GCF_014649935.1 - 23 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_BMTZ01000001.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	RiPP-like	164,188	175,498
Region 1.2	terpene	200,291	222,447	High	geosmin	terpene:Sesquiterpene
Region 1.3	NI-siderophore	348,920	380,159
Region 1.4	T2PKS	616,468	688,989	High	resistomycin/resistoflavine	PKS:Type II

NZ_BMTZ01000002.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	lassopeptide	544,500	566,993	High	aborycin	ribosomal:RiPP

NZ_BMTZ01000003.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	T2PKS	112,188	184,697	High	spore pigment	PKS

NZ_BMTZ01000004.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	terpene-precursor	172,466	193,587
Region 4.2	terpene	195,964	217,049	High	albaflavenone	terpene
Region 4.3	phenazine	304,541	324,987

NZ_BMTZ01000005.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	ectoine	1	8,615	High	ectoine	other:other
Region 5.2	RiPP-like	339,822	350,037	Medium	informatipeptin	ribosomal:RiPP:Lanthipeptide

NZ_BMTZ01000006.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	T3PKS,terpene-precursor	93,474	142,499	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 6.2	RiPP-like	234,986	246,365	Medium	streptamidine	ribosomal:unmodified
Region 6.3	NRPS,T1PKS,PKS-like	338,352	416,226	Medium	naphthyridinomycin	NRPS:Type I

NZ_BMTZ01000010.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	amglyccycl	147,516	168,772

NZ_BMTZ01000015.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	terpene	86,175	110,307	Medium	carotenoid	terpene

NZ_BMTZ01000024.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	ectoine	76,189	86,587	High	ectoine	other:other

NZ_BMTZ01000025.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 25.1	T1PKS,NRPS	1	72,212	Low	polyoxypeptin	NRPS:Type I+PKS

NZ_BMTZ01000026.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	hydrogen-cyanide	11,754	24,597	Low	aborycin	ribosomal:RiPP

NZ_BMTZ01000029.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 29.1	NI-siderophore	23,558	53,330	High	desferrioxamin B/desferrioxamine E	other:other

NZ_BMTZ01000046.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 46.1	terpene	1	13,473	Medium	hopene	terpene

NZ_BMTZ01000052.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 52.1	butyrolactone	1	4,356

NZ_BMTZ01000055.1 (Streptomyces variabilis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 55.1	NRPS	1	2,837

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	RiPP-like	164,188	175,498
Region 1.2	terpene	200,291	222,447	High	geosmin	terpene:Sesquiterpene
Region 1.3	NI-siderophore	348,920	380,159
Region 1.4	T2PKS	616,468	688,989	High	resistomycin/resistoflavine	PKS:Type II
Region 2.1	lassopeptide	544,500	566,993	High	aborycin	ribosomal:RiPP
Region 3.1	T2PKS	112,188	184,697	High	spore pigment	PKS
Region 4.1	terpene-precursor	172,466	193,587
Region 4.2	terpene	195,964	217,049	High	albaflavenone	terpene
Region 4.3	phenazine	304,541	324,987
Region 5.1	ectoine	1	8,615	High	ectoine	other:other
Region 5.2	RiPP-like	339,822	350,037	Medium	informatipeptin	ribosomal:RiPP:Lanthipeptide
Region 6.1	T3PKS,terpene-precursor	93,474	142,499	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 6.2	RiPP-like	234,986	246,365	Medium	streptamidine	ribosomal:unmodified
Region 6.3	NRPS,T1PKS,PKS-like	338,352	416,226	Medium	naphthyridinomycin	NRPS:Type I
Region 10.1	amglyccycl	147,516	168,772
Region 15.1	terpene	86,175	110,307	Medium	carotenoid	terpene
Region 24.1	ectoine	76,189	86,587	High	ectoine	other:other
Region 25.1	T1PKS,NRPS	1	72,212	Low	polyoxypeptin	NRPS:Type I+PKS
Region 26.1	hydrogen-cyanide	11,754	24,597	Low	aborycin	ribosomal:RiPP
Region 29.1	NI-siderophore	23,558	53,330	High	desferrioxamin B/desferrioxamine E	other:other
Region 46.1	terpene	1	13,473	Medium	hopene	terpene
Region 52.1	butyrolactone	1	4,356
Region 55.1	NRPS	1	2,837

No secondary metabolite regions were found in these records:: NZ_BMTZ01000007.1 (Streptomyces variabilis); NZ_BMTZ01000008.1 (Streptomyces variabilis); NZ_BMTZ01000009.1 (Streptomyces variabilis); NZ_BMTZ01000011.1 (Streptomyces variabilis); NZ_BMTZ01000012.1 (Streptomyces variabilis); NZ_BMTZ01000013.1 (Streptomyces variabilis); NZ_BMTZ01000014.1 (Streptomyces variabilis); NZ_BMTZ01000016.1 (Streptomyces variabilis); NZ_BMTZ01000017.1 (Streptomyces variabilis); NZ_BMTZ01000018.1 (Streptomyces variabilis); NZ_BMTZ01000019.1 (Streptomyces variabilis); NZ_BMTZ01000020.1 (Streptomyces variabilis); NZ_BMTZ01000021.1 (Streptomyces variabilis); NZ_BMTZ01000022.1 (Streptomyces variabilis); NZ_BMTZ01000023.1 (Streptomyces variabilis); NZ_BMTZ01000027.1 (Streptomyces variabilis); NZ_BMTZ01000028.1 (Streptomyces variabilis); NZ_BMTZ01000030.1 (Streptomyces variabilis); NZ_BMTZ01000031.1 (Streptomyces variabilis); NZ_BMTZ01000032.1 (Streptomyces variabilis); NZ_BMTZ01000033.1 (Streptomyces variabilis); NZ_BMTZ01000034.1 (Streptomyces variabilis); NZ_BMTZ01000035.1 (Streptomyces variabilis); NZ_BMTZ01000036.1 (Streptomyces variabilis); NZ_BMTZ01000037.1 (Streptomyces variabilis); NZ_BMTZ01000038.1 (Streptomyces variabilis); NZ_BMTZ01000039.1 (Streptomyces variabilis); NZ_BMTZ01000040.1 (Streptomyces variabilis); NZ_BMTZ01000041.1 (Streptomyces variabilis); NZ_BMTZ01000042.1 (Streptomyces variabilis); NZ_BMTZ01000043.1 (Streptomyces variabilis); NZ_BMTZ01000044.1 (Streptomyces variabilis); NZ_BMTZ01000045.1 (Streptomyces variabilis); NZ_BMTZ01000047.1 (Streptomyces variabilis); NZ_BMTZ01000048.1 (Streptomyces variabilis); NZ_BMTZ01000049.1 (Streptomyces variabilis); NZ_BMTZ01000050.1 (Streptomyces variabilis); NZ_BMTZ01000051.1 (Streptomyces variabilis); NZ_BMTZ01000053.1 (Streptomyces variabilis); NZ_BMTZ01000054.1 (Streptomyces variabilis); NZ_BMTZ01000056.1 (Streptomyces variabilis); NZ_BMTZ01000057.1 (Streptomyces variabilis); NZ_BMTZ01000058.1 (Streptomyces variabilis); NZ_BMTZ01000059.1 (Streptomyces variabilis); NZ_BMTZ01000060.1 (Streptomyces variabilis)

Compact view

NZ_BMTZ01000001.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 164,188 - 175,498 nt. (total: 11,311 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE148_RS00655: Oxidation

MITE: MITE0000068Oxidation (identity: 60.00%)
smcogs: SMCOG1222: dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000674.5	0.44	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0002387.2	0.36	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001377.5	0.32	PKS	uncialamycin	Streptomyces uncialis
BGC0000874.5	0.30	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0002788.2	0.29	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0000241.5	0.26	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001060.5	0.26	PKS	dynemicin A	Micromonospora chersina
BGC0001984.3	0.26	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0000240.5	0.25	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora pacifica
BGC0001693.3	0.24	PKS	nenestatin	Micromonospora echinospora

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000674.5	0.44	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0002387.2	0.36	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001377.5	0.32	PKS	uncialamycin	Streptomyces uncialis
BGC0000874.5	0.30	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0002788.2	0.29	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0000241.5	0.26	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001060.5	0.26	PKS	dynemicin A	Micromonospora chersina
BGC0001984.3	0.26	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0000240.5	0.25	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora pacifica
BGC0001693.3	0.24	PKS	nenestatin	Micromonospora echinospora

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.90 out of 30.12

Confidence: medium

Additional weak hits (3):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.35 out of 29.51

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.58 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.76 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
OsdR	Development and stress management regulator

NZ_BMTZ01000001.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 200,291 - 222,447 nt. (total: 22,157 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucanase peptidase

IE148_RS00880: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

IE148_RS00890: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

Lyases: cyclase

IE148_RS00870: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.87	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000849.4	0.46	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000850.5	0.41	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001483.4	0.37	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001285.5	0.34	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001840.2	0.32	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0002805.2	0.31	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.87	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000849.4	0.46	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000850.5	0.41	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001483.4	0.37	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001285.5	0.34	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001840.2	0.32	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0002805.2	0.31	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

IE148_RS00870: T1TS + T1TS

Domain 1 (2 - 325): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (326 - 694): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.84 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.04 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.16 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.83 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description

NZ_BMTZ01000001.1 - Region 3 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 348,920 - 380,159 nt. (total: 31,240 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE148_RS01640: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase

IE148_RS01550: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase

IE148_RS01665: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001374.5	0.44	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002584.2	0.42	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001184.4	0.41	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002346.3	0.41	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0002316.2	0.41	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.40	other (other)	bacilysin	Bacillus sp. CS93

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001374.5	0.44	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002584.2	0.42	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001184.4	0.41	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002346.3	0.41	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0002316.2	0.41	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.40	other (other)	bacilysin	Bacillus sp. CS93

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (10):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 30.11

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.35 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.88 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.09 out of 26.06

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.90 out of 32.93

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.99 out of 23.43

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.42 out of 26.85

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMTZ01000001.1 - Region 4 - T2PKS

Download region GenBank file

Download region SVG

Location: 616,468 - 688,989 nt. (total: 72,522 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

IE148_RS02755: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

IE148_RS02825: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

IE148_RS02840: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

IE148_RS02920: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IE148_RS02975: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase kinase methyltransferase

IE148_RS02855: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

IE148_RS02860: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

IE148_RS02895: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

IE148_RS02910: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: back translocase

IE148_RS02940: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Lyases: cyclase dehydratase

IE148_RS02820: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

IE148_RS02885: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

IE148_RS02865: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE148_RS02870: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Translocases: transporter

IE148_RS02950: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000264.5	0.75	PKS	resistomycin, resistoflavine	Streptomyces resistomycificus
BGC0002154.2	0.61	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.61	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000272.3	0.55	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.54	PKS	spore pigment	Streptomyces avermitilis
BGC0000231.5	0.53	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000196.4	0.52	PKS	AQ-256, AQ-270a, AQ-284a	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000264.5	0.75	PKS	resistomycin, resistoflavine	Streptomyces resistomycificus
BGC0002154.2	0.61	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.61	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000272.3	0.55	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.54	PKS	spore pigment	Streptomyces avermitilis
BGC0000231.5	0.53	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000196.4	0.52	PKS	AQ-256, AQ-270a, AQ-284a	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.29 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.69 out of 30.11

Confidence: medium

Additional weak hits (15):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.82 out of 20.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.56 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.37 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.09 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.03 out of 36.54

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.45 out of 29.51

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.34 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.24 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.92 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.34 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.98 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.21 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.58 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.51 out of 35.63

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

IE148_RS02910: mal

PKS_AT (95..379): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 58.6
Methylmalonyl-CoA: 41.3
Methoxymalonyl-CoA: 38.4
inactive: 34.9
Propionyl-CoA: 29.8
Ethylmalonyl-CoA: 22.2
2-Methylbutyryl-CoA: 19.8
CHC-CoA: 16.7
trans-1,2-CPDA: 13.0
Benzoyl-CoA: 11.0
Acetyl-CoA: 10.0
Isobutyryl-CoA: 7.6
3-Methylbutyryl-CoA: 6.4
fatty_acid: 0.0

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 616467 to 688989
Starter unit(s):: propionyl-CoA (Score: 106.0; E-value: 1.22e-28)

IE148_RS02855: MET (Score: 193.5; E-value: 1.2e-59)
IE148_RS02860: MET (Score: 137.4; E-value: 1.4e-42)
IE148_RS02865: KS (Score: 537.1; E-value: 6.1e-164)
IE148_RS02870: CLF (Score: 425.0; E-value: 6.3e-130)
IE148_RS02880: ACP (Score: 37.6; E-value: 3.8e-12)
IE148_RS02885: CYC C9-C14 (Score: 145.8; E-value: 1.8e-45)
IE148_RS02905: CYC C5-C14/C3-C16 (Score: 335.2; E-value: 5.8e-103)
IE148_RS02910: AT (Score: 148.2; E-value: 7e-46); AT BAB72049.1_Aklavinone_propionyl-CoA (Score: 106.0; E-value: 1.22e-28)
IE148_RS02920: OXY (Score: 129.2; E-value: 5.1e-40)
IE148_RS02975: KR (Score: 162.3; E-value: 4e-50)

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor

NZ_BMTZ01000002.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 544,500 - 566,993 nt. (total: 22,494 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

IE148_RS05690: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002015.4	0.97	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002307.3	0.84	ribosomal	humidimycin	Streptomyces humidus
BGC0001674.5	0.84	ribosomal	MS-271	Streptomyces mirabilis
BGC0001920.4	0.84	ribosomal	siamycin I	Streptomyces sp.
BGC0001779.5	0.79	ribosomal	siamycin	Streptomyces nodosus
BGC0002318.2	0.60	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0001539.4	0.60	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001506.5	0.60	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0000579.4	0.59	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083
BGC0002053.3	0.59	ribosomal	ulleungdin	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002015.4	0.97	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002307.3	0.84	ribosomal	humidimycin	Streptomyces humidus
BGC0001674.5	0.84	ribosomal	MS-271	Streptomyces mirabilis
BGC0001920.4	0.84	ribosomal	siamycin I	Streptomyces sp.
BGC0001779.5	0.79	ribosomal	siamycin	Streptomyces nodosus
BGC0002318.2	0.60	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0001539.4	0.60	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001506.5	0.60	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0000579.4	0.59	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083
BGC0002053.3	0.59	ribosomal	ulleungdin	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

Additional weak hits (11):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.67 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.06 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.12 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.35 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.43 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.91 out of 21.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.89 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.33 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.41 out of 21.55

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.56 out of 27.04

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.27 out of 30.12

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 85; Score: 76.4; RRE type: Lasso_Fused_RRE; Location: 0 - 57; Score: 27.3

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMTZ01000003.1 - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 112,188 - 184,697 nt. (total: 72,510 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

IE148_RS06560: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

IE148_RS06675: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IE148_RS06725: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE148_RS06730: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

IE148_RS06735: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

IE148_RS06850: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

IE148_RS06610: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE148_RS06715: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: hydrolase

IE148_RS06780: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

IE148_RS06810: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase

IE148_RS06705: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

IE148_RS06710: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Ligases: synthase

IE148_RS06690: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE148_RS06695: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

IE148_RS06860: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

IE148_RS06880: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.78	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.74	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.73	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.57	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001366.5	0.57	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0001386.5	0.55	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0000275.4	0.55	PKS	tetracenomycin C	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.78	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.74	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.73	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.57	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001366.5	0.57	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0001386.5	0.55	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0000275.4	0.55	PKS	tetracenomycin C	Streptomyces glaucescens

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.52 out of 27.04

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (15):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.74 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.33 out of 20.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.20 out of 26.12

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.53 out of 29.51

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.59 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.89 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.56 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.01 out of 24.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.43 out of 39.62

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.49 out of 29.65

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.04 out of 29.25

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 112187 to 184697
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

IE148_RS06575: MET (Score: 27.2; E-value: 4.5e-09)
IE148_RS06675: OXY (Score: 275.7; E-value: 1.9e-84)
IE148_RS06685: CYC C5-C18 (Score: 216.4; E-value: 2.4e-67)
IE148_RS06690: KS (Score: 725.5; E-value: 4.1e-221)
IE148_RS06695: CLF (Score: 551.3; E-value: 2.9e-168)
IE148_RS06700: ACP (Score: 80.6; E-value: 1.5e-25)
IE148_RS06705: CYC C9-C14 (Score: 251.0; E-value: 7.7e-78)
IE148_RS06710: CYC C4-C21/C2-C23|C2-C19 (Score: 157.4; E-value: 2.3e-49)
IE148_RS06715: MET C6|C8 (Score: 526.0; E-value: 7.4e-161)
IE148_RS06725: KR (Score: 88.9; E-value: 1e-27)
IE148_RS06850: KR (Score: 166.5; E-value: 2e-51)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
DasR	N-acetylglucosamine dependent repressor
OsdR	Development and stress management regulator

NZ_BMTZ01000004.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 172,466 - 193,587 nt. (total: 21,122 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

IE148_RS09225: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

IE148_RS09260: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000678.5	0.44	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001928.2	0.39	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001605.3	0.38	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0000340.5	0.37	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0001227.3	0.37	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000665.5	0.36	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000678.5	0.44	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001928.2	0.39	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001605.3	0.38	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0000340.5	0.37	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0001227.3	0.37	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000665.5	0.36	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IE148_RS09260: PT_FPPS_like

Domain 1 (86 - 371): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.15 out of 23.79

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

Additional weak hits (7):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.74 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.33 out of 27.04

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.33 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.89 out of 23.43

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis

NZ_BMTZ01000004.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 195,964 - 217,049 nt. (total: 21,086 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IE148_RS09365: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: deformylase

IE148_RS09375: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: cyclase

IE148_RS09370: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.85	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001746.3	0.76	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0002181.3	0.36	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000678.5	0.36	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.85	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001746.3	0.76	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0002181.3	0.36	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000678.5	0.36	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

IE148_RS09370: T1TS

Domain 1 (8 - 339): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.17 out of 27.04

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.77 out of 23.79

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.31 out of 27.18

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.21 out of 27.18

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (3):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.68 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.19 out of 30.22

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
NrdR	Represses ribonucleotide reductase encoding genes

NZ_BMTZ01000004.1 - Region 3 - phenazine

Download region GenBank file

Download region SVG

Location: 304,541 - 324,987 nt. (total: 20,447 nt) Show pHMM detection rules used

phenazine: phzB

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

IE148_RS09835: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: amidase

IE148_RS09910: amidase

smcogs: SMCOG1105: amidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000254.5	0.32	PKS	oxytetracycline	Streptomyces rimosus
BGC0001156.5	0.30	terpene	platencin	Streptomyces platensis
BGC0000453.5	0.30	NRPS	valinomycin	Streptomyces tsusimaensis
BGC0002037.3	0.29	NRPS	azetidomonamide A, azetidomonamide B	Pseudomonas aeruginosa PAO1
BGC0000937.5	0.28	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001140.5	0.28	terpene	platensimycin, platencin, thioplatensimycin, thioplatencin, platensilin, thioplatensilin	Streptomyces platensis
BGC0000197.5	0.27	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0001739.3	0.27	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0000209.5	0.27	PKS	chlortetracycline	Kitasatospora aureofaciens
BGC0001225.5	0.27	NRPS	celesticetin	Streptomyces caelestis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000254.5	0.32	PKS	oxytetracycline	Streptomyces rimosus
BGC0001156.5	0.30	terpene	platencin	Streptomyces platensis
BGC0000453.5	0.30	NRPS	valinomycin	Streptomyces tsusimaensis
BGC0002037.3	0.29	NRPS	azetidomonamide A, azetidomonamide B	Pseudomonas aeruginosa PAO1
BGC0000937.5	0.28	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001140.5	0.28	terpene	platensimycin, platencin, thioplatensimycin, thioplatencin, platensilin, thioplatensilin	Streptomyces platensis
BGC0000197.5	0.27	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0001739.3	0.27	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0000209.5	0.27	PKS	chlortetracycline	Kitasatospora aureofaciens
BGC0001225.5	0.27	NRPS	celesticetin	Streptomyces caelestis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (15):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.66 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.21 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.32 out of 28.19

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.87 out of 27.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.03 out of 23.43

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.10 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.84 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.14 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.12 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.19 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMTZ01000005.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 1 - 8,615 nt. (total: 8,615 nt) Show pHMM detection rules used

Region on contig edge.

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

IE148_RS10445: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: dehydratase

IE148_RS10425: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.83	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.83	other (ectoine)	ectoine	Streptomyces sp.
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000854.3	0.63	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000857.3	0.59	other (other)	ectoine	Methylophaga alcalica
BGC0000852.5	0.57	other (other)	ectoine	Sporosarcina pasteurii
BGC0000856.3	0.55	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.50	other (other)	ectoine	Methylarcula marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.83	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.83	other (ectoine)	ectoine	Streptomyces sp.
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000854.3	0.63	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000857.3	0.59	other (other)	ectoine	Methylophaga alcalica
BGC0000852.5	0.57	other (other)	ectoine	Sporosarcina pasteurii
BGC0000856.3	0.55	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.50	other (other)	ectoine	Methylarcula marina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

Additional weak hits (6):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.79 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.83 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.63 out of 30.25

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.81 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_BMTZ01000005.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 339,822 - 350,037 nt. (total: 10,216 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.57	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.46	ribosomal	microcin L	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002698.2	0.42	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.41	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000500.5	0.39	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000589.5	0.38	ribosomal	microcin M	Escherichia coli Nissle 1917

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.57	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.46	ribosomal	microcin L	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002698.2	0.42	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.41	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000500.5	0.39	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000589.5	0.38	ribosomal	microcin M	Escherichia coli Nissle 1917

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (2):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.44 out of 20.01

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.03 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_BMTZ01000006.1 - Region 1 - T3PKS,terpene-precursor

Download region GenBank file

Download region SVG

Location: 93,474 - 142,499 nt. (total: 49,026 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IE148_RS12955: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE148_RS12995: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

IE148_RS13090: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: methyltransferase

IE148_RS12855: methyltransferase

smcogs: SMCOG1089: methyltransferase

IE148_RS12990: Methylation

MITE: MITE0000155Methylation (identity: 68.90%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Hydrolases: deacetylase hydrolase

IE148_RS12945: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

IE148_RS13005: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase synthetase

IE148_RS12985: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

IE148_RS13060: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.56	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000677.5	0.27	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.24	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002276.2	0.23	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000678.5	0.23	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001075.5	0.23	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0001911.3	0.22	terpene	raimonol	Streptomyces anulatus
BGC0000664.5	0.22	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001910.4	0.22	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001227.3	0.22	terpene	isorenieratene	Streptomyces collinus Tu 365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.82	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001962.3	0.50	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0002332.2	0.49	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001077.4	0.47	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000678.5	0.45	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000252.5	0.44	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0001964.2	0.44	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IE148_RS13060: PT_FPPS_like

Domain 1 (61 - 355): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (9):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.97 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.12 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.51 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 14.92 out of 20.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.89 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.45 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.45 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.85 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.20 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMTZ01000006.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 234,986 - 246,365 nt. (total: 11,380 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.78	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.44	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.41	ribosomal	microcin N	Escherichia coli
BGC0001843.2	0.41	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.78	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.44	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.41	ribosomal	microcin N	Escherichia coli
BGC0001843.2	0.41	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

NZ_BMTZ01000006.1 - Region 3 - NRPS,PKS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 338,352 - 416,226 nt. (total: 77,875 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE148_RS13895: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

IE148_RS13900: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

IE148_RS13960: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE148_RS14010: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE148_RS14045: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: PPTase aminotransferase

IE148_RS13970: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

IE148_RS14025: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: esterase

IE148_RS14110: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

IE148_RS13945: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE148_RS13950: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE148_RS13955: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE148_RS13975: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE148_RS14060: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

IE148_RS14065: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IE148_RS14085: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE148_RS14095: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE148_RS14105: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE148_RS14115: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE148_RS14120: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001455.6	1.51	NRPS, PKS	antimycin A1B	Streptomyces argillaceus
BGC0000958.5	1.41	NRPS, PKS	antimycin	Streptomyces sp. S4
BGC0002135.2	1.34	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.34	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	1.34	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001216.5	1.34	NRPS, PKS	splenocin C	Streptomyces sp. CNQ431
BGC0001758.4	1.33	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	1.33	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.33	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.32	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001455.6	0.85	NRPS, PKS	antimycin A1B	Streptomyces argillaceus
BGC0000958.5	0.82	NRPS, PKS	antimycin	Streptomyces sp. S4
BGC0001216.5	0.80	NRPS, PKS	splenocin C	Streptomyces sp. CNQ431
BGC0000394.5	0.76	NRPS	naphthyridinomycin	Streptomyces lusitanus
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.36 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.13 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.16 out of 30.11

Confidence: medium

Additional weak hits (12):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.79 out of 25.75

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.85 out of 27.04

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.59 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.44 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.14 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.56 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.31 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 19.86 out of 27.18

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.99 out of 28.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 338351 - 416226:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - fatty_acid) + (mal) + (X) + (NH2)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 338351 - 390868:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - fatty_acid) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 373318 - 414323:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 383417 - 416226:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE148_RS13950: Thr - fatty_acid

Search NORINE for peptide: strict or relaxed

AMP-binding (461..874): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAAHFDFSVWEGNQVFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

CAL_domain (1706..2115): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 15.6
AHBA: 2.7
shikimic_acid: 0.0
NH2: 0.0
Acetyl-CoA: -3.1

IE148_RS13955: mal

PKS_AT (563..846): mal

ATSignature: 2-Rhyd-Malonyl-CoA, Malonyl-CoA

Top 3 matches:: 2-Rhyd-Malonyl-CoA: 62.5%; Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 102.3
Methoxymalonyl-CoA: 66.5
inactive: 56.1
Methylmalonyl-CoA: 43.6
Ethylmalonyl-CoA: 26.1
Isobutyryl-CoA: 19.3
Propionyl-CoA: 18.0
Benzoyl-CoA: 14.3
2-Methylbutyryl-CoA: 6.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

IE148_RS13975: X

AMP-binding (7..402): X

nrpys: Ant

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IGWCHGSMVVSTWLLYGAARQVYGMTEVGGFVTL
Nearest Stachelhaus code(s):: Ant GSVWLGVGFK (100% 8Å match); Pyv or Ant GSVWLGVGFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

IE148_RS14085: X

AMP-binding (378..769): X

nrpys: dohmTyr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SARPFDGAAGGWHAAVGGEFNDYGPTECAVWATT
Nearest Stachelhaus code(s):: dohmTyr DGGHAGDVWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

IE148_RS14095: X

AMP-binding (488..887): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SARAFDASGGGWDGVLAGEFNEYGPTEATVWASV
Nearest Stachelhaus code(s):: 4,5-dhArg DAGDIAEVWK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

IE148_RS14115: NH2

CAL_domain (169..476): NH2

minowa: NH2

Prediction, score:

NH2: 114.8
Acetyl-CoA: 37.3
fatty_acid: 29.3
AHBA: 26.9
shikimic_acid: 17.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMTZ01000010.1 - Region 1 - amglyccycl

Download region GenBank file

Download region SVG

Location: 147,516 - 168,772 nt. (total: 21,257 nt) Show pHMM detection rules used

amglyccycl: (DOIS or ValA or salQ or strH or strK1 or strK2 or NeoL or SpcFG or SpcDK_glyc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

IE148_RS18315: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE148_RS18330: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IE148_RS18370: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: acyltransferase

IE148_RS18375: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Ligases: synthase

IE148_RS18345: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000701.5	0.52	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002496.3	0.45	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.43	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001184.4	0.41	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001605.3	0.40	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001197.5	0.40	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000701.5	0.52	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002496.3	0.45	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.43	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001184.4	0.41	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001605.3	0.40	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001197.5	0.40	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (8):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.68 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.18 out of 27.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.42 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.78 out of 31.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.54 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.60 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMTZ01000015.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 86,175 - 110,307 nt. (total: 24,133 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE148_RS22375: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

IE148_RS22390: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

IE148_RS22405: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IE148_RS22415: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

IE148_RS22380: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.72	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.67	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.66	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.65	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.65	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000645.3	0.48	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000648.3	0.47	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.47	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000650.3	0.45	terpene	carotenoid	Algoriphagus sp. KK10202C

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.72	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.67	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.66	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.65	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.65	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000645.3	0.48	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000648.3	0.47	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.47	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000650.3	0.45	terpene	carotenoid	Algoriphagus sp. KK10202C

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

IE148_RS22385: Lycopene_cycl

Domain 1 (5 - 382): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

IE148_RS22395: PT_phytoene_like

Domain 1 (16 - 315): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.71 out of 26.85

Confidence: medium

Additional weak hits (1):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_BMTZ01000024.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 76,189 - 86,587 nt. (total: 10,399 nt) Show pHMM detection rules used

Region on contig edge.

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

IE148_RS27845: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

IE148_RS27860: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

IE148_RS27875: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.36 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 25.44 out of 30.22

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.26 out of 28.19

Confidence: medium

Additional weak hits (3):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
ClgR	Caseinolytic protease gene regulator
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_BMTZ01000025.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 72,212 nt. (total: 72,212 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase phosphate reductase

IE148_RS27955: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IE148_RS27965: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IE148_RS28025: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

IE148_RS28055: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: acylase aminotransferase halogenase kinase transferase

IE148_RS27905: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

IE148_RS27930: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

IE148_RS27940: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

IE148_RS27945: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

IE148_RS27990: halogenase

smcogs: SMCOG1119: halogenase

IE148_RS28035: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

IE148_RS28040: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: dehalogenase esterase hydrolase

IE148_RS27910: thioesterase

smcogs: SMCOG1004: thioesterase

IE148_RS27915: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

IE148_RS27950: thioesterase

smcogs: SMCOG1004: thioesterase

IE148_RS27970: thioesterase

smcogs: SMCOG1004: thioesterase

IE148_RS28015: thioesterase

smcogs: SMCOG1004: thioesterase

IE148_RS28020: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase synthase

IE148_RS27925: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE148_RS27935: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

IE148_RS27975: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE148_RS27980: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE148_RS27985: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IE148_RS28000: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IE148_RS28070: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	1.40	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001132.4	1.19	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	1.17	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	1.15	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	1.14	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	1.14	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.13	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000041.3	1.11	PKS	oronofacic acid	Pseudomonas syringae
BGC0000342.4	1.07	NRPS	enniatin	Fusarium equiseti
BGC0001166.5	1.02	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.74	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.49 out of 20.97

Confidence: medium

Additional weak hits (13):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.37 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.85 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.08 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.79 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.75 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.25 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.72 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.55 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.71 out of 24.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.15 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 72212:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - Ala) + (D-NMe-Val - Leu) + (Gly) + (Me-mal) + (Me-ccmal) + (redmal) + (pk) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 46600:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - Ala) + (D-NMe-Val - Leu) + (Gly) + (Me-mal) + (Me-ccmal) + (redmal) + (pk) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 0 - 27929:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (Me-ccmal) + (redmal) + (pk) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 11768 - 72212:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - Ala) + (D-NMe-Val - Leu) + (Gly) + (Me-mal) + (Me-ccmal) + (redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE148_RS27925: X

AMP-binding (500..896): X

nrpys: Ile, Val, aIle

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FDRACDALALEAWLWTGGDVHGHGPSETTVFAAR
Nearest Stachelhaus code(s):: Ile DALWWGGVFK (71% 8Å match); Val or aIle DALWWGGVFK (71% 8Å match)
Stachelhaus code match:: 100% (strong)

IE148_RS27930: pk

PKS_AT (580..876): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 214.5
Methylmalonyl-CoA: 213.4
Methoxymalonyl-CoA: 176.2
2-Methylbutyryl-CoA: 167.6
trans-1,2-CPDA: 130.0
Propionyl-CoA: 122.4
Malonyl-CoA: 107.7
CHC-CoA: 97.7
Isobutyryl-CoA: 92.1
Benzoyl-CoA: 70.3
inactive: 44.1
3-Methylbutyryl-CoA: 43.4
Acetyl-CoA: 42.8
fatty_acid: 32.6

IE148_RS27935: mal

PKS_AT (582..878): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Ethylmalonyl-CoA: 70.8%; Methoxymalonyl-CoA: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 156.7
Methylmalonyl-CoA: 93.6
Methoxymalonyl-CoA: 77.9
Ethylmalonyl-CoA: 60.6
inactive: 52.1
Propionyl-CoA: 49.1
Isobutyryl-CoA: 36.4
2-Methylbutyryl-CoA: 35.3
CHC-CoA: 35.1
Acetyl-CoA: 34.6
trans-1,2-CPDA: 28.6
fatty_acid: 25.5
Benzoyl-CoA: 24.6
3-Methylbutyryl-CoA: 14.3

IE148_RS27940: mmal

PKS_AT (564..854): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.9
Ethylmalonyl-CoA: 198.0
Methoxymalonyl-CoA: 168.2
2-Methylbutyryl-CoA: 139.0
trans-1,2-CPDA: 127.5
CHC-CoA: 115.5
Propionyl-CoA: 112.6
Malonyl-CoA: 98.8
Isobutyryl-CoA: 76.0
Benzoyl-CoA: 64.0
Acetyl-CoA: 52.0
3-Methylbutyryl-CoA: 42.5
inactive: 33.0
fatty_acid: 28.7

IE148_RS27945: mmal

PKS_AT (543..840): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%; Malonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 183.8
Ethylmalonyl-CoA: 177.6
Methoxymalonyl-CoA: 154.3
2-Methylbutyryl-CoA: 104.6
Malonyl-CoA: 104.5
CHC-CoA: 91.6
trans-1,2-CPDA: 87.9
Propionyl-CoA: 84.0
inactive: 47.1
Isobutyryl-CoA: 46.9
Benzoyl-CoA: 41.1
Acetyl-CoA: 26.9
3-Methylbutyryl-CoA: 24.2
fatty_acid: 22.7

IE148_RS27975: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (469..845): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: YTTTFDIAGTELQAMVGGEGNWYGPTETTIWSTT
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (79% 8Å match)
Stachelhaus code match:: 70% (weak)

IE148_RS27980: Val - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (465..844): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MWRSFDASVPETFFEAGGEHNLYGPTEAAVEVTA
Nearest Stachelhaus code(s):: Val DAPFEALVEK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2372..2760): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GELTFDVSVFETSTVFAGEVNAYGQSESFYATTA
Nearest Stachelhaus code(s):: Leu DVFSVAAYAK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

IE148_RS27985: X - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (465..862): X

nrpys: Piz

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GELTFDVSVFETSGVFAGDVNSYGQSESFYATTF
Nearest Stachelhaus code(s):: Piz DVFSVASYAK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2016..2395): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWGTFDVSVPEADFEVAGEHNLYGPTEASVEVTA
Nearest Stachelhaus code(s):: Ala DVPDEALVEK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

IE148_RS28000: X

AMP-binding (19..425): X

nrpys: Leu, Ser

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWLSFDLSQRATHCLFGGELHQYGVAECTDVATS
Nearest Stachelhaus code(s):: Leu or Ser DLRHLGQDVK (97% 8Å match); Leu or Ala DLRHLGQDVK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

IE148_RS28070: X

AMP-binding (472..815): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAAGGDAAIG-SLG-VSGGYRAY-----LLDALL
Nearest Stachelhaus code(s):: Lys DAGFSGAVDK (26% 8Å match); Dab DVGEISAIDK (21% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_BMTZ01000026.1 - Region 1 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 11,754 - 24,597 nt. (total: 12,844 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

IE148_RS28225: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

IE148_RS28235: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.36	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001782.3	0.31	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0001065.5	0.29	PKS	herboxidiene	Streptomyces chromofuscus
BGC0001364.3	0.27	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001649.3	0.26	PKS	lavendiol	Streptomyces lavendulae
BGC0002340.3	0.26	NRPS, other (other)	pyrroloformamide A, pyrroloformamide B, pyrroloformamide D, pyrroloformamide C	Streptomyces sp. CB02980
BGC0000595.3	0.25	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000117.5	0.25	PKS	oligomycin	Streptomyces avermitilis
BGC0002407.3	0.25	other (other), saccharide	angustmycin A, angustmycin C	Streptomyces angustmyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.36	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001782.3	0.31	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0001065.5	0.29	PKS	herboxidiene	Streptomyces chromofuscus
BGC0001364.3	0.27	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001649.3	0.26	PKS	lavendiol	Streptomyces lavendulae
BGC0002340.3	0.26	NRPS, other (other)	pyrroloformamide A, pyrroloformamide B, pyrroloformamide D, pyrroloformamide C	Streptomyces sp. CB02980
BGC0000595.3	0.25	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000117.5	0.25	PKS	oligomycin	Streptomyces avermitilis
BGC0002407.3	0.25	other (other), saccharide	angustmycin A, angustmycin C	Streptomyces angustmyceticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (12):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.40 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.07 out of 30.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.62 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.83 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.49 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 17.67 out of 22.40

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.31 out of 24.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.45 out of 26.85

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMTZ01000029.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 23,558 - 53,330 nt. (total: 29,773 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IE148_RS29375: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE148_RS29400: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IE148_RS29420: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: carboxylase transferase

IE148_RS29385: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

IE148_RS29390: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Lyases: decarboxylase

IE148_RS29415: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase

IE148_RS29395: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Translocases: transporter

IE148_RS29500: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000940.5	0.85	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000941.3	0.84	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.64	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002073.3	0.56	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000940.5	0.85	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000941.3	0.84	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.64	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002073.3	0.56	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.19 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.19 out of 36.53

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.12 out of 29.51

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.26 out of 23.43

Confidence: medium

Additional weak hits (11):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.36 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.16 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.27 out of 26.85

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.23 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.87 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.35 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.72 out of 35.63

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
DosR	Hypoxia stress response regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BMTZ01000046.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 13,473 nt. (total: 13,473 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IE148_RS32875: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

IE148_RS32910: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Ligases: synthetase

IE148_RS32915: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.70	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000664.5	0.52	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.70	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000664.5	0.52	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

IE148_RS32900: PT_phytoene_like

Domain 1 (27 - 290): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

IE148_RS32905: PT_phytoene_like

Domain 1 (17 - 304): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

IE148_RS32915: PT_FPPS_like

Domain 1 (60 - 353): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

IE148_RS32920: T2TS

Domain 1 (24 - 655): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Terpene

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

NZ_BMTZ01000052.1 - Region 1 - butyrolactone

Download region GenBank file

Download region SVG

Location: 1 - 4,356 nt. (total: 4,356 nt) Show pHMM detection rules used

Region on contig edge.

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.69	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.63	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.40	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001083.5	0.33	PKS, terpene	merochlorin A, merochlorin B, deschloro-merochlorin A, deschloro-merochlorin B, isochloro-merochlorin B, dichloro-merochlorin B, merochlorin D, merochlorin C	Streptomyces sp. CNH189
BGC0000914.5	0.33	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0000885.3	0.32	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001513.3	0.32	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000889.5	0.30	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000238.5	0.28	PKS	lactonamycin	Streptomyces rishiriensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.69	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.63	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.40	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001083.5	0.33	PKS, terpene	merochlorin A, merochlorin B, deschloro-merochlorin A, deschloro-merochlorin B, isochloro-merochlorin B, dichloro-merochlorin B, merochlorin D, merochlorin C	Streptomyces sp. CNH189
BGC0000914.5	0.33	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0000885.3	0.32	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001513.3	0.32	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000889.5	0.30	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000238.5	0.28	PKS	lactonamycin	Streptomyces rishiriensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.67 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMTZ01000055.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,837 nt. (total: 2,837 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

IE148_RS33230: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000900.5	0.66	other (other)	ferrichrome	Aspergillus oryzae
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000900.5	0.66	other (other)	ferrichrome	Aspergillus oryzae
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 2837:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IE148_RS33230: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (0..300): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: MWATFDLSVFEANTNLAGENNLYGPSEDTTYSTH
Nearest Stachelhaus code(s):: Ala DLFNNALTYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor