GCF_014650335.1 - 44 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_BMUT01000001.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NI-siderophore	41,329	74,149
Region 1.2	T1PKS,NRPS,PKS-like	361,553	494,884	Low	camporidine A/camporidine B	other:other+PKS
Region 1.3	triceptide	575,342	596,714
Region 1.4	NRP-metallophore,NRPS	647,050	696,042	High	paenibactin	NRPS:Type I
Region 1.5	NRPS-like,T1PKS,prodigiosin	725,836	778,052	High	marineosin A/marineosin B	PKS
Region 1.6	NAPAA,terpene	781,766	836,595	High	hopene	terpene
Region 1.7	terpene,polyyne,NRPS	871,819	948,331	Low	cepacin A	PKS
Region 1.8	aminopolycarboxylic-acid	1,138,946	1,152,447	High	Ethylenediaminesuccinic acid hydroxyarginine	other:other

NZ_BMUT01000002.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	melanin	302,281	312,685	Low	melanin	other:other
Region 2.2	lanthipeptide-class-iii	592,553	615,342	Medium	SapB	ribosomal:RiPP:Lanthipeptide

NZ_BMUT01000003.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	CDPS	30,787	51,525
Region 3.2	terpene	95,547	116,596
Region 3.3	azole-containing-RiPP,NI-siderophore	160,779	199,350
Region 3.4	T1PKS	204,954	313,577	High	pentamycin	PKS
Region 3.5	NRPS-like,T1PKS,NRPS	406,065	462,440

NZ_BMUT01000004.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	hydrogen-cyanide	54,571	67,694

NZ_BMUT01000005.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	melanin	304,660	315,025	Low	melanin	other:other

NZ_BMUT01000007.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	butyrolactone	1	9,905
Region 7.2	crocagin	37,243	65,282
Region 7.3	terpene,T1PKS	162,484	208,367	Medium	toxoflavin/fervenulin	other:other
Region 7.4	triceptide	245,477	266,811	Low	cyclofaulknamycin	PKS
Region 7.5	deazapurine,hglE-KS,T1PKS	270,620	356,355	Low	toyocamycin	other:other
Region 7.6	NRP-metallophore,NRPS	363,445	412,151	High	qinichelins	NRPS:Type I

NZ_BMUT01000009.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	T2PKS	1	47,120	High	hiroshidine	PKS
Region 9.2	lassopeptide,amglyccycl	233,882	274,430	Low	TVA-YJ-2	ribosomal:RiPP

NZ_BMUT01000010.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	ectoine	67,267	77,665	High	ectoine	other:other

NZ_BMUT01000011.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	RiPP-like	1	10,615
Region 11.2	terpene	61,731	82,657
Region 11.3	terpene-precursor,RiPP-like	85,233	106,306
Region 11.4	terpene-precursor,RiPP-like,NRPS-like,NRPS	196,762	289,047	High	antipain	NRPS:Type I

NZ_BMUT01000012.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	NI-siderophore,terpene	252,804	299,512	Low	peucechelin	NRPS:Type I

NZ_BMUT01000013.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	lassopeptide,hglE-KS,NRPS-like,terpene	8,583	135,090	High	guanipiperazine A/guanipiperazine B	NRPS:Type I
Region 13.2	terpene-precursor	141,581	164,130

NZ_BMUT01000014.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	terpene-precursor,hydrogen-cyanide	80,603	112,233	Low	aborycin	ribosomal:RiPP
Region 14.2	terpene	123,046	144,380

NZ_BMUT01000015.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	RiPP-like	51,747	63,063

NZ_BMUT01000017.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	T1PKS,T3PKS,t3nrps-iterative,PKS-like,NRPS,butyrolactone	1	102,590	Low	4-hexadecanoyl-3-hydroxy-2-(hydroxymethyl)-2H-furan-5-one	PKS
Region 17.2	terpene	111,838	132,737

NZ_BMUT01000018.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	amglyccycl	57,995	79,218

NZ_BMUT01000019.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	lassopeptide,terpene,atropopeptide	26,423	67,747

NZ_BMUT01000020.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	T3PKS,RRE-containing	3,672	44,778	Low	vazabitide A	NRPS:Type I

NZ_BMUT01000024.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	lanthipeptide-class-iii	29,742	46,970

NZ_BMUT01000027.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 27.1	RRE-containing	1	14,768	Medium	lagmysin	ribosomal:RiPP

NZ_BMUT01000030.1 (Streptomyces hiroshimensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 30.1	NRPS-like,T1PKS	1	13,052

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NI-siderophore	41,329	74,149
Region 1.2	T1PKS,NRPS,PKS-like	361,553	494,884	Low	camporidine A/camporidine B	other:other+PKS
Region 1.3	triceptide	575,342	596,714
Region 1.4	NRP-metallophore,NRPS	647,050	696,042	High	paenibactin	NRPS:Type I
Region 1.5	NRPS-like,T1PKS,prodigiosin	725,836	778,052	High	marineosin A/marineosin B	PKS
Region 1.6	NAPAA,terpene	781,766	836,595	High	hopene	terpene
Region 1.7	terpene,polyyne,NRPS	871,819	948,331	Low	cepacin A	PKS
Region 1.8	aminopolycarboxylic-acid	1,138,946	1,152,447	High	Ethylenediaminesuccinic acid hydroxyarginine	other:other
Region 2.1	melanin	302,281	312,685	Low	melanin	other:other
Region 2.2	lanthipeptide-class-iii	592,553	615,342	Medium	SapB	ribosomal:RiPP:Lanthipeptide
Region 3.1	CDPS	30,787	51,525
Region 3.2	terpene	95,547	116,596
Region 3.3	azole-containing-RiPP,NI-siderophore	160,779	199,350
Region 3.4	T1PKS	204,954	313,577	High	pentamycin	PKS
Region 3.5	NRPS-like,T1PKS,NRPS	406,065	462,440
Region 4.1	hydrogen-cyanide	54,571	67,694
Region 5.1	melanin	304,660	315,025	Low	melanin	other:other
Region 7.1	butyrolactone	1	9,905
Region 7.2	crocagin	37,243	65,282
Region 7.3	terpene,T1PKS	162,484	208,367	Medium	toxoflavin/fervenulin	other:other
Region 7.4	triceptide	245,477	266,811	Low	cyclofaulknamycin	PKS
Region 7.5	deazapurine,hglE-KS,T1PKS	270,620	356,355	Low	toyocamycin	other:other
Region 7.6	NRP-metallophore,NRPS	363,445	412,151	High	qinichelins	NRPS:Type I
Region 9.1	T2PKS	1	47,120	High	hiroshidine	PKS
Region 9.2	lassopeptide,amglyccycl	233,882	274,430	Low	TVA-YJ-2	ribosomal:RiPP
Region 10.1	ectoine	67,267	77,665	High	ectoine	other:other
Region 11.1	RiPP-like	1	10,615
Region 11.2	terpene	61,731	82,657
Region 11.3	terpene-precursor,RiPP-like	85,233	106,306
Region 11.4	terpene-precursor,RiPP-like,NRPS-like,NRPS	196,762	289,047	High	antipain	NRPS:Type I
Region 12.1	NI-siderophore,terpene	252,804	299,512	Low	peucechelin	NRPS:Type I
Region 13.1	lassopeptide,hglE-KS,NRPS-like,terpene	8,583	135,090	High	guanipiperazine A/guanipiperazine B	NRPS:Type I
Region 13.2	terpene-precursor	141,581	164,130
Region 14.1	terpene-precursor,hydrogen-cyanide	80,603	112,233	Low	aborycin	ribosomal:RiPP
Region 14.2	terpene	123,046	144,380
Region 15.1	RiPP-like	51,747	63,063
Region 17.1	T1PKS,T3PKS,t3nrps-iterative,PKS-like,NRPS,butyrolactone	1	102,590	Low	4-hexadecanoyl-3-hydroxy-2-(hydroxymethyl)-2H-furan-5-one	PKS
Region 17.2	terpene	111,838	132,737
Region 18.1	amglyccycl	57,995	79,218
Region 19.1	lassopeptide,terpene,atropopeptide	26,423	67,747
Region 20.1	T3PKS,RRE-containing	3,672	44,778	Low	vazabitide A	NRPS:Type I
Region 24.1	lanthipeptide-class-iii	29,742	46,970
Region 27.1	RRE-containing	1	14,768	Medium	lagmysin	ribosomal:RiPP
Region 30.1	NRPS-like,T1PKS	1	13,052

No secondary metabolite regions were found in these records:: NZ_BMUT01000006.1 (Streptomyces hiroshimensis); NZ_BMUT01000008.1 (Streptomyces hiroshimensis); NZ_BMUT01000016.1 (Streptomyces hiroshimensis); NZ_BMUT01000021.1 (Streptomyces hiroshimensis); NZ_BMUT01000022.1 (Streptomyces hiroshimensis); NZ_BMUT01000023.1 (Streptomyces hiroshimensis); NZ_BMUT01000025.1 (Streptomyces hiroshimensis); NZ_BMUT01000026.1 (Streptomyces hiroshimensis); NZ_BMUT01000028.1 (Streptomyces hiroshimensis); NZ_BMUT01000029.1 (Streptomyces hiroshimensis); NZ_BMUT01000031.1 (Streptomyces hiroshimensis); NZ_BMUT01000032.1 (Streptomyces hiroshimensis); NZ_BMUT01000033.1 (Streptomyces hiroshimensis); NZ_BMUT01000034.1 (Streptomyces hiroshimensis)

Compact view

NZ_BMUT01000001.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 41,329 - 74,149 nt. (total: 32,821 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE241_RS00275: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

IE241_RS00220: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

IE241_RS00290: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001713.5	0.54	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002683.2	0.52	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.52	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002470.2	0.52	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.52	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002633.2	0.52	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002305.2	0.51	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001713.5	0.54	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002683.2	0.52	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.52	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002470.2	0.52	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.52	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002633.2	0.52	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002305.2	0.51	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 25.31

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.96 out of 29.72

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.09 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.15 out of 24.78

Confidence: medium

Additional weak hits (7):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.74 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.32 out of 27.18

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.60 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes
NtrC	Nitrogen regulatory protein C

NZ_BMUT01000001.1 - Region 2 - NRPS,PKS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 361,553 - 494,884 nt. (total: 133,332 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

IE241_RS01530: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

IE241_RS01590: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

IE241_RS01605: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

IE241_RS01620: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

IE241_RS01645: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE241_RS01675: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE241_RS01690: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE241_RS01695: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE241_RS01730: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

IE241_RS01790: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: aminotransferase

IE241_RS01600: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: back translocase esterase

IE241_RS01505: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

IE241_RS01725: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

IE241_RS01570: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

IE241_RS01575: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE241_RS01580: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE241_RS01705: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS01710: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS01715: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS01735: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS01765: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IE241_RS01775: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS01780: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.74	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.71	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (30):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.19 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.41 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.74 out of 31.73

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.54 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.58 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.17 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.65 out of 20.01

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.58 out of 27.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.76 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.71 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.33 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.34 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.53 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.45 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.33 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.42 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.16 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.65 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.49 out of 19.26

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.31 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.20 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.43 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.07 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.16 out of 36.54

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.15 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.73 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.79 out of 30.98

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 361552 - 494884:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (Leu - Glu) + (Orn - Leu) + (mal - ccmal - ccmal) + (Me-ccmal - ccmal) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 361552 - 432805:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - ccmal) + (Me-ccmal - ccmal) + (ccmal)
Non-colinear ordering:: IE241_RS01580 + IE241_RS01575 + IE241_RS01570

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 425316 - 490040:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (Leu - Glu) + (Orn - Leu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 453855 - 494884:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - Glu) + (D-Asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE241_RS01570: mal

PKS_AT (572..866): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.2
inactive: 94.0
Methoxymalonyl-CoA: 67.6
Methylmalonyl-CoA: 57.8
Propionyl-CoA: 43.8
Isobutyryl-CoA: 29.9
Ethylmalonyl-CoA: 25.6
Acetyl-CoA: 22.7
2-Methylbutyryl-CoA: 18.9
Benzoyl-CoA: 16.2
trans-1,2-CPDA: 13.1
CHC-CoA: 12.7
3-Methylbutyryl-CoA: 6.7
fatty_acid: 0.0

IE241_RS01575: mmal - mal

PKS_AT (577..875): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 224.8
Ethylmalonyl-CoA: 218.8
Methoxymalonyl-CoA: 180.8
2-Methylbutyryl-CoA: 159.4
trans-1,2-CPDA: 130.1
Propionyl-CoA: 118.8
Malonyl-CoA: 112.0
CHC-CoA: 102.7
Isobutyryl-CoA: 92.5
Benzoyl-CoA: 67.7
Acetyl-CoA: 59.8
3-Methylbutyryl-CoA: 58.1
fatty_acid: 44.8
inactive: 29.8

PKS_AT (2362..2656): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 206.6
inactive: 98.4
Methoxymalonyl-CoA: 72.6
Methylmalonyl-CoA: 60.6
Propionyl-CoA: 49.4
Isobutyryl-CoA: 30.2
Acetyl-CoA: 25.2
Ethylmalonyl-CoA: 23.9
2-Methylbutyryl-CoA: 20.5
Benzoyl-CoA: 17.1
trans-1,2-CPDA: 13.7
CHC-CoA: 11.8
3-Methylbutyryl-CoA: 7.7
fatty_acid: 0.0

IE241_RS01580: mal - mal - mal

PKS_AT (561..854): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 222.9
inactive: 99.1
Methylmalonyl-CoA: 66.1
Methoxymalonyl-CoA: 63.9
Ethylmalonyl-CoA: 30.0
Propionyl-CoA: 28.7
Isobutyryl-CoA: 27.6
Benzoyl-CoA: 25.5
Acetyl-CoA: 24.6
CHC-CoA: 18.7
trans-1,2-CPDA: 17.5
2-Methylbutyryl-CoA: 16.9
fatty_acid: 9.7
3-Methylbutyryl-CoA: 5.5

PKS_AT (1575..1873): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.7
inactive: 101.4
Methoxymalonyl-CoA: 77.1
Methylmalonyl-CoA: 76.3
Isobutyryl-CoA: 47.9
Propionyl-CoA: 34.4
Ethylmalonyl-CoA: 26.2
2-Methylbutyryl-CoA: 25.4
Acetyl-CoA: 21.7
Benzoyl-CoA: 20.3
trans-1,2-CPDA: 18.5
CHC-CoA: 18.4
fatty_acid: 14.1
3-Methylbutyryl-CoA: 12.1

PKS_AT (3313..3609): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 206.0
inactive: 93.4
Methoxymalonyl-CoA: 63.0
Methylmalonyl-CoA: 46.6
Propionyl-CoA: 29.9
Isobutyryl-CoA: 17.3
CHC-CoA: 10.6
Acetyl-CoA: 10.4
Ethylmalonyl-CoA: 8.5
2-Methylbutyryl-CoA: 7.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

IE241_RS01705: Orn - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (476..897): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MSHNFDASWSQWDTALGGEYNLYGPAECTVDAMI
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (65% 8Å match); Lys DADDAGTVDK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1566..1984): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LQQAFDASVWETLLVVGGEVNAYGPTEATVMATM
Nearest Stachelhaus code(s):: Leu DAWLVGAVYK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

IE241_RS01710: Leu - Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (469..869): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LFQAFDASVWETLLVVGAEVNAYGPTESTVIALQ
Nearest Stachelhaus code(s):: Leu DAWLVGAVYK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1549..1937): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: YGMTFDPSVWEWQFFVGGEHNQYGPTEVSVYTTT
Nearest Stachelhaus code(s):: Arg DPWGFGLVDK (68% 8Å match); Gln DAWQFGVVDK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

IE241_RS01715: X

AMP-binding (27..436): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDMVCDGWMMQ-AMIIGAELPAYGGAEATLAVTG
Nearest Stachelhaus code(s):: Thr DGMLVGAIVK (41% 8Å match); Arg DVESIGAIAK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

IE241_RS01735: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (494..893): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YFASFDLTVTGGKAVLGGEVNEYGPTEATVGCTE
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

IE241_RS01775: X

AMP-binding (14..393): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NRTLHQYGLSLLDACTGGALDGYGSTELGNVSFA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein

NZ_BMUT01000001.1 - Region 3 - triceptide

Download region GenBank file

Download region SVG

Location: 575,342 - 596,714 nt. (total: 21,373 nt) Show pHMM detection rules used

triceptide: ((cds(PF04055 and (TIGR04085 or SPASM)) and triceptide_precursor) or triceptide_rSAM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

IE241_RS02290: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: aminotransferase

IE241_RS02280: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: hydratase

IE241_RS02275: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000919.5	0.43	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0002633.2	0.39	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002332.2	0.39	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0002683.2	0.39	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002382.3	0.39	ribosomal	grimoviridin	Grimontia marina
BGC0000663.5	0.38	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002470.2	0.37	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000895.5	0.37	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002535.2	0.36	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0001151.5	0.36	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000919.5	0.43	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0002633.2	0.39	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002332.2	0.39	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0002683.2	0.39	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002382.3	0.39	ribosomal	grimoviridin	Grimontia marina
BGC0000663.5	0.38	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002470.2	0.37	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000895.5	0.37	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002535.2	0.36	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0001151.5	0.36	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (8):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.61 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.71 out of 27.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 32.93

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.66 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.51 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.37 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.15 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.83 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMUT01000001.1 - Region 4 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 647,050 - 696,042 nt. (total: 48,993 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IE241_RS02675: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

IE241_RS02685: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE241_RS02690: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE241_RS02725: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE241_RS02795: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acetyltransferase aminotransferase methyltransferase

IE241_RS02755: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

IE241_RS02780: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

IE241_RS02805: aminotransferase

smcogs: SMCOG1019: aminotransferase

IE241_RS02815: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

IE241_RS02830: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deacetylase hydrolase

IE241_RS02705: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IE241_RS02715: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

IE241_RS02740: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

IE241_RS02730: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

IE241_RS02700: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS02735: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

IE241_RS02800: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000343.5	0.79	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001185.5	0.79	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000401.5	0.70	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002474.2	0.64	NRPS	agrobactin	Agrobacterium tumefaciens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000343.5	0.72	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001185.5	0.71	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000401.5	0.68	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002474.2	0.66	NRPS	agrobactin	Agrobacterium tumefaciens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.05 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.83 out of 24.78

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 33.62 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.03 out of 36.53

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.15 out of 29.72

Confidence: medium

Additional weak hits (16):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.98 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.16 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.10 out of 20.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.59 out of 20.97

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.72 out of 32.93

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.44 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.74 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.96 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.64 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.73 out of 24.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 39.62

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.54 out of 29.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.89 out of 18.57

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.19 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 647049 - 696042:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE241_RS02700: X

AMP-binding (14..423): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWAAFDLTTFDSYAAFAGEYNLYGPTETNVCTYS
Nearest Stachelhaus code(s):: Pro DLFYLALVCK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

IE241_RS02735: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (37..445): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SGSLFPLSSPGGGLLVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPGLGVVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

IE241_RS02750: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (494..908): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFSSGEHNLYGPTEAAVDVTH
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C

NZ_BMUT01000001.1 - Region 5 - NRPS-like,T1PKS,prodigiosin

Download region GenBank file

Download region SVG

Location: 725,836 - 778,052 nt. (total: 52,217 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
prodigiosin: (PPDK_N and AMP-binding and PP-binding and PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE241_RS03105: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase methyltransferase

IE241_RS03030: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

IE241_RS03085: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase

IE241_RS03035: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

IE241_RS03040: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

IE241_RS03045: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE241_RS03050: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS03055: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

IE241_RS03065: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IE241_RS03075: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE241_RS03110: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

IE241_RS03130: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000091.5	1.22	PKS	marineosin A, marineosin B	Streptomyces sp. CNQ-617
BGC0001063.5	0.99	NRPS, PKS	undecylprodigiosin	Streptomyces coelicolor A3(2)
BGC0001758.4	0.93	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001273.3	0.92	PKS	asperlactone	Aspergillus ochraceus
BGC0001641.4	0.92	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.92	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001276.3	0.92	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.91	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.91	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.91	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000091.5	0.73	PKS	marineosin A, marineosin B	Streptomyces sp. CNQ-617
BGC0001063.5	0.67	NRPS, PKS	undecylprodigiosin	Streptomyces coelicolor A3(2)
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (13):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.81 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.23 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.00 out of 36.54

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.92 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.76 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.79 out of 30.22

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.72 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.37 out of 26.12

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 8, location 725835 - 778052:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2 - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE241_RS03045: NH2 - mal

CAL_domain (48..501): NH2

minowa: NH2

Prediction, score:

NH2: 138.4
fatty_acid: 38.5
AHBA: 9.4
shikimic_acid: 0.0
Acetyl-CoA: -1.6

PKS_AT (1366..1665): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 138.2
inactive: 79.8
Methoxymalonyl-CoA: 64.8
Methylmalonyl-CoA: 54.4
Propionyl-CoA: 33.7
2-Methylbutyryl-CoA: 25.9
Ethylmalonyl-CoA: 21.6
Isobutyryl-CoA: 17.8
Benzoyl-CoA: 16.9
trans-1,2-CPDA: 14.2
Acetyl-CoA: 9.8
fatty_acid: 9.4
CHC-CoA: 9.4
3-Methylbutyryl-CoA: 0.0

IE241_RS03050: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (18..424): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWAAFDLSTFDVYSLFAGEYNLYGPTETNVCTYH
Nearest Stachelhaus code(s):: Pro DLFYLALVCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_BMUT01000001.1 - Region 6 - NAPAA,terpene

Download region GenBank file

Download region SVG

Location: 781,766 - 836,595 nt. (total: 54,830 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE241_RS03190: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

IE241_RS03200: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE241_RS03290: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

IE241_RS03325: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: acetyltransferase aminotransferase transferase

IE241_RS03195: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

IE241_RS03285: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

IE241_RS03360: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: dehydratase hydratase

IE241_RS03205: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

IE241_RS03255: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

IE241_RS03275: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase synthetase

IE241_RS03225: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS03330: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

IE241_RS03355: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.48	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0000663.5	0.47	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002283.2	0.31	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.30	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000777.3	0.30	saccharide	lipopolysaccharide	Escherichia coli
BGC0000916.5	0.29	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000880.4	0.29	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882
BGC0002553.2	0.28	other (other)	tunicamycin	Rathayibacter iranicus
BGC0000786.3	0.28	saccharide	O-antigen	Edwardsiella ictaluri 93-146
BGC0000898.5	0.27	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0000663.5	0.77	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.54	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

IE241_RS03315: PT_phytoene_like

Domain 1 (14 - 281): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

IE241_RS03320: PT_phytoene_like

Domain 1 (17 - 299): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → PSPP; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

IE241_RS03330: PT_FPPS_like

Domain 1 (45 - 337): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

IE241_RS03335: T2TS

Domain 1 (34 - 666): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 25.31

Confidence: medium

Additional weak hits (17):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.56 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.73 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.36 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.82 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.67 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.12 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.55 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.22 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.72 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.01 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.49 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.66 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.07 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.49 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 9, location 781765 - 836595:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 781765 - 815827:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE241_RS03225: X

AMP-binding (37..417): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIVGGEWNTYGPTETTVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (68% 8Å match); Gln or Tyr DAESVGTVVK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUT01000001.1 - Region 7 - NRPS,polyyne,terpene

Download region GenBank file

Download region SVG

Location: 871,819 - 948,331 nt. (total: 76,513 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
polyyne: ((PP-binding_2 or PP-binding) and delta9_cd03505 and delta12_cd03507 and FAAL_cd05931 and (4HBT_2 or Thioesterase or PF00561))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

IE241_RS03545: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

IE241_RS03655: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: kinase

IE241_RS03835: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: esterase hydrolase

IE241_RS03745: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

IE241_RS03760: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

IE241_RS03780: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

Lyases: cyclase lyase

IE241_RS03535: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

IE241_RS03565: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Isomerases: mutase

IE241_RS03790: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

IE241_RS03610: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IE241_RS03620: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS03765: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001746.3	0.94	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000683.3	0.91	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001268.4	0.45	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000892.4	0.45	other (other)	caryoynencin	Burkholderia gladioli BSR3
BGC0000368.5	0.42	NRPS	griseobactin	Streptomyces sp. ATCC 700974
BGC0001833.4	0.38	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.38	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.37	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.37	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.36	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001746.3	0.77	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000683.3	0.76	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000368.5	0.70	NRPS	griseobactin	Streptomyces sp. ATCC 700974
BGC0001641.4	0.69	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

IE241_RS03565: T1TS

Domain 1 (4 - 317): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.81 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.41 out of 27.55

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.08 out of 18.57

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.02 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.03 out of 36.53

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.27 out of 27.04

Confidence: medium

Additional weak hits (24):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.46 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.53 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.81 out of 25.88

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.34 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.44 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.46 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.25 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.12 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.09 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.45 out of 21.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.02 out of 39.62

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.65 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.14 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.99 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.11 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.81 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.47 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.85 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.52 out of 36.53

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.27 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.51 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 871818 - 948331:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg - Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 15, location 901125 - 948331:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE241_RS03620: NH2

CAL_domain (45..503): NH2

minowa: NH2

Prediction, score:

NH2: 105.1
Acetyl-CoA: 48.8
fatty_acid: 14.9
shikimic_acid: 9.3
AHBA: 8.2

IE241_RS03765: Arg - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (474..881): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGHAFDASWDPWDVVVGGEVNLYGPTETTVDAYY
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1542..1954): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis

NZ_BMUT01000001.1 - Region 8 - aminopolycarboxylic-acid

Download region GenBank file

Download region SVG

Location: 1,138,946 - 1,152,447 nt. (total: 13,502 nt) Show pHMM detection rules used

aminopolycarboxylic-acid: (AesA and AesB and AesC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deaminase

IE241_RS04645: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: decarboxylase

IE241_RS04650: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

IE241_RS04655: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001587.5	0.85	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.80	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.69	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0000943.5	0.42	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002487.3	0.37	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0000932.5	0.36	other (other)	tropodithietic acid, hydroxytropodithietic acid	Phaeobacter inhibens DSM 17395
BGC0002573.2	0.35	other (other)	phosphoramidon	Streptomyces mozunensis
BGC0002213.3	0.33	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001790.4	0.33	NRPS	sulfazecin	Pseudomonas acidophila
BGC0000188.5	0.32	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001587.5	0.85	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.80	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.69	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0000943.5	0.42	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002487.3	0.37	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0000932.5	0.36	other (other)	tropodithietic acid, hydroxytropodithietic acid	Phaeobacter inhibens DSM 17395
BGC0002573.2	0.35	other (other)	phosphoramidon	Streptomyces mozunensis
BGC0002213.3	0.33	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001790.4	0.33	NRPS	sulfazecin	Pseudomonas acidophila
BGC0000188.5	0.32	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.57 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.57 out of 36.53

Confidence: medium

Additional weak hits (8):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.25 out of 32.74

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.16 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.18 out of 27.04

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.05 out of 27.55

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.23 out of 36.53

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.92 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.04 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_BMUT01000002.1 - Region 1 - melanin

Download region GenBank file

Download region SVG

Location: 302,281 - 312,685 nt. (total: 10,405 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.78	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.63	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.61	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.57	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.35	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.35	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0002596.2	0.34	PKS	lecanoric acid, orsellinic acid	Claviceps purpurea 20.1
BGC0000889.5	0.34	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.78	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.63	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.61	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.57	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.35	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.35	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0002596.2	0.34	PKS	lecanoric acid, orsellinic acid	Claviceps purpurea 20.1
BGC0000889.5	0.34	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (5):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.94 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.23 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.35 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.39 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.14 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein

NZ_BMUT01000002.1 - Region 2 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 592,553 - 615,342 nt. (total: 22,790 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE241_RS08075: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: glycosyltransferase methyltransferase

IE241_RS08120: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

IE241_RS08125: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.66	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.63	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000553.3	0.59	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000519.4	0.58	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.58	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000513.3	0.58	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000518.3	0.57	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.48	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0001210.5	0.45	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000528.5	0.45	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.66	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.63	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000553.3	0.59	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000519.4	0.58	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.58	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000513.3	0.58	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000518.3	0.57	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.48	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0001210.5	0.45	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000528.5	0.45	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for IE241_RS08085

IE241_RS08090

Leader:

MALLDLQNMESDENTGHGGG

Core:

GQSTVSLLSCVSTASVLICL

Core with dehydrations:

GQDhaDhbVDhaLLDhaCysVDhaDhbADhaVLICysL

antiSMASH-DB 4.0 matches for IE241_RS08090

100.0%

NZ_BMUT01000002.1and 2 others:

NZ_CP040752.1 Lanthipeptides: FGW37_RS09755_lanthipeptideNZ_LNBE01000004.1 Lanthipeptides: AS857_RS19855_lanthipeptide

Lanthipeptides: IE241_RS08090_lanthipeptide

1

GQSTVSLLSCVSTASVLICL

20

GQSTVSLLSCVSTASVLICL

1

GQSTVSLLSCVSTASVLICL

20

90.0%

NZ_WPBY01000022.1:

Lanthipeptides: GO001_RS24105_lanthipeptide

3

STVSLLSCVSTASVLICL

20

STVSLLSCVSTASVLICL

1

STVSLLSCVSTASVLICL

18

85.7%

NZ_CP034587.1:

Lanthipeptides: EKH77_RS09240_lanthipeptide

1

GQSTVSLLSCVSTASVLICL

20

GQSTVSLLSC+STASVL+CL

2

GQSTVSLLSCISTASVLLCL

21

with 64 more sequence matches

Only the first 10 are displayed here.

80.0%

NZ_BBYG01000010.1:

Lanthipeptides: AOQ37_RS09965_lanthipeptide

3

STVSLLSCVSTASVLICL

20

STVSLLSCVS ASVL+CL

1

STVSLLSCVSAASVLLCL

18

80.0%

NZ_CP072827.1:

Lanthipeptides: J7W19_RS28510_lanthipeptide

3

STVSLLSCVSTASVLICL

20

ST SLLSCVSTASVL+CL

1

STASLLSCVSTASVLLCL

18

80.0%

NZ_CP092051.1:

Lanthipeptides: MCU78_RS03785_lanthipeptide

3

STVSLLSCVSTASVLICL

20

STVSLLSCVS ASVL+CL

1

STVSLLSCVSAASVLVCL

18

77.3%

NZ_CP031455.1:

Lanthipeptides: DXZ73_RS14610_lanthipeptide

1

GQSTVSLLSCVSTASVLICL

20

G STVSLLSCVSTAS+L+CL

3

GASTVSLLSCVSTASILLCL

22

75.0%

NC_003155.5and 4 others:

NZ_KB891997.1 Lanthipeptides: B079_RS0125330_lanthipeptideNZ_KB912966.1 Lanthipeptides: B065_RS0120870_lanthipeptideNZ_MLCE01000039.1 Lanthipeptides: BKI49_RS34310_lanthipeptideNZ_MQUS01000001.1 Lanthipeptides: AV521_RS02305_lanthipeptide

Lanthipeptides: SAVERM_RS38515_lanthipeptide

4

TVSLLSCVSTASVLICL

20

TVSLLSCVS ASVL+CL

1

TVSLLSCVSAASVLLCL

17

75.0%

NZ_BMSE01000001.1and 20 others:

NZ_BMTM01000009.1 Lanthipeptides: IE213_RS27820_lanthipeptideNZ_BMUK01000002.1 Lanthipeptides: IE276_RS03565_lanthipeptideNZ_BMUO01000001.1 Lanthipeptides: IE232_RS00145_lanthipeptideNZ_CP015098.1 Lanthipeptides: A4E84_RS37870_lanthipeptideNZ_CP041604.2 Lanthipeptides: FNV64_RS48055_lanthipeptideNZ_CP041610.2 Lanthipeptides: FNV62_RS46395_lanthipeptideNZ_CP041611.1 Lanthipeptides: FNV63_RS47280_lanthipeptideNZ_CP041613.2 Lanthipeptides: FNV68_RS48480_lanthipeptideNZ_CP041650.2 Lanthipeptides: FNV59_RS47040_lanthipeptideNZ_CP049838.1 Lanthipeptides: G9272_RS40085_lanthipeptideNZ_JACHCX010000007.1 Lanthipeptides: HDC93_RS16065_lanthipeptideNZ_JACHGV010000013.1 Lanthipeptides: HNR57_RS32395_lanthipeptideNZ_JACHXE010000001.1 Lanthipeptides: FHS41_RS01865_lanthipeptideNZ_KB911710.1 Lanthipeptides: H294_RS0120310_lanthipeptideNZ_KQ948484.1 Lanthipeptides: AQJ27_RS46770_lanthipeptideNZ_KQ948484.1 Lanthipeptides: AQJ27_RS46770_lanthipeptideNZ_KZ671983.1 Lanthipeptides: BV882_RS30460_lanthipeptideNZ_LMEQ01000023.1 Lanthipeptides: ASD48_RS25330_lanthipeptideNZ_LMIZ01000012.1 Lanthipeptides: ASE41_RS11285_lanthipeptideNZ_QFRX01000001.1 Lanthipeptides: DI272_RS05815_lanthipeptide

Lanthipeptides: IE153_RS00140_lanthipeptide

3

STVSLLSCVSTASVLICL

20

STVSLLSC+S ASVL+CL

1

STVSLLSCISAASVLLCL

18

75.0%

NZ_BMSI01000009.1:

Lanthipeptides: IE189_RS23215_lanthipeptide

3

STVSLLSCVSTASVLICL

20

STVSLLSCVS SVL+CL

1

STVSLLSCVSATSVLLCL

18

70.0%

NZ_AUKV01000001.1and 12 others:

NZ_BMWC01000009.1 Lanthipeptides: IE255_RS28335_lanthipeptideNZ_BNBR01000001.1 Lanthipeptides: IE308_RS02895_lanthipeptideNZ_CP023694.1 Lanthipeptides: CP976_RS39235_lanthipeptideNZ_CP026121.1 Lanthipeptides: C1703_RS37710_lanthipeptideNZ_CP029788.1 Lanthipeptides: DMT42_RS35020_lanthipeptideNZ_CP049780.1 Lanthipeptides: G7Z13_RS32285_lanthipeptideNZ_CP075896.1 Lanthipeptides: KJK29_RS01685_lanthipeptideNZ_CP094344.1 Lanthipeptides: MQE23_RS40865_lanthipeptideNZ_GG657757.1 Lanthipeptides: SSQG_RS35880_lanthipeptideNZ_JAPJYN010000013.1 Lanthipeptides: OR263_RS25210_lanthipeptideNZ_LIVZ01000003.1 Lanthipeptides: AMK31_RS09050_lanthipeptideNZ_LT963352.1 Lanthipeptides: SCNRRL3882_RS38195_lanthipeptide

Lanthipeptides: H305_RS0100085_lanthipeptide

4

TVSLLSCVSTASVLICL

20

TVSLLSC+S ASVL+CL

1

TVSLLSCISAASVLLCL

17

70.0%

NZ_BCMN01000008.1and 18 others:

NZ_CP016438.1 Lanthipeptides: SLINC_RS40935_lanthipeptideNZ_CP028834.1 Lanthipeptides: DBP13_RS03385_lanthipeptideNZ_CP032427.1 Lanthipeptides: DWG14_RS04755_lanthipeptideNZ_CP041168.1 Lanthipeptides: FJ654_RS37200_lanthipeptideNZ_CP063808.1 Lanthipeptides: IOD14_RS17380_lanthipeptideNZ_CP089312.1 Lanthipeptides: LUX31_RS01980_lanthipeptideNZ_CP090447.1 Lanthipeptides: LXH13_RS36110_lanthipeptideNZ_CP114283.1 Lanthipeptides: O1Q96_RS29865_lanthipeptideNZ_KB911777.1 Lanthipeptides: H295_RS0107720_lanthipeptideNZ_KE150426.1 Lanthipeptides: HMPREF1211_RS03610_lanthipeptideNZ_KQ948146.1 Lanthipeptides: AQI94_RS13060_lanthipeptideNZ_KQ948176.1 Lanthipeptides: AQI84_RS04025_lanthipeptideNZ_KQ948306.1 Lanthipeptides: AQI96_RS09745_lanthipeptideNZ_KQ948656.1 Lanthipeptides: AQJ46_RS04035_lanthipeptideNZ_KQ948737.1 Lanthipeptides: AQJ54_RS21815_lanthipeptideNZ_MJAH01000003.1 Lanthipeptides: BFN33_RS10675_lanthipeptideNZ_PZZX01000020.1 Lanthipeptides: C7821_RS36345_lanthipeptideNZ_SLYY01000001.1 Lanthipeptides: EV578_RS04115_lanthipeptide

Lanthipeptides: AV140_RS18455_lanthipeptide

3

STVSLLSCVSTASVLICL

20

ST+SLLSCVS ASV +CL

1

STLSLLSCVSAASVTLCL

18

70.0%

NZ_CM002285.1and 2 others:

NZ_CP047020.1 Lanthipeptides: GQF42_RS39440_lanthipeptideNZ_VISR01000012.1 Lanthipeptides: FB157_RS21700_lanthipeptide

Lanthipeptides: M878_RS54195_lanthipeptide

4

TVSLLSCVSTASVLICL

20

TVSLLSCVS AS+L+CL

1

TVSLLSCVSAASILLCL

17

MIBiG 4.0 matches for IE241_RS08090

45.5%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

3

STVSLLSC-VSTASVLIC

19

S VSLL C S+ SV++C

3

SQVSLLVCEYSSLSVVLC

20

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (7):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.54 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.25 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.36 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.45 out of 21.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.70 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.98 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

IE241_RS08090 - Class III

Cleavage pHMM score: 13.90

RODEO score: 0

Monoisotopic mass: 1854.0 Da

Molecular weight: 1855.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1873.2 Da N = 1; 1891.2 Da N = 2; 1909.3 Da N = 3; 1927.3 Da N = 4; 1945.3 Da N = 5

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUT01000003.1 - Region 1 - CDPS

Download region GenBank file

Download region SVG

Location: 30,787 - 51,525 nt. (total: 20,739 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002194.3	0.28	PKS	epipyrone A	Epicoccum nigrum
BGC0001954.2	0.27	NRPS, PKS	wortmanamide A, wortmanamide B	Talaromyces wortmannii
BGC0002464.3	0.27	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002058.3	0.27	NRPS, PKS	mutanocyclin	Streptococcus mutans B04Sm5
BGC0002287.2	0.27	NRPS	mutanocyclin, leuvalin, tyrvalin	Streptococcus mutans
BGC0001336.5	0.26	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0000678.5	0.25	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002471.3	0.25	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0001440.5	0.23	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0001301.5	0.23	PKS	anthracimycin	Streptomyces sp. T676

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002194.3	0.28	PKS	epipyrone A	Epicoccum nigrum
BGC0001954.2	0.27	NRPS, PKS	wortmanamide A, wortmanamide B	Talaromyces wortmannii
BGC0002464.3	0.27	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002058.3	0.27	NRPS, PKS	mutanocyclin	Streptococcus mutans B04Sm5
BGC0002287.2	0.27	NRPS	mutanocyclin, leuvalin, tyrvalin	Streptococcus mutans
BGC0001336.5	0.26	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0000678.5	0.25	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002471.3	0.25	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0001440.5	0.23	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0001301.5	0.23	PKS	anthracimycin	Streptomyces sp. T676

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

Additional weak hits (1):

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.14 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUT01000003.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 95,547 - 116,596 nt. (total: 21,050 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE241_RS09250: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Transferases: acetyltransferase

IE241_RS09215: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Lyases: cyclase dehydratase

IE241_RS09265: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

IE241_RS09270: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001972.4	0.41	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001778.5	0.36	other (other)	showdomycin	Streptomyces showdoensis
BGC0001336.5	0.35	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001440.5	0.33	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0000275.4	0.32	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001322.3	0.32	terpene	lycosantalonol, β-phellandrene	Solanum lycopersicum
BGC0001321.3	0.31	terpene	monoterpenes-diterpenes	Solanum habrochaites
BGC0000466.5	0.31	NRPS	yatakemycin	Streptomyces sp. TP-A2060
BGC0002387.2	0.31	PKS	yangpumicin A	Micromonospora yangpuensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001972.4	0.41	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001778.5	0.36	other (other)	showdomycin	Streptomyces showdoensis
BGC0001336.5	0.35	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001440.5	0.33	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0000275.4	0.32	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001322.3	0.32	terpene	lycosantalonol, β-phellandrene	Solanum lycopersicum
BGC0001321.3	0.31	terpene	monoterpenes-diterpenes	Solanum habrochaites
BGC0000466.5	0.31	NRPS	yatakemycin	Streptomyces sp. TP-A2060
BGC0002387.2	0.31	PKS	yangpumicin A	Micromonospora yangpuensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

IE241_RS09270: T1TS

Domain 1 (12 - 322): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BMUT01000003.1 - Region 3 - NI-siderophore,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 160,779 - 199,350 nt. (total: 38,572 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

IE241_RS09480: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: dehalogenase protease

IE241_RS09545: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

IE241_RS09580: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001499.5	0.34	other (other)	aerobactin	Pantoea ananatis
BGC0002013.4	0.32	ribosomal	curacozole	Streptomyces curacoi
BGC0000608.5	0.31	ribosomal	nocathiacin I	Actinokineospora fastidiosa
BGC0000946.5	0.31	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001174.4	0.30	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0000569.5	0.28	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001173.5	0.28	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0002527.2	0.27	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.27	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0001860.4	0.26	ribosomal	thiomuracin	Thermobispora bispora DSM 43833

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001499.5	0.48	other (other)	aerobactin	Pantoea ananatis
BGC0002013.4	0.47	ribosomal	curacozole	Streptomyces curacoi
BGC0000608.5	0.46	ribosomal	nocathiacin I	Actinokineospora fastidiosa
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001174.4	0.45	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0000569.5	0.43	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001173.5	0.43	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0002527.2	0.42	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.42	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0001860.4	0.41	ribosomal	thiomuracin	Thermobispora bispora DSM 43833

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.52 out of 23.43

Confidence: medium

Additional weak hits (9):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.04 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.04 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.94 out of 23.43

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.16 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.39 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.39 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.81 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.62 out of 28.19

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

TFBS Finder

Azole RiPPs

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein

Core peptide predictions

No core peptides found.

NZ_BMUT01000003.1 - Region 4 - T1PKS

Download region GenBank file

Download region SVG

Location: 204,954 - 313,577 nt. (total: 108,624 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE241_RS09695: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE241_RS09700: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE241_RS09705: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE241_RS09735: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE241_RS09765: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

IE241_RS09770: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE241_RS09825: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: acylase

IE241_RS09720: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase hydrolase

IE241_RS09655: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IE241_RS09795: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: dehydratase hydratase

IE241_RS09750: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

IE241_RS09755: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: synthase

IE241_RS09710: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

IE241_RS09715: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE241_RS09725: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

IE241_RS09730: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002032.4	0.75	PKS	pentamycin	Streptomyces sp. S816
BGC0002789.2	0.74	PKS	pentamycin, filipin	Streptomyces lavendulae strain YAKB-15
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000059.5	0.73	PKS	filipin	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002032.4	0.75	PKS	pentamycin	Streptomyces sp. S816
BGC0002789.2	0.74	PKS	pentamycin, filipin	Streptomyces lavendulae strain YAKB-15
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000059.5	0.73	PKS	filipin	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (14):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.52 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.87 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.00 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.32 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.43 out of 21.55

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.14 out of 32.93

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.35 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 204953 - 313577:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ohmal - ccmal - ccmal - ccmal) + (ccmal - pk) + (ccmal) + (ohmal - ohmal - ohmal - ohmal) + (ohmal - pk)
Non-colinear ordering:: IE241_RS09730 + IE241_RS09725 + IE241_RS09720 + IE241_RS09715 + IE241_RS09710

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE241_RS09710: mal - pk

PKS_AT (562..838): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.0
inactive: 119.7
Methoxymalonyl-CoA: 74.0
Methylmalonyl-CoA: 67.4
Propionyl-CoA: 35.0
Ethylmalonyl-CoA: 33.6
Isobutyryl-CoA: 32.0
Benzoyl-CoA: 31.6
CHC-CoA: 25.0
Acetyl-CoA: 23.7
2-Methylbutyryl-CoA: 23.2
trans-1,2-CPDA: 20.0
fatty_acid: 13.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (2072..2369): pk

ATSignature: Methoxymalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%; Methylmalonyl-CoA: 75.0%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 200.1
Methylmalonyl-CoA: 190.6
Methoxymalonyl-CoA: 169.6
2-Methylbutyryl-CoA: 133.7
trans-1,2-CPDA: 129.3
Propionyl-CoA: 104.7
Isobutyryl-CoA: 102.0
CHC-CoA: 94.6
Malonyl-CoA: 93.2
Benzoyl-CoA: 71.9
Acetyl-CoA: 55.8
fatty_acid: 40.1
inactive: 36.7
3-Methylbutyryl-CoA: 35.3

IE241_RS09715: mal - mal - mal - mal

PKS_AT (568..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 210.2
inactive: 111.4
Methoxymalonyl-CoA: 56.9
Methylmalonyl-CoA: 52.9
Propionyl-CoA: 27.2
Benzoyl-CoA: 25.1
Isobutyryl-CoA: 20.9
Acetyl-CoA: 20.3
Ethylmalonyl-CoA: 19.0
CHC-CoA: 18.8
2-Methylbutyryl-CoA: 14.2
trans-1,2-CPDA: 10.9
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2085..2362): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 212.6
inactive: 103.7
Methoxymalonyl-CoA: 59.2
Methylmalonyl-CoA: 54.1
Propionyl-CoA: 28.6
Benzoyl-CoA: 26.0
Ethylmalonyl-CoA: 22.2
Acetyl-CoA: 21.1
Isobutyryl-CoA: 18.8
CHC-CoA: 16.4
2-Methylbutyryl-CoA: 16.2
trans-1,2-CPDA: 12.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3601..3889): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 222.4
inactive: 121.6
Methoxymalonyl-CoA: 68.9
Methylmalonyl-CoA: 56.5
Propionyl-CoA: 32.4
Benzoyl-CoA: 24.2
Isobutyryl-CoA: 23.7
Acetyl-CoA: 19.5
Ethylmalonyl-CoA: 17.8
2-Methylbutyryl-CoA: 13.5
trans-1,2-CPDA: 13.0
CHC-CoA: 7.1
3-Methylbutyryl-CoA: 7.0
fatty_acid: 6.2

PKS_AT (5129..5403): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.4
inactive: 110.6
Methoxymalonyl-CoA: 62.8
Methylmalonyl-CoA: 57.5
Propionyl-CoA: 33.1
Acetyl-CoA: 25.6
Ethylmalonyl-CoA: 23.8
Benzoyl-CoA: 21.0
Isobutyryl-CoA: 20.4
2-Methylbutyryl-CoA: 19.5
CHC-CoA: 17.5
trans-1,2-CPDA: 15.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

IE241_RS09720: mal

PKS_AT (570..849): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 204.7
inactive: 105.2
Methoxymalonyl-CoA: 52.4
Methylmalonyl-CoA: 48.0
Propionyl-CoA: 25.9
Acetyl-CoA: 20.1
Isobutyryl-CoA: 18.2
Benzoyl-CoA: 15.9
CHC-CoA: 14.1
Ethylmalonyl-CoA: 13.7
2-Methylbutyryl-CoA: 12.1
trans-1,2-CPDA: 9.3
fatty_acid: 6.9
3-Methylbutyryl-CoA: 0.0

IE241_RS09725: mal - pk

PKS_AT (587..868): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 206.9
inactive: 107.3
Methoxymalonyl-CoA: 58.6
Methylmalonyl-CoA: 52.0
Propionyl-CoA: 28.7
Benzoyl-CoA: 26.4
2-Methylbutyryl-CoA: 21.8
Acetyl-CoA: 21.1
Isobutyryl-CoA: 19.3
Ethylmalonyl-CoA: 19.3
trans-1,2-CPDA: 15.1
CHC-CoA: 13.0
fatty_acid: 5.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (2372..2680): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 191.8
Methylmalonyl-CoA: 187.5
Methoxymalonyl-CoA: 155.2
2-Methylbutyryl-CoA: 139.3
trans-1,2-CPDA: 126.9
Propionyl-CoA: 107.6
CHC-CoA: 87.2
Isobutyryl-CoA: 73.8
Malonyl-CoA: 73.5
Benzoyl-CoA: 64.0
Acetyl-CoA: 43.7
fatty_acid: 28.7
inactive: 15.1
3-Methylbutyryl-CoA: 11.7

IE241_RS09730: mal - mal - mal - mal - mal

PKS_AT (570..870): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 222.8
inactive: 118.0
Methoxymalonyl-CoA: 70.6
Methylmalonyl-CoA: 56.7
Isobutyryl-CoA: 38.7
Propionyl-CoA: 33.3
Benzoyl-CoA: 19.6
Acetyl-CoA: 16.8
Ethylmalonyl-CoA: 14.8
trans-1,2-CPDA: 14.7
2-Methylbutyryl-CoA: 12.0
fatty_acid: 9.3
CHC-CoA: 7.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (1610..1889): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 212.7
inactive: 110.9
Methoxymalonyl-CoA: 58.8
Methylmalonyl-CoA: 56.0
Propionyl-CoA: 35.2
Acetyl-CoA: 24.7
Isobutyryl-CoA: 22.4
Ethylmalonyl-CoA: 21.7
CHC-CoA: 16.5
Benzoyl-CoA: 15.4
2-Methylbutyryl-CoA: 14.8
trans-1,2-CPDA: 8.6
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3120..3401): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.4
inactive: 110.7
Methoxymalonyl-CoA: 62.5
Methylmalonyl-CoA: 61.3
Propionyl-CoA: 34.4
Ethylmalonyl-CoA: 27.2
Acetyl-CoA: 25.9
Isobutyryl-CoA: 25.4
2-Methylbutyryl-CoA: 22.4
Benzoyl-CoA: 21.7
CHC-CoA: 17.6
trans-1,2-CPDA: 16.3
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (4848..5129): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 212.1
inactive: 113.8
Methoxymalonyl-CoA: 58.8
Methylmalonyl-CoA: 54.0
Propionyl-CoA: 32.5
Acetyl-CoA: 23.8
Ethylmalonyl-CoA: 23.0
Benzoyl-CoA: 20.8
Isobutyryl-CoA: 20.2
CHC-CoA: 19.0
2-Methylbutyryl-CoA: 19.0
trans-1,2-CPDA: 10.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (6540..6813): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 206.9
inactive: 111.3
Methoxymalonyl-CoA: 57.9
Methylmalonyl-CoA: 53.7
Propionyl-CoA: 34.5
Acetyl-CoA: 23.9
Ethylmalonyl-CoA: 23.7
Isobutyryl-CoA: 21.5
Benzoyl-CoA: 20.2
2-Methylbutyryl-CoA: 19.2
CHC-CoA: 16.6
trans-1,2-CPDA: 13.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_BMUT01000003.1 - Region 5 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 406,065 - 462,440 nt. (total: 56,376 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

IE241_RS10220: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE241_RS10260: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE241_RS10375: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Hydrolases: esterase

IE241_RS10270: thioesterase

smcogs: SMCOG1004: thioesterase

IE241_RS10285: thioesterase

smcogs: SMCOG1004: thioesterase

IE241_RS10350: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

IE241_RS10265: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS10295: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE241_RS10300: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS10305: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE241_RS10310: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS10330: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE241_RS10335: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS10345: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE241_RS10370: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE241_RS10380: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	2.24	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001251.4	1.94	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	1.94	NRPS	epichloenin A	Epichloe festucae
BGC0001132.4	1.89	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.87	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.86	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.85	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	1.84	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	1.81	NRPS	peramine	Epichloe festucae
BGC0001641.4	1.77	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.75	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001251.4	0.71	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.71	NRPS	epichloenin A	Epichloe festucae
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.69	NRPS	peramine	Epichloe festucae
BGC0001641.4	0.68	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.46 out of 26.85

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

Additional weak hits (12):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.75 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.55 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.80 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.97 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.52 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.46 out of 26.85

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.61 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.51 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.29 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.17 out of 21.55

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.69 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 406064 - 462440:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (NH2 - X) + (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 406064 - 447849:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (NH2 - X) + (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 412313 - 457172:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (NH2 - X) + (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 417176 - 460608:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (NH2 - X) + (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 11, location 420619 - 462440:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (NH2 - X) + (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE241_RS10265: X

AMP-binding (12..410): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FADSFDTFTFERLACSGGDFNLYGPTEATVACTG
Nearest Stachelhaus code(s):: Leu DAFLHGLTAK (68% 8Å match); Ala DVFFVGLVAK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

IE241_RS10295: mal

PKS_AT (536..825): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 131.0
inactive: 67.7
Methoxymalonyl-CoA: 48.7
Methylmalonyl-CoA: 45.7
Propionyl-CoA: 21.6
Isobutyryl-CoA: 17.5
fatty_acid: 13.4
Ethylmalonyl-CoA: 9.0
CHC-CoA: 8.8
2-Methylbutyryl-CoA: 8.0
Benzoyl-CoA: 6.9
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

IE241_RS10300: X

AMP-binding (25..385): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWCLFDFGLQETFTLLGGEFNGYGPTEATVNCLM
Nearest Stachelhaus code(s):: Phe DCFFLGGVFK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

IE241_RS10305: NH2

CAL_domain (151..459): NH2

minowa: NH2

Prediction, score:

NH2: 115.0
Acetyl-CoA: 30.8
fatty_acid: 25.0
shikimic_acid: 0.0
AHBA: 0.0

IE241_RS10310: X

AMP-binding (25..420): X

nrpys: Gln, Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LALAFDASVQQRDILVGGEVNLYGPTECTVDATV
Nearest Stachelhaus code(s):: Gln or Glu DAQDLGVVDK (79% 8Å match); Ile DAQDLGVVDK (79% 8Å match); Gln DAQDLGVVDK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

IE241_RS10335: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (17..421): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: MDAHFDVSVWEAHITFCGECNVYGITESTVYNTF
Nearest Stachelhaus code(s):: Ala DVFSLAVVYK (56% 8Å match); Ser DVWHISLVDK (50% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
RutR	Regulator of the pyrimidine and purine metabolism

NZ_BMUT01000004.1 - Region 1 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 54,571 - 67,694 nt. (total: 13,124 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

IE241_RS11180: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

IE241_RS11190: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Lyases: decarboxylase

IE241_RS11205: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000694.3	0.30	saccharide	butirosin	Bacillus circulans
BGC0000997.4	0.28	NRPS, PKS	glidobactin, glidobactin B, glidobactin C	[Polyangium] brachysporum
BGC0000693.5	0.27	saccharide	butirosin A, butirosin B	Bacillus circulans
BGC0000291.5	0.24	NRPS	A54145	Streptomyces fradiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000694.3	0.30	saccharide	butirosin	Bacillus circulans
BGC0000997.4	0.28	NRPS, PKS	glidobactin, glidobactin B, glidobactin C	[Polyangium] brachysporum
BGC0000693.5	0.27	saccharide	butirosin A, butirosin B	Bacillus circulans
BGC0000291.5	0.24	NRPS	A54145	Streptomyces fradiae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.02 out of 27.18

Confidence: medium

Additional weak hits (1):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.79 out of 25.75

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
NrdR	Represses ribonucleotide reductase encoding genes

NZ_BMUT01000005.1 - Region 1 - melanin

Download region GenBank file

Download region SVG

Location: 304,660 - 315,025 nt. (total: 10,366 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000912.3	0.78	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.60	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.56	other (other)	melanin	Streptomyces avermitilis
BGC0000909.3	0.53	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.35	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.35	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.34	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.24	other (other)	iso-A82775C	Pestalotiopsis fici

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000912.3	0.78	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.60	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.56	other (other)	melanin	Streptomyces avermitilis
BGC0000909.3	0.53	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.35	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.35	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.34	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.24	other (other)	iso-A82775C	Pestalotiopsis fici

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.73 out of 30.22

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.57 out of 24.78

Confidence: medium

Additional weak hits (5):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.68 out of 30.22

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.57 out of 26.85

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.77 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.39 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
ClgR	Caseinolytic protease gene regulator
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response

NZ_BMUT01000007.1 - Region 1 - butyrolactone

Download region GenBank file

Download region SVG

Location: 1 - 9,905 nt. (total: 9,905 nt) Show pHMM detection rules used

Region on contig edge.

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE241_RS17005: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.77	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.75	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.69	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000231.5	0.35	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000188.5	0.34	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000234.5	0.34	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002514.3	0.33	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0000667.3	0.32	terpene	PR-toxin	Penicillium roqueforti FM164

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.77	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.75	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.69	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000231.5	0.35	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000188.5	0.34	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000234.5	0.34	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002514.3	0.33	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0000667.3	0.32	terpene	PR-toxin	Penicillium roqueforti FM164

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.68 out of 20.97

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.59 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.91 out of 29.25

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.30 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.18 out of 32.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMUT01000007.1 - Region 2 - crocagin

Download region GenBank file

Download region SVG

Location: 37,243 - 65,282 nt. (total: 28,040 nt) Show pHMM detection rules used

crocagin: (PhyH and Carbam_trans_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase reductase

IE241_RS17170: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IE241_RS17225: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Transferases: aminotransferase

IE241_RS17260: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: esterase peptidase

IE241_RS17180: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

IE241_RS17190: putative esterase

smcogs: SMCOG1104: putative esterase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000820.5	0.50	other (other)	physostigmine	Streptomyces griseofuscus
BGC0001488.3	0.48	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0002659.2	0.45	ribosomal	TvgA-RiPP	Halomonas anticariensis FP35 = DSM 16096
BGC0000657.5	0.43	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000188.5	0.42	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001903.3	0.42	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0000877.5	0.39	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0001223.5	0.39	other (other)	hydroxysporine	uncultured bacterium
BGC0000627.4	0.39	ribosomal	ustiloxin B	Aspergillus flavus NRRL3357
BGC0001782.3	0.37	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000820.5	0.50	other (other)	physostigmine	Streptomyces griseofuscus
BGC0001488.3	0.48	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0002659.2	0.45	ribosomal	TvgA-RiPP	Halomonas anticariensis FP35 = DSM 16096
BGC0000657.5	0.43	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000188.5	0.42	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001903.3	0.42	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0000877.5	0.39	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0001223.5	0.39	other (other)	hydroxysporine	uncultured bacterium
BGC0000627.4	0.39	ribosomal	ustiloxin B	Aspergillus flavus NRRL3357
BGC0001782.3	0.37	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.62 out of 23.79

Confidence: medium

Additional weak hits (7):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.23 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.41 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.58 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.41 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.38 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.99 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.92 out of 30.22

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_BMUT01000007.1 - Region 3 - T1PKS,terpene

Download region GenBank file

Download region SVG

Location: 162,484 - 208,367 nt. (total: 45,884 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase synthase

IE241_RS17740: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IE241_RS17830: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Transferases: methyltransferase

IE241_RS17840: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE241_RS17880: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: synthase

IE241_RS17830: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Lyases: cyclase

IE241_RS17760: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

IE241_RS17800: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	1.10	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000683.3	0.89	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001746.3	0.89	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0001959.4	0.60	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0001276.3	0.32	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.31	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.31	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.31	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002134.4	0.30	other (other)	leupeptin A, leupeptin B, leupeptin D, leupeptin C	Xenorhabdus bovienii SS-2004
BGC0001336.5	0.29	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001959.4	0.84	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000683.3	0.75	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

IE241_RS17760: T1TS + T1TS

Domain 1 (3 - 325): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (326 - 709): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.17 out of 23.79

Confidence: medium

Additional weak hits (14):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.08 out of 26.85

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.49 out of 28.14

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.54 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.13 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.60 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.45 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.84 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.84 out of 30.25

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.76 out of 20.01

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.07 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.79 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.28 out of 26.06

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.53 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 162483 - 208367:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 164476 - 208367:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE241_RS17775: X

AMP-binding (486..693): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GAAF----CGGGFGFYGGEVH-------SITYGS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

IE241_RS17795: X

AMP-binding (53..309): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAGA----VGSLAGFFGGEY-------ASVDAGL
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

IE241_RS17800: pk

PKS_AT (542..835): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 70.8%; Ethylmalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 131.1
Ethylmalonyl-CoA: 111.0
Methoxymalonyl-CoA: 101.2
Malonyl-CoA: 99.1
2-Methylbutyryl-CoA: 78.3
Propionyl-CoA: 71.5
Isobutyryl-CoA: 71.1
trans-1,2-CPDA: 65.9
CHC-CoA: 54.5
Acetyl-CoA: 50.5
Benzoyl-CoA: 44.4
3-Methylbutyryl-CoA: 42.5
fatty_acid: 37.0
inactive: 33.7

Link to PARAS substrate predictor

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_BMUT01000007.1 - Region 4 - triceptide

Download region GenBank file

Download region SVG

Location: 245,477 - 266,811 nt. (total: 21,335 nt) Show pHMM detection rules used

triceptide: ((cds(PF04055 and (TIGR04085 or SPASM)) and triceptide_precursor) or triceptide_rSAM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE241_RS18120: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Lyases: decarboxylase

IE241_RS18070: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Translocases: transporter

IE241_RS18135: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002527.2	0.44	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000946.5	0.43	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0000882.5	0.43	other (other)	mildiomycin	Streptomyces rimofaciens
BGC0002042.3	0.41	NRPS	anthelvencin A, anthelvencin B, anthelvencin C	Streptomyces venezuelae
BGC0001553.5	0.41	NRPS, PKS	clifednamide A	Streptomyces sp. JV178
BGC0000947.5	0.40	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001488.3	0.39	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0002358.3	0.39	PKS	cyclofaulknamycin	Streptomyces albidoflavus
BGC0000188.5	0.38	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000874.5	0.38	other (other)	blasticidin S	Streptomyces griseochromogenes

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002527.2	0.44	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000946.5	0.43	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0000882.5	0.43	other (other)	mildiomycin	Streptomyces rimofaciens
BGC0002042.3	0.41	NRPS	anthelvencin A, anthelvencin B, anthelvencin C	Streptomyces venezuelae
BGC0001553.5	0.41	NRPS, PKS	clifednamide A	Streptomyces sp. JV178
BGC0000947.5	0.40	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001488.3	0.39	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0002358.3	0.39	PKS	cyclofaulknamycin	Streptomyces albidoflavus
BGC0000188.5	0.38	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000874.5	0.38	other (other)	blasticidin S	Streptomyces griseochromogenes

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.88 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.79 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.20 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.63 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.33 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMUT01000007.1 - Region 5 - T1PKS,deazapurine,hglE-KS

Download region GenBank file

Download region SVG

Location: 270,620 - 356,355 nt. (total: 85,736 nt) Show pHMM detection rules used

deazapurine: (GTP_cyclohydroI and PTPS and QueE and QueC and not (dpdA1 or bTGT))
hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE241_RS18295: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

IE241_RS18460: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: acylase

IE241_RS18280: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

IE241_RS18270: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

IE241_RS18410: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

IE241_RS18465: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: lyase

IE241_RS18225: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

IE241_RS18255: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: synthase

IE241_RS18180: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

IE241_RS18290: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE241_RS18390: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

IE241_RS18395: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002354.4	0.60	other (other)	huimycin	Kutzneria albida DSM 43870
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001937.4	0.52	other (other)	tubercidin	Streptomyces tubercidicus
BGC0001160.5	0.51	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.51	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000802.5	0.51	saccharide	succinoglycan	Sinorhizobium meliloti
BGC0001808.5	0.44	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0000881.3	0.44	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002354.4	0.64	other (other)	huimycin	Kutzneria albida DSM 43870
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000802.5	0.61	saccharide	succinoglycan	Sinorhizobium meliloti
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.52 out of 28.19

Confidence: medium

Additional weak hits (30):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.03 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.28 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.41 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.05 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.24 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.02 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.54 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.02 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.74 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.92 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.21 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.45 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.29 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.31 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.49 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.24 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.77 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.51 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.91 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.75 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.68 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.06 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.47 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.93 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 270619 - 356355:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Me-pk)
Non-colinear ordering:: IE241_RS18290 + IE241_RS18390

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 277747 - 323795:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 308756 - 356355:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE241_RS18290: mal

PKS_AT (569..864): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 76.0
Methoxymalonyl-CoA: 38.9
Methylmalonyl-CoA: 38.6
inactive: 30.1
fatty_acid: 25.0
Isobutyryl-CoA: 24.1
Ethylmalonyl-CoA: 18.0
Propionyl-CoA: 16.6
CHC-CoA: 14.3
Acetyl-CoA: 14.1
trans-1,2-CPDA: 12.6
2-Methylbutyryl-CoA: 11.2
Benzoyl-CoA: 8.2
3-Methylbutyryl-CoA: 0.0

IE241_RS18390: pk

PKS_AT (556..851): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 66.7%; CE-Malonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 102.1
Malonyl-CoA: 94.0
Methoxymalonyl-CoA: 90.3
Isobutyryl-CoA: 59.3
Ethylmalonyl-CoA: 54.2
Propionyl-CoA: 52.5
trans-1,2-CPDA: 43.1
Benzoyl-CoA: 38.1
fatty_acid: 37.2
CHC-CoA: 31.7
2-Methylbutyryl-CoA: 30.4
inactive: 16.4
Acetyl-CoA: 13.1
3-Methylbutyryl-CoA: 9.1

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ZuR variant 1	Zinc-responsive repressor

NZ_BMUT01000007.1 - Region 6 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 363,445 - 412,151 nt. (total: 48,707 nt) Show pHMM detection rules used

Region on contig edge.

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE241_RS18620: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: aminotransferase kinase

IE241_RS18625: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

IE241_RS18630: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

Ligases: ligase

IE241_RS18600: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE241_RS34640: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE241_RS34990: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001752.4	1.03	NRPS	qinichelins	Streptomyces sp. MBT76
BGC0002135.2	0.88	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.83	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.81	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.77	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.76	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001752.4	0.79	NRPS	qinichelins	Streptomyces sp. MBT76
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.71	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 33.62 out of 36.53

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.90 out of 36.53

Confidence: medium

Additional weak hits (5):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.54 out of 20.01

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.43 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.95 out of 36.53

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.63 out of 32.93

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.56 out of 39.62

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 11, location 363444 - 412151:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ser - Orn - D-Ser) + (Ser) + (OH-Orn - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE241_RS18600: Ser - OH-Orn - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (9..408): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWELHFFCSGEHNLYGPTEAAVDVTY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1085..1490): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2148..2557): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

IE241_RS34640: Ser - Orn - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (475..891): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEHNLYGPTEAAVDVTY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match); Ala or Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2236..2654): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MHHAFDSSWEQWDVLLGGEHNFYGPTEYTVDTLG
Nearest Stachelhaus code(s):: Orn DSEDLGFVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3315..3714): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWELHFFCSGEHNLYGPTEAAVDVTH
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match); Ala or Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUT01000009.1 - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 1 - 47,120 nt. (total: 47,120 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IE241_RS20350: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE241_RS20375: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE241_RS20380: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

IE241_RS20385: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE241_RS20420: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE241_RS20440: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

IE241_RS20450: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

IE241_RS34835: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: PPTase aminotransferase glycosyltransferase methyltransferase transferase

IE241_RS20425: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

IE241_RS20445: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

IE241_RS20465: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

IE241_RS20470: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

IE241_RS20475: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE241_RS20480: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: cyclase dehydratase

IE241_RS20410: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

IE241_RS20485: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

IE241_RS20395: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE241_RS20400: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

IE241_RS20550: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001960.2	0.86	PKS	hiroshidine	Streptomyces hiroshimensis
BGC0000231.5	0.70	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000278.3	0.63	PKS	urdamycin	Streptomyces fradiae
BGC0001723.5	0.62	PKS	oviedomycin	Streptomyces antibioticus
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0000275.4	0.59	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000271.5	0.56	PKS	spore pigment	Streptomyces avermitilis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001960.2	0.86	PKS	hiroshidine	Streptomyces hiroshimensis
BGC0000231.5	0.70	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000278.3	0.63	PKS	urdamycin	Streptomyces fradiae
BGC0001723.5	0.62	PKS	oviedomycin	Streptomyces antibioticus
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0000275.4	0.59	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000271.5	0.56	PKS	spore pigment	Streptomyces avermitilis

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (7):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.90 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.28 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.39 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.42 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.78 out of 29.38

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.56 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.43 out of 30.25

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 0 to 47120
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 7 (Score: 728.5; E-value: 4.3e-222)
Product class(es):: benzoisochromanequinone
Product molecular weight(s):: acetyl-CoA_7: 506 Da

IE241_RS20380: KR (Score: 127.9; E-value: 1.2e-39)
IE241_RS20385: KR C9 (Score: 441.0; E-value: 3.2e-135)
IE241_RS20395: KS (Score: 779.5; E-value: 1.7e-237)
IE241_RS20400: CLF 7 (Score: 728.5; E-value: 4.3e-222)
IE241_RS20405: ACP (Score: 117.5; E-value: 4.4e-37)
IE241_RS20410: CYC C7-C12 (Score: 446.2; E-value: 1.1e-136)
IE241_RS20430: CYC C5-C14 (Score: 504.0; E-value: 2.8e-154)
IE241_RS20470: GT (Score: 387.2; E-value: 2.6e-118)
IE241_RS20475: MET (Score: 37.1; E-value: 4.4e-12)
IE241_RS34835: KR (Score: 99.5; E-value: 5.7e-31)

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUT01000009.1 - Region 2 - amglyccycl,lassopeptide

Download region GenBank file

Download region SVG

Location: 233,882 - 274,430 nt. (total: 40,549 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
amglyccycl: (DOIS or ValA or salQ or strH or strK1 or strK2 or NeoL or SpcFG or SpcDK_glyc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxidoreductase synthase

IE241_RS21530: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

IE241_RS21560: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

IE241_RS21575: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: acyltransferase

IE241_RS21565: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

IE241_RS21570: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Hydrolases: hydrolase synthase

IE241_RS21475: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

IE241_RS21485: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IE241_RS21530: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Isomerases: isomerase

IE241_RS21600: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: synthase

IE241_RS21590: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002669.2	0.22	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000701.5	0.19	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0000283.4	0.18	other (cyclitol)	cetoniacytone A	Actinomyces sp. Lu 9419
BGC0000935.5	0.17	PKS, other (aminocoumarin)	esmeraldin	Streptomyces antibioticus
BGC0000722.5	0.17	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. jinggangensis
BGC0000723.5	0.16	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus
BGC0001052.5	0.15	NRPS, PKS	tirandamycin	Streptomyces sp. 307-9
BGC0000229.5	0.15	PKS, saccharide	grincamycin	Streptomyces lusitanus
BGC0001438.5	0.14	PKS, saccharide	warkmycin CS1, warkmycin CS2	Streptomyces sp. CS057
BGC0002439.3	0.14	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000701.5	0.52	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0000843.5	0.46	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0002439.3	0.44	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0002669.2	0.44	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000885.3	0.43	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000019.5	0.42	PKS	angolamycin	Streptomyces eurythermus
BGC0000884.5	0.42	other (other)	3-methylarginine	Pseudomonas syringae pv. syringae
BGC0002000.4	0.42	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0001151.5	0.41	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0002031.3	0.41	other (other)	kitasetaline	Kitasatospora setae KM-6054

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 27.04

Confidence: medium

Additional weak hits (21):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.85 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.54 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.34 out of 31.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.79 out of 36.54

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.09 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.81 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.37 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.26 out of 25.88

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.59 out of 26.85

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.24 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.24 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.85 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.53 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.22 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.36 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.97 out of 35.63

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.33 out of 27.18

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.42 out of 36.53

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.52 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 5 - 84; Score: 31.7

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NZ_BMUT01000010.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 67,267 - 77,665 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

IE241_RS22350: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

IE241_RS22365: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.28 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.40 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.55 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMUT01000011.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1 - 10,615 nt. (total: 10,615 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase

IE241_RS23670: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002584.2	0.43	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000483.5	0.41	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002115.3	0.40	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000477.3	0.40	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0000503.5	0.40	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000565.5	0.40	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002551.2	0.38	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0002485.2	0.38	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0002669.2	0.38	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000471.4	0.37	ribosomal	viridisamide A	Oscillatoria nigro-viridis PCC 7112

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002584.2	0.43	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000483.5	0.41	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002115.3	0.40	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000477.3	0.40	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0000503.5	0.40	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000565.5	0.40	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002551.2	0.38	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0002485.2	0.38	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0002669.2	0.38	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000471.4	0.37	ribosomal	viridisamide A	Oscillatoria nigro-viridis PCC 7112

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (7):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.21 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.18 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.29 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.81 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.57 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.52 out of 20.01

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 18 - 119; Score: 63.1; RRE type: NHLP_CD_RRE; Location: 18 - 95; Score: 34.9; RRE type: Cyanobactin_D_RRE; Location: 17 - 89; Score: 29.8

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_BMUT01000011.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 61,731 - 82,657 nt. (total: 20,927 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase methyltransferase

IE241_RS24000: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE241_RS24005: acyltransferase

smcogs: SMCOG1141: acyltransferase

Hydrolases: hydrolase

IE241_RS23980: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001456.3	0.40	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.40	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.39	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.39	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000043.5	0.39	PKS	curacin A	Moorea producens 19L
BGC0000563.4	0.36	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002669.2	0.32	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000221.5	0.32	PKS	erdacin	uncultured soil bacterium V167
BGC0000609.3	0.32	ribosomal	nocathiacin	Nocardia sp. ATCC 202099

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001456.3	0.40	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.40	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.39	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.39	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000043.5	0.39	PKS	curacin A	Moorea producens 19L
BGC0000563.4	0.36	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002669.2	0.32	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000221.5	0.32	PKS	erdacin	uncultured soil bacterium V167
BGC0000609.3	0.32	ribosomal	nocathiacin	Nocardia sp. ATCC 202099

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

IE241_RS23990: PT_phytoene_like

Domain 1 (19 - 261): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (8):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 24.40 out of 33.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.60 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.89 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.73 out of 24.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 27.04

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_BMUT01000011.1 - Region 3 - RiPP-like,terpene-precursor

Download region GenBank file

Download region SVG

Location: 85,233 - 106,306 nt. (total: 21,074 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE241_RS24130: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Hydrolases: hydrolase

IE241_RS24120: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: synthetase

IE241_RS24095: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.41	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.36	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.29	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002398.2	0.28	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002309.2	0.26	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000688.4	0.24	terpene	copalyl diphosphate	Diaporthe amygdali
BGC0001911.3	0.24	terpene	raimonol	Streptomyces anulatus
BGC0000664.5	0.23	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.23	terpene	carotenoid	Streptomyces avermitilis
BGC0000678.5	0.23	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.44	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002398.2	0.43	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000706.3	0.42	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0002309.2	0.42	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000688.4	0.41	terpene	copalyl diphosphate	Diaporthe amygdali
BGC0002346.3	0.41	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000528.5	0.41	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002316.2	0.41	ribosomal	cebulantin	Saccharopolyspora cebuensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IE241_RS24095: PT_FPPS_like

Domain 1 (61 - 352): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (12):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.90 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.61 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.35 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.12 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.02 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.12 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.48 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.10 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_BMUT01000011.1 - Region 4 - NRPS,NRPS-like,RiPP-like,terpene-precursor

Download region GenBank file

Download region SVG

Location: 196,762 - 289,047 nt. (total: 92,286 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE241_RS24520: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

IE241_RS24785: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: methyltransferase

IE241_RS24540: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

IE241_RS24625: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

IE241_RS24630: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

IE241_RS24620: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IE241_RS24850: hydrolase

smcogs: SMCOG1179: hydrolase

IE241_RS24855: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase synthetase

IE241_RS24515: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

IE241_RS24545: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

IE241_RS24770: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE241_RS24790: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS24795: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE241_RS34315: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.83	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IE241_RS24545: PT_FPPS_like

Domain 1 (48 - 338): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 26.06 out of 29.72

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.99 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 22.67 out of 26.33

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.50 out of 32.93

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (35):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.34 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.22 out of 36.54

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.33 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.63 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.96 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.52 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.30 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.00 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.20 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.22 out of 27.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.80 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.85 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.56 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.53 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.12 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.96 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.94 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.09 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.64 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.80 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.52 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.59 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.81 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.28 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.67 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 196761 - 289047:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (Phe)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 240861 - 284629:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (Phe)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 245894 - 289047:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (Phe)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE241_RS34315: Phe - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (29..432): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWYIFDPHVLEAILSIGGDDNAYGPAEATVVATA
Nearest Stachelhaus code(s):: Phe DPLVVGAVVK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (660..1057): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LEPSFDGSPFEVFLIVGGEVNGYGPTETTSFATA
Nearest Stachelhaus code(s):: Val DGFFVGGVFK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

IE241_RS24790: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (465..866): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HTVAFDVALEEPNLVAGGELNAYGVTEAAITSTV
Nearest Stachelhaus code(s):: Arg DVENVGAITK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
LexA variant 3	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUT01000012.1 - Region 1 - NI-siderophore,terpene

Download region GenBank file

Download region SVG

Location: 252,804 - 299,512 nt. (total: 46,709 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: transferase

IE241_RS26380: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: hydrolase

IE241_RS26355: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: cyclase decarboxylase

IE241_RS26360: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

IE241_RS26465: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

IE241_RS26320: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Translocases: permease

IE241_RS26390: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.33	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.27	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.24	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000947.5	0.18	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000885.3	0.17	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000942.4	0.16	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001880.3	0.15	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000943.5	0.15	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002556.2	0.15	other (other)	cervinomycin B3, cervinomycin C1, cervinomycin C2, cervinomycin C3, cervinomycin C4	Streptomyces sp.
BGC0001374.5	0.14	other (other)	thienodolin	Streptomyces albogriseolus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.66	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.63	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000947.5	0.54	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000943.5	0.50	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0000885.3	0.49	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000942.4	0.47	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001374.5	0.45	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000846.5	0.45	other (other)	tabtoxin	Pseudomonas syringae
BGC0001880.3	0.45	ribosomal	scytodecamide	Scytonema sp. UIC 10036

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.03 out of 36.53

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (14):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.12 out of 27.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.78 out of 39.62

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 25.75

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.11 out of 30.22

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.35 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.76 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.47 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.63 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.77 out of 24.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.88 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.88 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor
ToxT	Regulator of MSHA biosynthesis

NZ_BMUT01000013.1 - Region 1 - NRPS-like,hglE-KS,lassopeptide,terpene

Download region GenBank file

Download region SVG

Location: 8,583 - 135,090 nt. (total: 126,508 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
hglE-KS: (hglE or hglD)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

IE241_RS26695: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

IE241_RS26800: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE241_RS26850: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE241_RS26855: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE241_RS26880: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

IE241_RS26970: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IE241_RS26995: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE241_RS27055: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: acylase glycosyltransferase methyltransferase

IE241_RS26760: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

IE241_RS26775: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

IE241_RS26990: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

IE241_RS27030: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

IE241_RS26660: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

IE241_RS26670: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

IE241_RS26740: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

IE241_RS26890: isochorismatase

smcogs: SMCOG1027: isochorismatase

IE241_RS26895: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: cyclase dehydratase

IE241_RS26795: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

IE241_RS27035: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase

IE241_RS26765: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE241_RS26845: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS26980: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.66	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002391.2	0.61	terpene	zealexin B3, zealexin C2	Zea mays
BGC0002582.3	0.59	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0000659.3	0.58	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.55	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000869.5	0.49	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'
BGC0002648.2	0.49	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0001276.3	0.49	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.49	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.48	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002582.3	0.78	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0002391.2	0.68	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000657.5	0.66	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001552.3	0.65	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001550.3	0.63	ribosomal	citrulassin D	Streptomyces katrae
BGC0000659.3	0.63	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0001549.3	0.63	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0002276.2	0.62	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002164.2	0.62	NRPS	peramine	Epichloe festucae
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

IE241_RS27035: T1TS

Domain 1 (38 - 409): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.40 out of 21.55

Confidence: medium

Additional weak hits (31):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.84 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.37 out of 20.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.10 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.26 out of 20.01

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.39 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.81 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.64 out of 18.57

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.81 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.68 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.61 out of 27.55

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.24 out of 25.88

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.24 out of 27.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.54 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.32 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.64 out of 24.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.60 out of 30.98

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.27 out of 20.01

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.29 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.58 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.52 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.17 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.46 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.30 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

Terpene

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 1, location 8582 - 135090:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 22732 - 74311:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 51522 - 94675:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 86433 - 132556:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE241_RS26760: mal

PKS_AT (1234..1529): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 77.9
Methylmalonyl-CoA: 38.9
Methoxymalonyl-CoA: 38.2
inactive: 33.5
Propionyl-CoA: 24.7
fatty_acid: 23.5
Ethylmalonyl-CoA: 20.4
Isobutyryl-CoA: 13.1
trans-1,2-CPDA: 9.3
2-Methylbutyryl-CoA: 6.6
CHC-CoA: 3.2
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

IE241_RS26765: mal

PKS_AT (633..847): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 13.7
fatty_acid: 11.8
Methoxymalonyl-CoA: 11.4
Methylmalonyl-CoA: 9.6
trans-1,2-CPDA: 0.0
inactive: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

IE241_RS26845: X

AMP-binding (35..432): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSEYSDASTIEGYLSAGGEVNFYGPTENSVVSTA
Nearest Stachelhaus code(s):: Leu DAWYLGNVVK (59% 8Å match); Leu or Ile DAIYLGVVLK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

IE241_RS26980: mal

PKS_AT (573..869): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 95.7
inactive: 40.0
Methylmalonyl-CoA: 32.0
Methoxymalonyl-CoA: 29.8
Isobutyryl-CoA: 17.8
fatty_acid: 16.3
Ethylmalonyl-CoA: 14.1
CHC-CoA: 10.2
trans-1,2-CPDA: 0.0
Propionyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 4 - 83; Score: 75.8

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation

NZ_BMUT01000013.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 141,581 - 164,130 nt. (total: 22,550 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

IE241_RS27140: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IE241_RS27150: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: dehydratase

IE241_RS27130: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

IE241_RS27165: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: transport

IE241_RS27170: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000678.5	0.50	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001377.5	0.36	PKS	uncialamycin	Streptomyces uncialis
BGC0002138.2	0.36	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0000207.5	0.36	PKS	chartreusin	Streptomyces chartreusis
BGC0002387.2	0.36	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002012.4	0.35	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0001228.5	0.34	NRPS	retimycin A	Salinispora arenicola CNT005
BGC0000339.5	0.33	NRPS	echinomycin	Streptomyces lasaliensis
BGC0001561.4	0.32	NRPS	curacomycin	Streptomyces curacoi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000678.5	0.50	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001377.5	0.36	PKS	uncialamycin	Streptomyces uncialis
BGC0002138.2	0.36	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0000207.5	0.36	PKS	chartreusin	Streptomyces chartreusis
BGC0002387.2	0.36	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002012.4	0.35	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0001228.5	0.34	NRPS	retimycin A	Salinispora arenicola CNT005
BGC0000339.5	0.33	NRPS	echinomycin	Streptomyces lasaliensis
BGC0001561.4	0.32	NRPS	curacomycin	Streptomyces curacoi

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IE241_RS27165: PT_FPPS_like

Domain 1 (511 - 802): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.42 out of 26.85

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.38 out of 36.53

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.88 out of 28.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.63 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_BMUT01000014.1 - Region 1 - hydrogen-cyanide,terpene-precursor

Download region GenBank file

Download region SVG

Location: 80,603 - 112,233 nt. (total: 31,631 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

IE241_RS27800: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

IE241_RS27810: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

IE241_RS27825: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Hydrolases: peptidase

IE241_RS27795: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: dehydratase

IE241_RS27735: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

IE241_RS27750: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.21	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002488.3	0.21	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002656.2	0.19	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002042.3	0.16	NRPS	anthelvencin A, anthelvencin B, anthelvencin C	Streptomyces venezuelae
BGC0002712.2	0.15	PKS	WS-5995 D, WS-5995 B, WS-5995 C, SEK 43	Streptomyces yanglinensis
BGC0002657.2	0.15	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0001846.4	0.14	NRPS, saccharide	valinomycin, montanastatin	Streptomyces sp. CBMAI 2042
BGC0000274.5	0.14	PKS	tetarimycin A, tetarimycin B	uncultured bacterium
BGC0002285.2	0.13	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000551.5	0.13	ribosomal	SapB	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.49	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000707.5	0.46	saccharide	kasugamycin	Streptomyces kasugaensis
BGC0002488.3	0.45	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0000648.3	0.43	terpene	carotenoid	Myxococcus xanthus
BGC0001227.3	0.43	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000502.5	0.42	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001075.5	0.41	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IE241_RS27750: PT_FPPS_like

Domain 1 (52 - 337): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (13):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.84 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.77 out of 23.43

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.35 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.15 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.30 out of 29.38

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.81 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.19 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.40 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.60 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_BMUT01000014.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 123,046 - 144,380 nt. (total: 21,335 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase sulfotransferase

IE241_RS27905: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE241_RS27910: Sulfotransferase domain

extras: Sulfotransfer_1: Sulfotransferase domain

IE241_RS27925: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

IE241_RS27920: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.80	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000657.5	0.70	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0001198.3	0.43	terpene	(+)-O-methylkolavelool	Herpetosiphon aurantiacus DSM 785
BGC0002449.2	0.41	other (other)	sarasinoside	uncultured bacterium
BGC0000841.5	0.41	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate, clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0000249.5	0.39	PKS	nogalamycin	Streptomyces nogalater
BGC0001364.3	0.39	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000255.5	0.35	PKS	pederin	Uncultured bacterium
BGC0000821.5	0.35	other (other)	rebeccamycin	Lechevalieria aerocolonigenes

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.80	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000657.5	0.70	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0001198.3	0.43	terpene	(+)-O-methylkolavelool	Herpetosiphon aurantiacus DSM 785
BGC0002449.2	0.41	other (other)	sarasinoside	uncultured bacterium
BGC0000841.5	0.41	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate, clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0000249.5	0.39	PKS	nogalamycin	Streptomyces nogalater
BGC0001364.3	0.39	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000255.5	0.35	PKS	pederin	Uncultured bacterium
BGC0000821.5	0.35	other (other)	rebeccamycin	Lechevalieria aerocolonigenes

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

IE241_RS27920: T1TS

Domain 1 (106 - 441): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.29 out of 23.79

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.28 out of 27.55

Confidence: medium

Additional weak hits (1):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.70 out of 27.55

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism

NZ_BMUT01000015.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 51,747 - 63,063 nt. (total: 11,317 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase sulfotransferase

IE241_RS28285: Sulfotransferase domain

extras: Sulfotransfer_4: Sulfotransferase domain

IE241_RS28300: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

IE241_RS28275: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.44	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002144.3	0.41	ribosomal	phazolicin	Rhizobium sp. Pop5
BGC0000504.5	0.41	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001229.4	0.37	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000538.3	0.36	ribosomal	nisin Z	Lactococcus lactis
BGC0000571.3	0.36	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001735.5	0.36	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000501.3	0.36	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.36	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.44	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002144.3	0.41	ribosomal	phazolicin	Rhizobium sp. Pop5
BGC0000504.5	0.41	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001229.4	0.37	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000538.3	0.36	ribosomal	nisin Z	Lactococcus lactis
BGC0000571.3	0.36	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001735.5	0.36	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000501.3	0.36	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.36	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

Additional weak hits (1):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.98 out of 21.55

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUT01000017.1 - Region 1 - NRPS,PKS-like,T1PKS,T3PKS,butyrolactone,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 1 - 102,590 nt. (total: 102,590 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
PKS-like: (t2pks2 or ksIII)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

IE241_RS29605: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE241_RS29610: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE241_RS29630: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IE241_RS29635: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE241_RS29670: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

IE241_RS29700: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

IE241_RS29705: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

IE241_RS29830: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

IE241_RS29890: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: PPTase acetyltransferase aminotransferase methyltransferase

IE241_RS29575: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

IE241_RS29675: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

IE241_RS29680: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE241_RS29695: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE241_RS29855: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

IE241_RS29860: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: back translocase dehalogenase esterase phosphatase

IE241_RS29560: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

IE241_RS29620: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

IE241_RS29750: thioesterase

smcogs: SMCOG1004: thioesterase

IE241_RS29915: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Lyases: decarboxylase hydratase

IE241_RS29720: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

IE241_RS29950: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

IE241_RS29590: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IE241_RS29595: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE241_RS29615: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS29685: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

IE241_RS29745: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS29865: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

IE241_RS34430: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE241_RS34435: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Translocases: transport

IE241_RS29650: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	1.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	1.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001833.4	1.46	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	1.46	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.45	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	1.44	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001163.3	1.08	PKS	1-heptadecene	Moorea producens 3L
BGC0001162.3	1.08	PKS	1-heptadecene	Moorea producens JHB
BGC0001161.5	1.08	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0002405.2	1.01	saccharide	mid-chain acyl sugars	Solanum lycopersicum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001251.4	0.70	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.70	NRPS	epichloenin A	Epichloe festucae
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.66	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.08 out of 18.57

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.08 out of 25.31

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.64 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (19):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.76 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.09 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.23 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.54 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.73 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.56 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.30 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.09 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.81 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.32 out of 31.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.28 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.51 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.61 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.95 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.81 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.37 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 102590:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 32448:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 51395 - 102590:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE241_RS29595: mal

PKS_AT (528..806): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 156.0
inactive: 97.9
Methoxymalonyl-CoA: 66.4
Methylmalonyl-CoA: 62.6
Propionyl-CoA: 36.1
Ethylmalonyl-CoA: 21.8
Acetyl-CoA: 21.5
2-Methylbutyryl-CoA: 16.7
Isobutyryl-CoA: 14.3
CHC-CoA: 10.1
Benzoyl-CoA: 8.7
fatty_acid: 8.3
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

IE241_RS29615: NH2

CAL_domain (39..483): NH2

minowa: NH2

Prediction, score:

NH2: 176.2
fatty_acid: 41.2
Acetyl-CoA: 2.7
AHBA: 1.5
shikimic_acid: 0.0

IE241_RS34430: X

AMP-binding (18..417): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAIVFDYGLYQLPLTNTGAVPMFGTTECKRITVL
Nearest Stachelhaus code(s):: Asp DYYPTTMRVK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

IE241_RS29745: NH2

CAL_domain (41..488): NH2

minowa: NH2

Prediction, score:

NH2: 191.2
fatty_acid: 41.0
AHBA: 0.1
shikimic_acid: 0.0
Acetyl-CoA: -2.9

IE241_RS29860: X

AMP-binding (1510..1923): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWQCFDASVMEPILLLGGDVNVYGPTEITVLCTV
Nearest Stachelhaus code(s):: ndmHex DAMVLGVVAK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

IE241_RS29865: mal

PKS_AT (558..854): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%; CE-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 152.8
inactive: 83.0
Methylmalonyl-CoA: 79.1
Methoxymalonyl-CoA: 65.8
Propionyl-CoA: 59.1
Isobutyryl-CoA: 52.5
Ethylmalonyl-CoA: 46.6
2-Methylbutyryl-CoA: 39.2
trans-1,2-CPDA: 35.7
Acetyl-CoA: 31.4
Benzoyl-CoA: 28.1
fatty_acid: 23.1
CHC-CoA: 20.7
3-Methylbutyryl-CoA: -0.7

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMUT01000017.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 111,838 - 132,737 nt. (total: 20,900 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

IE241_RS30040: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE241_RS30050: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

IE241_RS30070: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE241_RS30075: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

IE241_RS30095: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: cyclase

IE241_RS34460: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001197.5	0.47	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0001987.2	0.43	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0001911.3	0.42	terpene	raimonol	Streptomyces anulatus
BGC0000671.3	0.42	terpene	momilactone B	Oryza sativa Japonica Group
BGC0001483.4	0.42	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001197.5	0.47	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0001987.2	0.43	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0001911.3	0.42	terpene	raimonol	Streptomyces anulatus
BGC0000671.3	0.42	terpene	momilactone B	Oryza sativa Japonica Group
BGC0001483.4	0.42	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

IE241_RS34460: T1TS

Domain 1 (36 - 298): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.77 out of 29.72

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (2):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.04 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.52 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
NtrC	Nitrogen regulatory protein C

NZ_BMUT01000018.1 - Region 1 - amglyccycl

Download region GenBank file

Download region SVG

Location: 57,995 - 79,218 nt. (total: 21,224 nt) Show pHMM detection rules used

amglyccycl: (DOIS or ValA or salQ or strH or strK1 or strK2 or NeoL or SpcFG or SpcDK_glyc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IE241_RS30555: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

IE241_RS30565: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

IE241_RS30545: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

IE241_RS30595: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Ligases: synthase

IE241_RS30570: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000701.5	0.51	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0000894.4	0.45	other (other)	citrinin	Monascus aurantiacus
BGC0001264.3	0.42	PKS	betaenone A, betaenone B, betaenone C	Phoma betae
BGC0001810.3	0.40	PKS	trehangelin	Polymorphospora rubra
BGC0002216.3	0.40	terpene	HEx-tc1 terpene	Trichoderma virens Gv29-8
BGC0001510.5	0.40	other (other)	anisomycin	Streptomyces hygrospinosus
BGC0000719.5	0.39	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0000846.5	0.39	other (other)	tabtoxin	Pseudomonas syringae
BGC0000720.3	0.39	saccharide	tobramycin	Streptoalloteichus tenebrarius

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000701.5	0.51	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0000894.4	0.45	other (other)	citrinin	Monascus aurantiacus
BGC0001264.3	0.42	PKS	betaenone A, betaenone B, betaenone C	Phoma betae
BGC0001810.3	0.40	PKS	trehangelin	Polymorphospora rubra
BGC0002216.3	0.40	terpene	HEx-tc1 terpene	Trichoderma virens Gv29-8
BGC0001510.5	0.40	other (other)	anisomycin	Streptomyces hygrospinosus
BGC0000719.5	0.39	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0000846.5	0.39	other (other)	tabtoxin	Pseudomonas syringae
BGC0000720.3	0.39	saccharide	tobramycin	Streptoalloteichus tenebrarius

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.62 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.34 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.06 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.08 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.41 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.28 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.49 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.59 out of 20.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.49 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMUT01000019.1 - Region 1 - atropopeptide,lassopeptide,terpene

Download region GenBank file

Download region SVG

Location: 26,423 - 67,747 nt. (total: 41,325 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
atropopeptide: atropopeptide_p450

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE241_RS30995: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

IE241_RS31060: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE241_RS31065: Biaryl bond formation

MITE: MITE0000172Biaryl bond formation (identity: 76.00%)
smcogs: SMCOG1034: cytochrome P450

IE241_RS31120: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase

IE241_RS31115: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

IE241_RS30970: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: cyclase decarboxylase

IE241_RS31015: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

IE241_RS31035: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Ligases: oxygenase

IE241_RS31065: Biaryl bond formation

MITE: MITE0000172Biaryl bond formation (identity: 76.00%)
smcogs: SMCOG1034: cytochrome P450

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.49	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002751.2	0.48	ribosomal	Amyxirubin B	Amycolatopsis xylanica
BGC0002631.2	0.41	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0000677.5	0.37	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000675.5	0.37	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0001539.4	0.36	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000286.3	0.34	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001910.4	0.33	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000674.5	0.33	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002751.2	0.57	ribosomal	Amyxirubin B	Amycolatopsis xylanica
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.56	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000675.5	0.52	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.51	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.51	terpene	raimonol	Streptomyces anulatus
BGC0001223.5	0.50	other (other)	hydroxysporine	uncultured bacterium
BGC0001539.4	0.50	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

IE241_RS31005: T2TS

Domain 1 (26 - 430): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

IE241_RS31015: T1TS

Domain 1 (11 - 281): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.96 out of 27.04

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 24.84 out of 29.72

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.87 out of 29.72

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

Additional weak hits (5):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.48 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.60 out of 20.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.70 out of 27.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.95 out of 28.19

Confidence: weak

Lasso peptides

RREFinder

Terpene

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 82; Score: 27.3

Glossary

Acronym	Full name
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
NtrC	Nitrogen regulatory protein C
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BMUT01000020.1 - Region 1 - RRE-containing,T3PKS

Download region GenBank file

Download region SVG

Location: 3,672 - 44,778 nt. (total: 41,107 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE241_RS31335: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

IE241_RS31470: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase methyltransferase

IE241_RS31425: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE241_RS31525: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: esterase hydrolase

IE241_RS31490: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

IE241_RS31535: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: decarboxylase

IE241_RS31320: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase

IE241_RS31360: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

IE241_RS31465: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.55	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.39	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.34	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002064.2	0.30	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001493.5	0.29	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0000575.5	0.28	ribosomal	lariatin	Rhodococcus jostii
BGC0001548.4	0.27	ribosomal	citrulassin A	Streptomyces albulus
BGC0000285.5	0.27	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000595.3	0.27	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001634.3	0.26	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.82	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.71	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.67	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.60	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000016.4	0.56	other (other)	amphotericin B	Streptomyces nodosus
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001905.4	0.50	PKS	violapyrone B	Streptomyces somaliensis
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002567.2	0.49	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.90 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.76 out of 23.79

Confidence: medium

Additional weak hits (20):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.30 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.63 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.42 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.98 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.82 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.57 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.88 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.43 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.46 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.05 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.86 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.61 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.98 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.66 out of 36.53

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.78 out of 27.04

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.98 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.01 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.53 out of 27.18

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.68 out of 35.63

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

RREFinder

TFBS Finder

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 84; Score: 76.2; RRE type: Lasso_Fused_RRE; Location: 0 - 55; Score: 35.0

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

NZ_BMUT01000024.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 29,742 - 46,970 nt. (total: 17,229 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000513.3	0.50	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.50	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000553.3	0.49	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.49	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002700.2	0.48	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002111.3	0.46	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000518.3	0.42	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.39	ribosomal	SAL-2242	Streptomyces albidoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000513.3	0.50	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.50	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000553.3	0.49	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.49	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002700.2	0.48	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002111.3	0.46	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000518.3	0.42	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.39	ribosomal	SAL-2242	Streptomyces albidoflavus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for IE241_RS33145

IE241_RS33135

Leader:

MRNILALQELDEETIVDAP

Core:

ISTISLGGCH

Core with dehydrations:

IDhaDhbIDhaLGGCysH

antiSMASH-DB 4.0 matches for IE241_RS33135

100.0%

NZ_BMUT01000024.1and 1 other:

NZ_LNBE01000003.1 Lanthipeptides: AS857_RS40640_lanthipeptide

Lanthipeptides: IE241_RS33135_lanthipeptide

1

ISTISLGGCH

10

ISTISLGGCH

1

ISTISLGGCH

10

70.0%

NZ_BMVR01000001.1:

Lanthipeptides: IE274_RS02190_lanthipeptide

1

ISTISLGGCH

10

IST S GCH

1

ISTFSAAGCH

10

66.7%

NZ_BMVR01000001.1:

Lanthipeptides: allorf_531083_531172_lanthipeptide

1

ISTISLGGCH

10

+STIS+GGCH

3

VSTISIGGCH

12

with 4 more sequence matches

30.4%

NZ_BMVR01000001.1:

Lanthipeptides: IE274_RS02195_lanthipeptide

1

ISTISLGGCH

10

+ST+SL GCH

3

LSTLSLTGCH

12

28.0%

NZ_CP017780.1and 2 others:

NZ_KB913032.1 Lanthipeptides: AMYAL_RS49265_lanthipeptideNZ_MQUQ01000015.1 Lanthipeptides: BS329_RS42815_lanthipeptide

Lanthipeptides: BKN51_RS36495_lanthipeptide

2

STISLGGCH

10

STISL CH

17

STISLLTCH

25

26.1%

NZ_BMVR01000001.1:

Lanthipeptides: IE274_RS02195_lanthipeptide

1

ISTISLGGCH

10

++TIS+G CH

14

VTTISVGSCH

23

25.9%

NZ_CP029560.1and 1 other:

NZ_JADOZM010000015.1 Lanthipeptides: I4U92_RS06525_lanthipeptide

Lanthipeptides: DLJ51_RS10415_lanthipeptide

1

ISTISLGGCH

10

+ST+S GGCH

7

VSTLSGGGCH

16

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.54 out of 26.85

Confidence: medium

Additional weak hits (4):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.56 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.50 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.07 out of 29.38

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

IE241_RS33135 - Class III

Cleavage pHMM score: -2.10

RODEO score: 0

Monoisotopic mass: 932.5 Da

Molecular weight: 933.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 951.1 Da N = 1; 969.1 Da N = 2

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_BMUT01000027.1 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 1 - 14,768 nt. (total: 14,768 nt) Show pHMM detection rules used

Region on contig edge.

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE241_RS33470: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001645.3	0.58	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001634.3	0.55	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000575.5	0.53	ribosomal	lariatin	Rhodococcus jostii
BGC0001551.4	0.52	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001552.3	0.50	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002425.3	0.50	ribosomal	stlassin	Streptomyces sp.
BGC0001550.3	0.50	ribosomal	citrulassin D	Streptomyces katrae
BGC0002053.3	0.49	ribosomal	ulleungdin	Streptomyces sp.
BGC0001506.5	0.49	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002825.2	0.49	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001645.3	0.58	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001634.3	0.55	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000575.5	0.53	ribosomal	lariatin	Rhodococcus jostii
BGC0001551.4	0.52	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001552.3	0.50	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002425.3	0.50	ribosomal	stlassin	Streptomyces sp.
BGC0001550.3	0.50	ribosomal	citrulassin D	Streptomyces katrae
BGC0002053.3	0.49	ribosomal	ulleungdin	Streptomyces sp.
BGC0001506.5	0.49	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002825.2	0.49	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (4):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.42 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.12 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.12 out of 27.78

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 75; Score: 62.6

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_BMUT01000030.1 - Region 1 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 13,052 nt. (total: 13,052 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

IE241_RS33795: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Ligases: synthase

IE241_RS33800: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.56	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002171.2	0.37	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.37	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002171.2	0.51	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.51	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.48 out of 28.19

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.58 out of 30.11

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 13052:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA - ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE241_RS33800: AHBA - mal

CAL_domain (36..450): AHBA

minowa: AHBA

Prediction, score:

AHBA: 257.9
shikimic_acid: 203.7
NH2: 9.5
Acetyl-CoA: 9.5
fatty_acid: 0.0

PKS_AT (1219..1509): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 172.2
inactive: 99.8
Methoxymalonyl-CoA: 64.2
Methylmalonyl-CoA: 59.9
Ethylmalonyl-CoA: 35.5
Isobutyryl-CoA: 35.2
Benzoyl-CoA: 21.2
fatty_acid: 16.0
Propionyl-CoA: 13.7
Acetyl-CoA: 11.4
CHC-CoA: 1.7
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description