: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002669.2	0.35	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000375.5	0.31	NRPS	indigoidine	Streptomyces chromofuscus
BGC0002295.3	0.31	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0002387.2	0.31	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000391.5	0.30	NRPS	methylpendolmycin, pendolmycin	Marinactinospora thermotolerans
BGC0000876.5	0.29	other (other)	neopolyoxin C	Streptomyces tendae
BGC0001377.5	0.28	PKS	uncialamycin	Streptomyces uncialis
BGC0000874.5	0.27	other (other)	blasticidin S	Streptomyces griseochromogenes

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002669.2	0.35	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000375.5	0.31	NRPS	indigoidine	Streptomyces chromofuscus
BGC0002295.3	0.31	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0002387.2	0.31	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000391.5	0.30	NRPS	methylpendolmycin, pendolmycin	Marinactinospora thermotolerans
BGC0000876.5	0.29	other (other)	neopolyoxin C	Streptomyces tendae
BGC0001377.5	0.28	PKS	uncialamycin	Streptomyces uncialis
BGC0000874.5	0.27	other (other)	blasticidin S	Streptomyces griseochromogenes

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

IE233_RS24675: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (340 - 695): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.50 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (7):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.85 out of 18.57

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.24 out of 27.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.93 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.83 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.31 out of 27.04

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.34 out of 31.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.38 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUU01000010.1 - Region 1 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 1 - 64,967 nt. (total: 64,967 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase synthase

IE233_RS25995: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

IE233_RS26015: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

IE233_RS26045: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

IE233_RS26090: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Transferases: Halogenation PPTase carbamoyltransferase

IE233_RS25955: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

IE233_RS25960: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase

IE233_RS25980: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

IE233_RS25985: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

Hydrolases: deacetylase deaminase esterase synthase

IE233_RS25970: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

IE233_RS26020: thioesterase

smcogs: SMCOG1004: thioesterase

IE233_RS26090: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

IE233_RS26115: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Ligases: ligase synthase

IE233_RS25975: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

IE233_RS26005: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE233_RS26010: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS26030: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.45	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.44	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001249.5	0.42	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001833.4	0.42	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.42	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.42	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.42	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.41	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.41	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.39	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002071.2	0.72	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (11):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.76 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.70 out of 26.85

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.24 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.96 out of 36.54

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.47 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.58 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 64967:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln - Asn) + (X - Gly - X) + (D-Thr - Phe)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 57278:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln - Asn) + (X - Gly - X) + (D-Thr - Phe)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS26005: Gln - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (22..418): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWATFDAHVWEAQVFSAGEWNTYGPTECAIDVTA
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1071..1473): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWASFDLAVPNAKLVVAGEINEYGPTEASVGTCV
Nearest Stachelhaus code(s):: D-Ala DLTKVNEVGK (74% 8Å match); Asn DLTKVGEVGK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

IE233_RS26010: X - Gly - X

Search NORINE for peptide: strict or relaxed

AMP-binding (520..929): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LTAHFDVSVFEGSQVFAGEVNMYGITETTVHTTY
Nearest Stachelhaus code(s):: Ser DVWSVAMVHK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1588..1981): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LAMTFDISGLELQALTGGEVNVYGPTETTIWSTG
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2637..3037): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISVWQSEVLVTGEVNAYGPTECSDDITH
Nearest Stachelhaus code(s):: Dpr DIWELTADDK (94% 8Å match); Dab DIWELTADDK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

IE233_RS26030: Thr - Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (473..884): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVSH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2010..2400): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: MGQAFDAAVWEMTLVVAGEVNAYGPTESTVCASM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_BMUU01000010.1 - Region 2 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 93,696 - 152,199 nt. (total: 58,504 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase phosphate reductase

IE233_RS26290: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

IE233_RS26370: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

IE233_RS26400: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE233_RS26415: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: aminotransferase carbamoyltransferase formyltransferase kinase

IE233_RS26300: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

IE233_RS26305: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

IE233_RS26375: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

IE233_RS26435: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

Hydrolases: esterase peptidase

IE233_RS26330: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

IE233_RS26390: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: hydratase

IE233_RS26420: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

IE233_RS26340: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE233_RS26405: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

IE233_RS26430: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000325.5	1.07	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0000357.5	0.69	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.57	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.57	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.56	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001268.4	0.47	NRPS, PKS	fusarin C	Fusarium fujikuroi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000325.5	0.81	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 36.53 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 33.20 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.65 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.62 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.62 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.48 out of 36.53

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (22):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.27 out of 30.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.53 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.50 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.23 out of 36.53

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.41 out of 33.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.24 out of 36.53

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.84 out of 36.53

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.97 out of 39.62

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.52 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.73 out of 36.53

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 35.63

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.12 out of 36.53

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.52 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 17.67 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 93695 - 152199:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn - D-Thr - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS26340: Fo-OH-Orn - Thr - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (147..545): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISINELYLWCGGEYHGYGPAETTIGVSH
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1629..2043): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTHFDFAVWEGNQVFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3058..3456): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

IE233_RS26405: X

AMP-binding (54..441): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ITFPFGLGGLVPFTVSAGEINGIGATELLHIFIS
Nearest Stachelhaus code(s):: D-Hiv GALHVVGSIK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BMUU01000010.1 - Region 3 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 262,700 - 295,655 nt. (total: 32,956 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE233_RS26920: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

IE233_RS26965: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

IE233_RS26915: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002683.2	0.54	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002305.2	0.49	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002683.2	0.54	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002305.2	0.49	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.10 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.03 out of 27.18

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.17 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (14):

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.93 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.32 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.68 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.59 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.92 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.64 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.31 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.42 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.47 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.46 out of 25.88

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NZ_BMUU01000011.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 63,595 - 84,548 nt. (total: 20,954 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: back translocase hydrolase

IE233_RS27435: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IE233_RS27450: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001227.3	0.39	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000610.5	0.35	ribosomal	nosiheptide	Streptomyces actuosus
BGC0001298.4	0.34	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus
BGC0002363.3	0.33	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0000503.5	0.33	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000615.4	0.32	ribosomal	TP-1161	Nocardiopsis sp. TFS65-07
BGC0000611.5	0.32	ribosomal	siomycin A	Streptomyces sioyaensis
BGC0001579.4	0.31	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002060.3	0.30	PKS	secimide	Pseudomonas syringae pv. syringae B728a
BGC0001424.4	0.26	NRPS, PKS	myxochromide C	Myxococcus virescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001227.3	0.39	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000610.5	0.35	ribosomal	nosiheptide	Streptomyces actuosus
BGC0001298.4	0.34	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus
BGC0002363.3	0.33	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0000503.5	0.33	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000615.4	0.32	ribosomal	TP-1161	Nocardiopsis sp. TFS65-07
BGC0000611.5	0.32	ribosomal	siomycin A	Streptomyces sioyaensis
BGC0001579.4	0.31	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002060.3	0.30	PKS	secimide	Pseudomonas syringae pv. syringae B728a
BGC0001424.4	0.26	NRPS, PKS	myxochromide C	Myxococcus virescens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

IE233_RS27445: PT_phytoene_like

Domain 1 (18 - 267): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.23 out of 23.79

Confidence: medium

Additional weak hits (4):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.23 out of 26.85

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.00 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.60 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.63 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism

NZ_BMUU01000011.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 164,911 - 175,138 nt. (total: 10,228 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

IE233_RS27890: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000500.5	0.42	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000589.5	0.41	ribosomal	microcin M	Escherichia coli Nissle 1917
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000584.5	0.40	ribosomal	colicin V	Escherichia coli
BGC0000518.3	0.40	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002260.3	0.40	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000500.5	0.42	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000589.5	0.41	ribosomal	microcin M	Escherichia coli Nissle 1917
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000584.5	0.40	ribosomal	colicin V	Escherichia coli
BGC0000518.3	0.40	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002260.3	0.40	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.25 out of 27.04

Confidence: medium

Additional weak hits (8):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.98 out of 30.22

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.61 out of 26.12

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.93 out of 32.74

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.84 out of 36.53

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.12 out of 18.57

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NZ_BMUU01000013.1 - Region 1 - PKS-like,amglyccycl,butyrolactone

Download region GenBank file

Download region SVG

Location: 222,701 - 254,178 nt. (total: 31,478 nt) Show pHMM detection rules used

Region on contig edge.

butyrolactone: AfsA
PKS-like: (t2pks2 or ksIII)
amglyccycl: (DOIS or ValA or salQ or strH or strK1 or strK2 or NeoL or SpcFG or SpcDK_glyc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

IE233_RS30710: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE233_RS30725: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE233_RS30745: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

IE233_RS30750: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE233_RS30755: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE233_RS30760: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

IE233_RS30770: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE233_RS30780: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE233_RS30790: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acyltransferase sulfotransferase

IE233_RS30735: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

IE233_RS30775: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Lyases: hydratase

IE233_RS30785: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: synthase

IE233_RS30795: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IE233_RS30800: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IE233_RS30810: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.98	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.93	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.72	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001605.3	0.46	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001224.5	0.45	other (other)	reductasporine	uncultured bacterium
BGC0001928.2	0.43	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000867.3	0.43	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002631.2	0.42	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001197.5	0.39	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000701.5	0.39	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.78	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.76	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.69	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000701.5	0.52	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0001605.3	0.50	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000706.3	0.49	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001810.3	0.49	PKS	trehangelin	Polymorphospora rubra
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000019.5	0.49	PKS	angolamycin	Streptomyces eurythermus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (12):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.53 out of 27.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.97 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.33 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.37 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.53 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.53 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.39 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.53 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.98 out of 31.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.99 out of 32.93

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.19 out of 24.78

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_BMUU01000014.1 - Region 1 - CDPS

Download region GenBank file

Download region SVG

Location: 140,887 - 161,582 nt. (total: 20,696 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE233_RS31465: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: deacetylase

IE233_RS31455: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Lyases: hydratase

IE233_RS31445: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001986.3	0.60	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001948.3	0.52	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002103.2	0.48	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000851.5	0.47	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0001529.5	0.38	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0002582.3	0.38	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0001374.5	0.37	other (other)	thienodolin	Streptomyces albogriseolus
BGC0001335.5	0.35	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0000913.3	0.35	other (other)	MK-8	Enterobacter cloacae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001986.3	0.60	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001948.3	0.52	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002103.2	0.48	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000851.5	0.47	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0001529.5	0.38	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0002582.3	0.38	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0001374.5	0.37	other (other)	thienodolin	Streptomyces albogriseolus
BGC0001335.5	0.35	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0000913.3	0.35	other (other)	MK-8	Enterobacter cloacae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.20 out of 23.79

Confidence: medium

Additional weak hits (4):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.14 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.06 out of 23.43

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.90 out of 35.63

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism

NZ_BMUU01000015.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 44,992 - 67,486 nt. (total: 22,495 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase hydrolase

IE233_RS32135: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

IE233_RS32140: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001889.2	0.47	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001634.3	0.47	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000575.5	0.47	ribosomal	lariatin	Rhodococcus jostii
BGC0002298.2	0.46	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0001493.5	0.44	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001229.4	0.41	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000541.5	0.41	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000617.5	0.41	ribosomal	coagulin	Bacillus coagulans
BGC0000579.4	0.41	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001889.2	0.47	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001634.3	0.47	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000575.5	0.47	ribosomal	lariatin	Rhodococcus jostii
BGC0002298.2	0.46	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0001493.5	0.44	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001229.4	0.41	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000541.5	0.41	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000617.5	0.41	ribosomal	coagulin	Bacillus coagulans
BGC0000579.4	0.41	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

Additional weak hits (12):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.10 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.58 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.45 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.19 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.65 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.76 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.59 out of 29.65

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.18 out of 32.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.52 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.53 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.73 out of 28.19

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 3 - 87; Score: 32.6

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUU01000015.1 - Region 2 - indole

Download region GenBank file

Download region SVG

Location: 117,948 - 139,204 nt. (total: 21,257 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE233_RS32500: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE233_RS32525: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001294.5	0.61	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002128.3	0.45	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001483.4	0.44	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002643.2	0.42	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0000902.4	0.41	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0001840.2	0.36	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0001910.4	0.36	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000706.3	0.35	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0002805.2	0.34	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001294.5	0.61	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002128.3	0.45	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001483.4	0.44	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002643.2	0.42	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0000902.4	0.41	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0001840.2	0.36	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0001910.4	0.36	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000706.3	0.35	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0002805.2	0.34	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.47 out of 25.88

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

Additional weak hits (11):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.42 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.87 out of 20.01

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.07 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.30 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.26 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.90 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.03 out of 20.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.86 out of 26.85

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.09 out of 30.11

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
PsrA	Oleic acid responsive regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUU01000015.1 - Region 3 - T1PKS

Download region GenBank file

Download region SVG

Location: 146,667 - 192,596 nt. (total: 45,930 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IE233_RS32655: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

IE233_RS32660: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

IE233_RS32680: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: PPTase aminotransferase

IE233_RS32690: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

IE233_RS32700: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: esterase hydrolase

IE233_RS32625: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IE233_RS32705: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: synthase

IE233_RS32685: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000016.4	0.55	other (other)	amphotericin B	Streptomyces nodosus
BGC0000041.3	0.52	PKS	oronofacic acid	Pseudomonas syringae
BGC0001917.4	0.49	PKS	5aTHQ-9i, 5aTHQ-9n, 5aTHQ-10a, STAMs-9i, STAMs-9n	Streptomyces nigrescens
BGC0000919.5	0.47	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0002229.2	0.47	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0000122.5	0.47	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000016.4	0.55	other (other)	amphotericin B	Streptomyces nodosus
BGC0000041.3	0.52	PKS	oronofacic acid	Pseudomonas syringae
BGC0001917.4	0.49	PKS	5aTHQ-9i, 5aTHQ-9n, 5aTHQ-10a, STAMs-9i, STAMs-9n	Streptomyces nigrescens
BGC0000919.5	0.47	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0002229.2	0.47	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0000122.5	0.47	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.76 out of 21.84

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.58 out of 27.55

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.15 out of 29.72

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.25 out of 29.72

Confidence: medium

Additional weak hits (15):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.03 out of 30.12

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 21.90 out of 30.11

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.69 out of 30.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.35 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.91 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.02 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.50 out of 29.38

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.35 out of 27.18

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.74 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.31 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.56 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.76 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 146666 - 192596:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - ccmal) + (ccmal)
Non-colinear ordering:: IE233_RS32685 + IE233_RS32715

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS32685: mal - mal - mal

PKS_AT (537..830): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 181.5
inactive: 80.0
Methoxymalonyl-CoA: 60.8
Methylmalonyl-CoA: 46.1
Propionyl-CoA: 40.3
trans-1,2-CPDA: 24.1
Ethylmalonyl-CoA: 19.0
Benzoyl-CoA: 18.5
Isobutyryl-CoA: 15.4
Acetyl-CoA: 14.9
2-Methylbutyryl-CoA: 13.8
fatty_acid: 11.1
CHC-CoA: 8.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (1572..1862): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 185.6
inactive: 76.7
Methoxymalonyl-CoA: 61.1
Methylmalonyl-CoA: 55.8
Isobutyryl-CoA: 26.7
Propionyl-CoA: 20.1
Acetyl-CoA: 15.2
CHC-CoA: 11.0
Ethylmalonyl-CoA: 10.5
2-Methylbutyryl-CoA: 9.7
Benzoyl-CoA: 8.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3309..3611): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.4
inactive: 97.9
Methoxymalonyl-CoA: 59.2
Methylmalonyl-CoA: 53.7
Propionyl-CoA: 36.6
Isobutyryl-CoA: 17.6
Ethylmalonyl-CoA: 14.7
Benzoyl-CoA: 13.7
Acetyl-CoA: 10.6
CHC-CoA: 10.5
2-Methylbutyryl-CoA: 9.5
fatty_acid: 9.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

IE233_RS32715: mal

PKS_AT (1..152): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 76.1
inactive: 36.6
Methoxymalonyl-CoA: 27.9
Methylmalonyl-CoA: 19.2
Propionyl-CoA: 13.1
Isobutyryl-CoA: 10.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
MexT	Global virulence regulator
NtrC	Nitrogen regulatory protein C
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BMUU01000019.1 - Region 1 - NRPS-like,hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 1 - 35,965 nt. (total: 35,965 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

IE233_RS35090: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: PPTase

IE233_RS35020: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Lyases: lyase

IE233_RS35005: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

IE233_RS35010: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

IE233_RS34990: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS35000: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

IE233_RS35065: cobaltochelatase subunit CobN

smcogs: SMCOG1263: cobaltochelatase subunit CobN

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002286.3	0.29	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.29	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.29	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.29	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.29	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.29	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.29	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.28	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.27	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.27	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.92 out of 27.04

Confidence: medium

Additional weak hits (16):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.20 out of 30.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.69 out of 19.26

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.29 out of 36.53

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.34 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.03 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.68 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.45 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.54 out of 24.78

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.14 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.80 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.13 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 35965:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 22928:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS34990: X

AMP-binding (133..530): X

nrpys: Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGPSWDAFALEGQMMTAGELNGYGPAESMGFTTT
Nearest Stachelhaus code(s):: Val DALWMGGTFK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NZ_BMUU01000021.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 4,447 - 25,478 nt. (total: 21,032 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

IE233_RS36240: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001660.3	0.40	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000677.5	0.38	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000678.5	0.35	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000665.5	0.34	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002425.3	0.34	ribosomal	stlassin	Streptomyces sp.
BGC0002621.2	0.34	other (other)	angustmycin A, angustmycin B, angustmycin C, aristeromycin, arabinofuranosyladenine	Streptomyces angustmyceticus
BGC0001911.3	0.34	terpene	raimonol	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001660.3	0.40	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000677.5	0.38	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000678.5	0.35	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000665.5	0.34	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002425.3	0.34	ribosomal	stlassin	Streptomyces sp.
BGC0002621.2	0.34	other (other)	angustmycin A, angustmycin B, angustmycin C, aristeromycin, arabinofuranosyladenine	Streptomyces angustmyceticus
BGC0001911.3	0.34	terpene	raimonol	Streptomyces anulatus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IE233_RS36240: PT_FPPS_like

Domain 1 (57 - 340): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 26.18 out of 32.38

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

Additional weak hits (4):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.89 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.91 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CsoR	Copper-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUU01000026.1 - Region 1 - butyrolactone

Download region GenBank file

Download region SVG

Location: 15,675 - 26,610 nt. (total: 10,936 nt) Show pHMM detection rules used

Region on contig edge.

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE233_RS37670: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: dehalogenase

IE233_RS37645: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.76	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.76	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.60	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002276.2	0.57	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002578.2	0.42	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002496.3	0.39	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000667.3	0.37	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0001810.3	0.37	PKS	trehangelin	Polymorphospora rubra
BGC0001895.4	0.36	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.76	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.76	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.60	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002276.2	0.57	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002578.2	0.42	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002496.3	0.39	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000667.3	0.37	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0001810.3	0.37	PKS	trehangelin	Polymorphospora rubra
BGC0001895.4	0.36	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.08 out of 21.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.67 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.18 out of 39.62

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.57 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.24 out of 28.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMUU01000028.1 - Region 1 - butyrolactone

Download region GenBank file

Download region SVG

Location: 20,314 - 30,459 nt. (total: 10,146 nt) Show pHMM detection rules used

Region on contig edge.

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE233_RS37945: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

IE233_RS37960: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.58	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001273.3	0.58	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.58	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.57	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.57	PKS	ACT-Toxin II	Alternaria alternata
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000850.5	0.55	other (other)	γ-butyrolactone	Streptomyces acidiscabies

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.58	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001273.3	0.58	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.58	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.57	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.57	PKS	ACT-Toxin II	Alternaria alternata
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000850.5	0.55	other (other)	γ-butyrolactone	Streptomyces acidiscabies

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.92 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.22 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.65 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMUU01000034.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 12,258 nt. (total: 12,258 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carbamoyltransferase

IE233_RS38495: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

Lyases: lyase

IE233_RS38490: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

IE233_RS38480: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

IE233_RS38505: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.19 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.64 out of 29.65

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

IE233_RS38505: X

AMP-binding (464..862): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGQSWDGFAVEAQVMTAGELNGYGPVENMGLSTT
Nearest Stachelhaus code(s):: Trp DGVQMAGVGK (47% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_BMUU01000036.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,154 nt. (total: 10,154 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE233_RS38580: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: methyltransferase

IE233_RS38590: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Ligases: ligase

IE233_RS38570: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS38595: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.64	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.64	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 10154:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS38570: X

AMP-binding (464..864): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNQAFDVTVSELHIITGSEVNAYGPTEATVDVAS
Nearest Stachelhaus code(s):: Trp DVSSIGAVEK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

IE233_RS38595: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (442..800): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPSFDSSTYEVYLWTGGDVHVYGPTETTVFCSY
Nearest Stachelhaus code(s):: Val DGYFWGVTFK (76% 8Å match); Ile DAYFWGVTFK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

NZ_BMUU01000038.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 7,717 nt. (total: 7,717 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

IE233_RS38635: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE233_RS38640: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000396.5	0.70	NRPS	nodularin	Nostoc sp. 73.1
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001050.5	0.70	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000901.5	0.69	other (other)	ferrichrome	Aspergillus niger
BGC0001166.5	0.69	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000396.5	0.70	NRPS	nodularin	Nostoc sp. 73.1
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001050.5	0.70	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000901.5	0.69	other (other)	ferrichrome	Aspergillus niger
BGC0001166.5	0.69	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 7717:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS38635: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (635..1029): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDDSFDATTYEVWLWTGGDVNGYGPTETTTFASA
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

IE233_RS38640: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (472..874): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDHSFDASTFEAWLWTGGDVNGYGPTETTTFASA
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

NZ_BMUU01000040.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 5,664 nt. (total: 5,664 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

IE233_RS38680: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE233_RS38685: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 5664:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS38680: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (478..886): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHTFDVSAQESFAAQAGEHNHYGPTETHVVTAH
Nearest Stachelhaus code(s):: Pro DVQFAAHVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_BMUU01000043.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 3,668 nt. (total: 3,668 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

IE233_RS38725: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 3668:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS38725: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (72..475): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDIAALEHQGLVGGETNLYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_BMUU01000044.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 3,029 nt. (total: 3,029 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

IE233_RS38730: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.75 out of 26.85

Confidence: medium

Additional weak hits (1):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.76 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 3029:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE233_RS38730: X

AMP-binding (1..384): X

nrpys: Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGPSWDAFALEGQMMTAGELNGYGPAESMGFTTT
Nearest Stachelhaus code(s):: Val DALWMGGTFK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_BMUU01000045.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,681 nt. (total: 2,681 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

IE233_RS38735: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.61	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.61	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

IE233_RS38735: X

AMP-binding (536..892): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDESFDASTIEGFLWAGGDHNGYGPTETTVFVTV
Nearest Stachelhaus code(s):: Dab DAFFWGEVFK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

NZ_BMUU01000046.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,633 nt. (total: 2,633 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

IE233_RS38740: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

IE233_RS38740: X

AMP-binding (631..872): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDPSFDSSTYEVYF--------------------
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

NZ_BMUU01000047.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,565 nt. (total: 2,565 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

IE233_RS38745: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

IE233_RS38745: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (471..841): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YRASFDLTVTATKVILGGEIAAYGATETTVNSTE
Nearest Stachelhaus code(s):: Asp DLTKIGAVNK (82% 8Å match); OH-Asp or OMe-Asp DLTKIGAVNK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor