GCF_014645835.1 - 41 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_BMMM01000001.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	terpene,NAPAA	261,663	314,416
Region 1.2	T1PKS	420,897	475,242
Region 1.3	NRPS	534,689	596,661
Region 1.4	lassopeptide,T3PKS	880,436	937,274	High	citrulassin D	ribosomal:RiPP

NZ_BMMM01000002.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	T1PKS,NRPS-like	228,326	283,816
Region 2.2	NI-siderophore	302,749	332,521	High	desferrioxamin B/desferrioxamine E	other:other
Region 2.3	melanin	425,257	435,784

NZ_BMMM01000003.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	T2PKS	307,890	380,402	High	spore pigment	PKS
Region 3.2	terpene	498,284	524,929	High	hopene	terpene
Region 3.3	butyrolactone	611,338	622,378

NZ_BMMM01000004.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	CDPS	352,008	372,793

NZ_BMMM01000005.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	T1PKS,terpene	1	35,358
Region 5.2	RiPP-like	102,767	112,982	Low	informatipeptin	ribosomal:RiPP:Lanthipeptide
Region 5.3	redox-cofactor	206,965	229,106

NZ_BMMM01000007.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	ectoine	93,757	104,161	High	ectoine	other:other

NZ_BMMM01000008.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	NAPAA	16,120	49,995	High	ε-Poly-L-lysine	NRPS:Type I

NZ_BMMM01000009.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	NI-siderophore	66,037	99,136
Region 9.2	RiPP-like	310,314	321,687
Region 9.3	terpene	369,453	391,660	High	geosmin	terpene:Sesquiterpene

NZ_BMMM01000010.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	blactam	116,519	140,157	Medium	clavulanic acid	other:non-nrp beta-lactam
Region 10.2	T2PKS,oligosaccharide,PKS-like	141,385	213,849	High	antibiotic HKI 10311129/antibiotic A2121-1/cervimycin D/cervimycin C/cervimycin A	PKS+saccharide:hybrid/tailoring
Region 10.3	azole-containing-RiPP,benzoxazole,NRPS-like	241,090	304,440	High	caboxamycin	other:shikimate-derived

NZ_BMMM01000012.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	terpene-precursor	252,475	273,584
Region 12.2	terpene	290,246	311,331	High	albaflavenone	terpene

NZ_BMMM01000013.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	NAPAA	121,309	156,511
Region 13.2	terpene	166,038	187,111	High	2-methylisoborneol	terpene

NZ_BMMM01000014.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	NRPS-like,T1PKS	96,544	145,057

NZ_BMMM01000019.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	RiPP-like	21,782	31,991
Region 19.2	hydrogen-cyanide	176,872	189,817	Low	aborycin	ribosomal:RiPP

NZ_BMMM01000020.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	redox-cofactor	90,992	113,065

NZ_BMMM01000022.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 22.1	terpene-precursor,melanin	35,265	60,535	Medium	melanin	other:other
Region 22.2	CDPS	103,152	123,319

NZ_BMMM01000025.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 25.1	NI-siderophore	76,601	107,791
Region 25.2	NRPS	130,109	153,505	Low	misaugamycin A/misaugamycin B	NRPS:Type I

NZ_BMMM01000027.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 27.1	T3PKS,polyhalogenated-pyrrole,T1PKS	66,127	137,960	Low	pyralomicin 1a	NRPS:Type I+PKS:Type I

NZ_BMMM01000029.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 29.1	NRPS,PKS-like,T3PKS	18,928	114,905	Low	feglymycin	NRPS:Type I

NZ_BMMM01000030.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 30.1	T2PKS	1	42,710	Low	LL-D49194α1 (LLD)/LL-D49194β2	PKS

NZ_BMMM01000031.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 31.1	NRPS-like	18,149	62,024

NZ_BMMM01000038.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 38.1	NRPS	1	8,517

NZ_BMMM01000040.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 40.1	NRPS	1	7,365	Low	kistamicin A	NRPS:Type I+PKS

NZ_BMMM01000042.1 (Streptomyces albiflavescens)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 42.1	NRPS	1	4,147

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	terpene,NAPAA	261,663	314,416
Region 1.2	T1PKS	420,897	475,242
Region 1.3	NRPS	534,689	596,661
Region 1.4	lassopeptide,T3PKS	880,436	937,274	High	citrulassin D	ribosomal:RiPP
Region 2.1	T1PKS,NRPS-like	228,326	283,816
Region 2.2	NI-siderophore	302,749	332,521	High	desferrioxamin B/desferrioxamine E	other:other
Region 2.3	melanin	425,257	435,784
Region 3.1	T2PKS	307,890	380,402	High	spore pigment	PKS
Region 3.2	terpene	498,284	524,929	High	hopene	terpene
Region 3.3	butyrolactone	611,338	622,378
Region 4.1	CDPS	352,008	372,793
Region 5.1	T1PKS,terpene	1	35,358
Region 5.2	RiPP-like	102,767	112,982	Low	informatipeptin	ribosomal:RiPP:Lanthipeptide
Region 5.3	redox-cofactor	206,965	229,106
Region 7.1	ectoine	93,757	104,161	High	ectoine	other:other
Region 8.1	NAPAA	16,120	49,995	High	ε-Poly-L-lysine	NRPS:Type I
Region 9.1	NI-siderophore	66,037	99,136
Region 9.2	RiPP-like	310,314	321,687
Region 9.3	terpene	369,453	391,660	High	geosmin	terpene:Sesquiterpene
Region 10.1	blactam	116,519	140,157	Medium	clavulanic acid	other:non-nrp beta-lactam
Region 10.2	T2PKS,oligosaccharide,PKS-like	141,385	213,849	High	antibiotic HKI 10311129/antibiotic A2121-1/cervimycin D/cervimycin C/cervimycin A	PKS+saccharide:hybrid/tailoring
Region 10.3	azole-containing-RiPP,benzoxazole,NRPS-like	241,090	304,440	High	caboxamycin	other:shikimate-derived
Region 12.1	terpene-precursor	252,475	273,584
Region 12.2	terpene	290,246	311,331	High	albaflavenone	terpene
Region 13.1	NAPAA	121,309	156,511
Region 13.2	terpene	166,038	187,111	High	2-methylisoborneol	terpene
Region 14.1	NRPS-like,T1PKS	96,544	145,057
Region 19.1	RiPP-like	21,782	31,991
Region 19.2	hydrogen-cyanide	176,872	189,817	Low	aborycin	ribosomal:RiPP
Region 20.1	redox-cofactor	90,992	113,065
Region 22.1	terpene-precursor,melanin	35,265	60,535	Medium	melanin	other:other
Region 22.2	CDPS	103,152	123,319
Region 25.1	NI-siderophore	76,601	107,791
Region 25.2	NRPS	130,109	153,505	Low	misaugamycin A/misaugamycin B	NRPS:Type I
Region 27.1	T3PKS,polyhalogenated-pyrrole,T1PKS	66,127	137,960	Low	pyralomicin 1a	NRPS:Type I+PKS:Type I
Region 29.1	NRPS,PKS-like,T3PKS	18,928	114,905	Low	feglymycin	NRPS:Type I
Region 30.1	T2PKS	1	42,710	Low	LL-D49194α1 (LLD)/LL-D49194β2	PKS
Region 31.1	NRPS-like	18,149	62,024
Region 38.1	NRPS	1	8,517
Region 40.1	NRPS	1	7,365	Low	kistamicin A	NRPS:Type I+PKS
Region 42.1	NRPS	1	4,147

No secondary metabolite regions were found in these records:: NZ_BMMM01000006.1 (Streptomyces albiflavescens); NZ_BMMM01000011.1 (Streptomyces albiflavescens); NZ_BMMM01000015.1 (Streptomyces albiflavescens); NZ_BMMM01000016.1 (Streptomyces albiflavescens); NZ_BMMM01000017.1 (Streptomyces albiflavescens); NZ_BMMM01000018.1 (Streptomyces albiflavescens); NZ_BMMM01000021.1 (Streptomyces albiflavescens); NZ_BMMM01000023.1 (Streptomyces albiflavescens); NZ_BMMM01000024.1 (Streptomyces albiflavescens); NZ_BMMM01000026.1 (Streptomyces albiflavescens); NZ_BMMM01000028.1 (Streptomyces albiflavescens); NZ_BMMM01000032.1 (Streptomyces albiflavescens); NZ_BMMM01000033.1 (Streptomyces albiflavescens); NZ_BMMM01000034.1 (Streptomyces albiflavescens); NZ_BMMM01000035.1 (Streptomyces albiflavescens); NZ_BMMM01000036.1 (Streptomyces albiflavescens); NZ_BMMM01000037.1 (Streptomyces albiflavescens); NZ_BMMM01000039.1 (Streptomyces albiflavescens); NZ_BMMM01000041.1 (Streptomyces albiflavescens); NZ_BMMM01000043.1 (Streptomyces albiflavescens); NZ_BMMM01000044.1 (Streptomyces albiflavescens); NZ_BMMM01000045.1 (Streptomyces albiflavescens); NZ_BMMM01000046.1 (Streptomyces albiflavescens); NZ_BMMM01000047.1 (Streptomyces albiflavescens); NZ_BMMM01000048.1 (Streptomyces albiflavescens)

Compact view

NZ_BMMM01000001.1 - Region 1 - NAPAA,terpene

Download region GenBank file

Download region SVG

Location: 261,663 - 314,416 nt. (total: 52,754 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IEY95_RS01215: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

IEY95_RS01330: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Transferases: kinase methyltransferase

IEY95_RS01230: methyltransferase

smcogs: SMCOG1089: methyltransferase

IEY95_RS01345: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: deaminase

IEY95_RS01335: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: cyclase

IEY95_RS01225: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase

IEY95_RS01325: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS01340: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.51	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000657.5	0.38	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001641.4	0.28	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000659.3	0.28	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0001132.4	0.28	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.28	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.28	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.28	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.27	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.26	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.79	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000657.5	0.70	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

IEY95_RS01225: T1TS

Domain 1 (87 - 434): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.64 out of 28.19

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (9):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.78 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.51 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.46 out of 26.06

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.27 out of 30.12

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.60 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.50 out of 27.04

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.60 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 261662 - 314416:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 278492 - 314416:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IEY95_RS01325: X

AMP-binding (243..645): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQSQVSVTGEVNAYGLTETSDDTNH
Nearest Stachelhaus code(s):: Dpr DIWQSTADDK (97% 8Å match); dnmeProp or Dab DIWQSTADDK (82% 8Å match); Asp DIWQSTADDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
OsdR	Development and stress management regulator
ZuR variant 1	Zinc-responsive repressor

NZ_BMMM01000001.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 420,897 - 475,242 nt. (total: 54,346 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

IEY95_RS02010: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: acylase

IEY95_RS01935: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

IEY95_RS01920: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

IEY95_RS01930: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

IEY95_RS01940: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.67	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001873.3	0.49	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.67	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001873.3	0.49	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.78 out of 29.72

Confidence: medium

Additional weak hits (12):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.56 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.05 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.58 out of 27.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.03 out of 30.22

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.24 out of 32.93

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.24 out of 27.04

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.12 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.73 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.54 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.61 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.21 out of 27.04

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.42 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 420896 - 475242:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal - Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IEY95_RS01935: mmal - mmal

PKS_AT (660..957): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 199.0
Ethylmalonyl-CoA: 188.9
Methoxymalonyl-CoA: 169.0
trans-1,2-CPDA: 122.1
2-Methylbutyryl-CoA: 121.1
Propionyl-CoA: 100.5
Malonyl-CoA: 89.3
CHC-CoA: 88.6
Isobutyryl-CoA: 61.5
Benzoyl-CoA: 49.9
Acetyl-CoA: 40.5
3-Methylbutyryl-CoA: 33.6
inactive: 22.3
fatty_acid: 15.2

PKS_AT (2575..2867): mmal

ATSignature: Ethylmalonyl-CoA, Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 62.5%; Malonyl-CoA: 62.5%; Methylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 143.7
Methoxymalonyl-CoA: 130.6
Ethylmalonyl-CoA: 123.5
Malonyl-CoA: 93.6
2-Methylbutyryl-CoA: 85.0
trans-1,2-CPDA: 82.0
Isobutyryl-CoA: 68.6
Propionyl-CoA: 65.0
CHC-CoA: 63.3
3-Methylbutyryl-CoA: 50.9
Benzoyl-CoA: 48.1
fatty_acid: 32.3
Acetyl-CoA: 30.2
inactive: 25.2

IEY95_RS01940: NH2

CAL_domain (37..484): NH2

minowa: NH2

Prediction, score:

NH2: 169.8
AHBA: 8.4
fatty_acid: 4.1
Acetyl-CoA: 2.4
shikimic_acid: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

NZ_BMMM01000001.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 534,689 - 596,661 nt. (total: 61,973 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IEY95_RS02335: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IEY95_RS02445: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

IEY95_RS02450: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

IEY95_RS02460: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: carbamoyltransferase

IEY95_RS02410: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

Hydrolases: deaminase esterase hydrolase

IEY95_RS02345: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

IEY95_RS02420: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

IEY95_RS02455: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

IEY95_RS02380: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS02385: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS02415: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IEY95_RS02425: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

IEY95_RS02430: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IEY95_RS02440: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.76	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.71	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.76	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.71	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.83 out of 23.79

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

Additional weak hits (13):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.19 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.50 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.78 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.10 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.52 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.60 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.40 out of 20.01

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.35 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.05 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.18 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 534688 - 596661:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln - Asn) + (X - X - X - Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IEY95_RS02380: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (21..438): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LSMTFDISAAELQAITTGEVDLYGPTETTIWATG
Nearest Stachelhaus code(s):: Ala DILQITLIYK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

IEY95_RS02385: X - X - X

AMP-binding (505..916): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LVTHFDMSVWEGNQTFGGEVNMYGITETTVHTTY
Nearest Stachelhaus code(s):: Ser DMWNTGLVHK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1578..1965): X

nrpys: D-Ala, Asn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWASFDLVVPNAKLVVAGEVNEYGPTEATVGTCV
Nearest Stachelhaus code(s):: D-Ala DLTKVNEVGK (76% 8Å match); Asn DLTKVGEVGK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2618..3000): X

nrpys: D-Ala, Asn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWASFDLVVPNAKLVVAGEVNEYGPTEATVGTCV
Nearest Stachelhaus code(s):: D-Ala DLTKVNEVGK (76% 8Å match); Asn DLTKVGEVGK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

IEY95_RS02415: Gln - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (9..407): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWSTFDAAAWETQGCSAGEWNTYGPTECSIDVTA
Nearest Stachelhaus code(s):: Gln DAWQCGLIDK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1055..1441): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWASFDLVVPNAKLVVAGEFNEYGPTEATVGTCV
Nearest Stachelhaus code(s):: D-Ala DLTKVNEVGK (76% 8Å match); Asn DLTKVGEVGK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BMMM01000001.1 - Region 4 - T3PKS,lassopeptide

Download region GenBank file

Download region SVG

Location: 880,436 - 937,274 nt. (total: 56,839 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase reductase

IEY95_RS03735: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

IEY95_RS03830: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IEY95_RS03835: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IEY95_RS03840: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IEY95_RS03850: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

IEY95_RS03865: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

IEY95_RS03885: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IEY95_RS03895: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: formyltransferase

IEY95_RS03760: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: deformylase hydrolase

IEY95_RS03770: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

IEY95_RS03905: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: synthase

IEY95_RS03880: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.66	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001550.3	0.61	ribosomal	citrulassin D	Streptomyces katrae
BGC0001552.3	0.61	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.60	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.60	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001310.5	0.54	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001548.4	0.46	ribosomal	citrulassin A	Streptomyces albulus
BGC0000902.4	0.44	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001781.4	0.40	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001507.3	0.37	ribosomal	anantin C	Streptomyces olindensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.87	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001550.3	0.85	ribosomal	citrulassin D	Streptomyces katrae
BGC0001552.3	0.85	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.84	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.84	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001310.5	0.81	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001548.4	0.76	ribosomal	citrulassin A	Streptomyces albulus
BGC0000902.4	0.75	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001781.4	0.72	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001507.3	0.70	ribosomal	anantin C	Streptomyces olindensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.43 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

Additional weak hits (8):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 26.85

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.47 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.75 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.57 out of 30.98

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.07 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.55 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 83; Score: 82.9; RRE type: Lasso_Fused_RRE; Location: 0 - 56; Score: 27.0

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BMMM01000002.1 - Region 1 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 228,326 - 283,816 nt. (total: 55,491 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IEY95_RS06145: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IEY95_RS06195: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Hydrolases: amidase esterase

IEY95_RS06140: thioesterase

smcogs: SMCOG1004: thioesterase

IEY95_RS06190: amidase

smcogs: SMCOG1105: amidase

Lyases: cyclase

IEY95_RS06215: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase synthase

IEY95_RS06100: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS06130: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IEY95_RS06150: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS48765: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.68	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.68	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.52 out of 27.04

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

Additional weak hits (17):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.47 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.47 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.82 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.98 out of 32.74

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.17 out of 21.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.19 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.38 out of 21.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.27 out of 30.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.39 out of 27.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.06 out of 27.55

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.70 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.70 out of 30.98

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.32 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.64 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 228325 - 283816:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (aThr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 228325 - 272165:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (aThr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 241059 - 283816:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (aThr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IEY95_RS06100: X

AMP-binding (18..427): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ASLPGNAVIADPTYGFGTEVEGYGSSEGGAAIQR
Nearest Stachelhaus code(s):: 6-clTrp DAAMCGGVAK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

IEY95_RS48765: mal

PKS_AT (598..921): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 147.8
inactive: 78.9
Methylmalonyl-CoA: 78.7
Methoxymalonyl-CoA: 73.9
Propionyl-CoA: 49.1
Isobutyryl-CoA: 42.4
Ethylmalonyl-CoA: 40.3
CHC-CoA: 34.5
2-Methylbutyryl-CoA: 31.9
trans-1,2-CPDA: 29.8
Benzoyl-CoA: 29.5
fatty_acid: 29.2
Acetyl-CoA: 22.7
3-Methylbutyryl-CoA: 14.7

IEY95_RS06150: aThr

Search NORINE for peptide: strict or relaxed

AMP-binding (361..743): aThr

nrpys: aThr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGSQVLGGEVNMYGITETTVHATA
Nearest Stachelhaus code(s):: aThr DFWSVGMVHK (94% 8Å match); Thr DFWSVGMVHK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
NtrC	Nitrogen regulatory protein C

NZ_BMMM01000002.1 - Region 2 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 302,749 - 332,521 nt. (total: 29,773 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IEY95_RS06410: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

IEY95_RS06435: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IEY95_RS06460: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: carboxylase transferase

IEY95_RS06445: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

IEY95_RS06450: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Lyases: decarboxylase

IEY95_RS06415: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase

IEY95_RS06440: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.77	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.77	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002690.2	0.60	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.77	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.77	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002690.2	0.60	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.26 out of 23.43

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 25.31

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.32 out of 27.04

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.36 out of 36.53

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

Additional weak hits (8):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.16 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.21 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.80 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.61 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.54 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.99 out of 36.53

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 39.62

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.43 out of 28.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor

NZ_BMMM01000002.1 - Region 3 - melanin

Download region GenBank file

Download region SVG

Location: 425,257 - 435,784 nt. (total: 10,528 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IEY95_RS06905: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.81	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.66	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.54	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.34	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.34	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.33	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.32	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.31	other (other)	iso-A82775C	Pestalotiopsis fici

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.81	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.66	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.54	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.34	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.34	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.33	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.32	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.31	other (other)	iso-A82775C	Pestalotiopsis fici

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.57 out of 31.73

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.66 out of 27.18

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.85 out of 25.88

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMMM01000003.1 - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 307,890 - 380,402 nt. (total: 72,513 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase reductase

IEY95_RS10715: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IEY95_RS10750: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

IEY95_RS10770: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

IEY95_RS10800: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

IEY95_RS10805: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

IEY95_RS10880: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IEY95_RS10925: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

IEY95_RS10950: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

IEY95_RS11040: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: kinase methyltransferase

IEY95_RS10810: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

IEY95_RS10840: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Lyases: cyclase hydratase

IEY95_RS10795: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

IEY95_RS10845: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

IEY95_RS10850: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

IEY95_RS10860: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

IEY95_RS10865: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.79	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.75	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.73	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.57	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001723.5	0.55	PKS	oviedomycin	Streptomyces antibioticus
BGC0001366.5	0.55	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000275.4	0.55	PKS	tetracenomycin C	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.79	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.75	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.73	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.57	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001723.5	0.55	PKS	oviedomycin	Streptomyces antibioticus
BGC0001366.5	0.55	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000275.4	0.55	PKS	tetracenomycin C	Streptomyces glaucescens

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.52 out of 29.72

Confidence: medium

Additional weak hits (17):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.20 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.43 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.09 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.40 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.50 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.77 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.21 out of 20.01

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.34 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.01 out of 28.14

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.59 out of 27.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.49 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.58 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.43 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.29 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.14 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 307889 to 380402
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

IEY95_RS10715: KR (Score: 107.9; E-value: 1.5e-33)
IEY95_RS10720: OXY (Score: 30.6; E-value: 4.2e-10)
IEY95_RS10840: MET C6|C8 (Score: 525.7; E-value: 9.3e-161)
IEY95_RS10845: CYC C4-C21/C2-C23|C2-C19 (Score: 162.6; E-value: 5.5e-51)
IEY95_RS10850: CYC C9-C14 (Score: 255.7; E-value: 2.7e-79)
IEY95_RS10855: ACP (Score: 76.4; E-value: 3.1e-24)
IEY95_RS10860: CLF (Score: 540.7; E-value: 4.8e-165)
IEY95_RS10865: KS (Score: 733.6; E-value: 1.4e-223)
IEY95_RS10870: CYC C5-C18 (Score: 211.3; E-value: 8.6e-66)
IEY95_RS10880: OXY (Score: 277.8; E-value: 4.2e-85)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMMM01000003.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 498,284 - 524,929 nt. (total: 26,646 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IEY95_RS11705: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

IEY95_RS11740: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

IEY95_RS11670: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

IEY95_RS11745: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase

IEY95_RS11755: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase synthetase

IEY95_RS11675: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

IEY95_RS11700: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.81	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000664.5	0.50	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000651.5	0.49	terpene	KS-505a	Streptomyces argenteolus
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.81	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000664.5	0.50	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000651.5	0.49	terpene	KS-505a	Streptomyces argenteolus
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

IEY95_RS11695: T2TS

Domain 1 (30 - 658): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

IEY95_RS11700: PT_FPPS_like

Domain 1 (86 - 377): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

IEY95_RS11710: PT_phytoene_like

Domain 1 (17 - 306): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

IEY95_RS11715: PT_phytoene_like

Domain 1 (19 - 280): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.16 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.87 out of 30.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.01 out of 27.04

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.62 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.27 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_BMMM01000003.1 - Region 3 - butyrolactone

Download region GenBank file

Download region SVG

Location: 611,338 - 622,378 nt. (total: 11,041 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

IEY95_RS12160: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IEY95_RS12180: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IEY95_RS12195: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Hydrolases: hydrolase

IEY95_RS12175: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: dehydratase

IEY95_RS12190: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000850.5	0.47	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001458.4	0.44	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0001896.4	0.41	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001223.5	0.40	other (other)	hydroxysporine	uncultured bacterium
BGC0002482.2	0.38	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0000813.3	0.37	other (other)	K-252a	Nonomuraea longicatena
BGC0002578.2	0.36	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002165.3	0.36	PKS	betaenone C, probetaenone I, stemphyloxin II, compound 4, compound 6, compound 7, compound 9, compound 3, dehydroprobetaenone I, compound 5	Parastagonospora nodorum SN15
BGC0001336.5	0.36	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001575.4	0.35	NRPS	PZN5, PZN6, PZN7, PZN9, PZN10, PZN11	Ruminococcus sp. 5_1_39BFAA

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000850.5	0.47	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001458.4	0.44	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0001896.4	0.41	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001223.5	0.40	other (other)	hydroxysporine	uncultured bacterium
BGC0002482.2	0.38	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0000813.3	0.37	other (other)	K-252a	Nonomuraea longicatena
BGC0002578.2	0.36	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002165.3	0.36	PKS	betaenone C, probetaenone I, stemphyloxin II, compound 4, compound 6, compound 7, compound 9, compound 3, dehydroprobetaenone I, compound 5	Parastagonospora nodorum SN15
BGC0001336.5	0.36	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001575.4	0.35	NRPS	PZN5, PZN6, PZN7, PZN9, PZN10, PZN11	Ruminococcus sp. 5_1_39BFAA

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 25.31

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMMM01000004.1 - Region 1 - CDPS

Download region GenBank file

Download region SVG

Location: 352,008 - 372,793 nt. (total: 20,786 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IEY95_RS14000: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IEY95_RS14015: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001948.3	0.67	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001986.3	0.56	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0000851.5	0.46	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0001224.5	0.44	other (other)	reductasporine	uncultured bacterium
BGC0000888.5	0.40	other (other)	bacilysin	Bacillus sp. CS93
BGC0002825.2	0.37	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406
BGC0001184.4	0.37	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000631.5	0.36	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002582.3	0.35	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001948.3	0.67	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001986.3	0.56	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0000851.5	0.46	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0001224.5	0.44	other (other)	reductasporine	uncultured bacterium
BGC0000888.5	0.40	other (other)	bacilysin	Bacillus sp. CS93
BGC0002825.2	0.37	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406
BGC0001184.4	0.37	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000631.5	0.36	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002582.3	0.35	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (5):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.54 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.25 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.03 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.96 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.50 out of 30.22

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_BMMM01000005.1 - Region 1 - T1PKS,terpene

Download region GenBank file

Download region SVG

Location: 1 - 35,358 nt. (total: 35,358 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IEY95_RS15030: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IEY95_RS15055: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: esterase

IEY95_RS15025: putative esterase

smcogs: SMCOG1104: putative esterase

Lyases: cyclase dehydratase

IEY95_RS15065: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

IEY95_RS15095: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase

IEY95_RS15015: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS15020: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: permease

IEY95_RS15105: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001483.4	0.30	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001164.3	0.30	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.30	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000037.4	0.30	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001257.3	0.30	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001986.3	0.29	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001910.4	0.29	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001284.4	0.29	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.28	PKS	ACT-Toxin II	Alternaria alternata
BGC0001911.3	0.28	terpene	raimonol	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000037.4	0.63	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001275.3	0.61	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

IEY95_RS15095: T1TS

Domain 1 (2 - 318): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (11):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.92 out of 32.74

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.09 out of 30.22

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 19.26

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.87 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.91 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.75 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.07 out of 21.84

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.12 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 35358:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 32440:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IEY95_RS15015: NH2

CAL_domain (164..481): NH2

minowa: NH2

Prediction, score:

NH2: 104.1
Acetyl-CoA: 46.8
fatty_acid: 20.8
shikimic_acid: 0.0
AHBA: 0.0

IEY95_RS15020: mmal

PKS_AT (616..904): mmal

ATSignature: Malonyl-CoA, Ethylmalonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; Ethylmalonyl-CoA: 62.5%; Methylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 105.1
Ethylmalonyl-CoA: 94.9
Methoxymalonyl-CoA: 92.3
Malonyl-CoA: 82.4
2-Methylbutyryl-CoA: 65.1
trans-1,2-CPDA: 64.1
Propionyl-CoA: 60.1
fatty_acid: 50.6
Isobutyryl-CoA: 48.9
inactive: 43.3
CHC-CoA: 41.7
Acetyl-CoA: 34.7
Benzoyl-CoA: 28.7
3-Methylbutyryl-CoA: 27.6

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMMM01000005.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 102,767 - 112,982 nt. (total: 10,216 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.51	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.41	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0000484.5	0.39	ribosomal	glycocin F	Lactobacillus plantarum
BGC0000617.5	0.38	ribosomal	coagulin	Bacillus coagulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.51	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.41	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0000484.5	0.39	ribosomal	glycocin F	Lactobacillus plantarum
BGC0000617.5	0.38	ribosomal	coagulin	Bacillus coagulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.25 out of 26.85

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.42 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.46 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.34 out of 27.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.46 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
RutR	Regulator of the pyrimidine and purine metabolism

NZ_BMMM01000005.1 - Region 3 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 206,965 - 229,106 nt. (total: 22,142 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001100.5	0.32	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0002673.2	0.26	PKS, other (other)	iminimycin A, iminimycin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000916.5	0.25	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000883.5	0.24	other (other)	arginomycin	Streptomyces arginensis
BGC0001302.5	0.23	other (other)	lomofungin	Streptomyces lomondensis
BGC0002556.2	0.22	other (other)	cervinomycin B3, cervinomycin C1, cervinomycin C2, cervinomycin C3, cervinomycin C4	Streptomyces sp.
BGC0001060.5	0.21	PKS	dynemicin A	Micromonospora chersina
BGC0001784.5	0.20	PKS	streptoseomycin	Streptomyces seoulensis
BGC0001025.5	0.20	NRPS, PKS	myxovirescin A1	Myxococcus xanthus DK 1622
BGC0000033.5	0.18	PKS	calicheamicin	Micromonospora echinospora

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001100.5	0.32	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0002673.2	0.26	PKS, other (other)	iminimycin A, iminimycin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000916.5	0.25	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000883.5	0.24	other (other)	arginomycin	Streptomyces arginensis
BGC0001302.5	0.23	other (other)	lomofungin	Streptomyces lomondensis
BGC0002556.2	0.22	other (other)	cervinomycin B3, cervinomycin C1, cervinomycin C2, cervinomycin C3, cervinomycin C4	Streptomyces sp.
BGC0001060.5	0.21	PKS	dynemicin A	Micromonospora chersina
BGC0001784.5	0.20	PKS	streptoseomycin	Streptomyces seoulensis
BGC0001025.5	0.20	NRPS, PKS	myxovirescin A1	Myxococcus xanthus DK 1622
BGC0000033.5	0.18	PKS	calicheamicin	Micromonospora echinospora

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.36 out of 25.31

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.00 out of 24.78

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

Additional weak hits (10):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.24 out of 23.43

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.51 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.16 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.23 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 26.85

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.59 out of 39.62

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.61 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.23 out of 20.01

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.13 out of 29.65

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 19 - 106; Score: 76.2

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
LexA variant 2	Repressor of DNA damage response
MexT	Global virulence regulator
ToxT	Regulator of MSHA biosynthesis

NZ_BMMM01000007.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 93,757 - 104,161 nt. (total: 10,405 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

IEY95_RS20230: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

IEY95_RS20240: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

IEY95_RS20265: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.71	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.71	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMMM01000008.1 - Region 1 - NAPAA

Download region GenBank file

Download region SVG

Location: 16,120 - 49,995 nt. (total: 33,876 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IEY95_RS22020: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

IEY95_RS22025: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IEY95_RS22095: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

IEY95_RS22100: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Hydrolases: deacetylase

IEY95_RS22065: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Isomerases: mutase

IEY95_RS22115: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Translocases: permease

IEY95_RS22005: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.18 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.52 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.19 out of 23.79

Confidence: medium

Additional weak hits (15):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.88 out of 20.01

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.41 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.11 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.86 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.78 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.35 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.67 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.15 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.34 out of 31.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.44 out of 36.54

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.83 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.20 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.08 out of 35.63

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.83 out of 36.53

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 16119 - 49995:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IEY95_RS22055: X

AMP-binding (41..414): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMMM01000009.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 66,037 - 99,136 nt. (total: 33,100 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IEY95_RS24220: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

IEY95_RS24175: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

IEY95_RS24225: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.52	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.52	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 26.06 out of 27.18

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

Additional weak hits (10):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.92 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.71 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.42 out of 18.57

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.63 out of 27.18

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NZ_BMMM01000009.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 310,314 - 321,687 nt. (total: 11,374 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.43	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002387.2	0.30	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001895.4	0.28	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0002788.2	0.26	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0000274.5	0.26	PKS	tetarimycin A, tetarimycin B	uncultured bacterium
BGC0001377.5	0.26	PKS	uncialamycin	Streptomyces uncialis
BGC0001596.3	0.26	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0000874.5	0.26	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000236.5	0.25	PKS	kinamycin	Streptomyces murayamaensis
BGC0001495.3	0.25	PKS	actinoallolide A	Actinoallomurus fulvus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.43	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002387.2	0.30	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001895.4	0.28	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0002788.2	0.26	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0000274.5	0.26	PKS	tetarimycin A, tetarimycin B	uncultured bacterium
BGC0001377.5	0.26	PKS	uncialamycin	Streptomyces uncialis
BGC0001596.3	0.26	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0000874.5	0.26	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000236.5	0.25	PKS	kinamycin	Streptomyces murayamaensis
BGC0001495.3	0.25	PKS	actinoallolide A	Actinoallomurus fulvus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.13 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.92 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.62 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMMM01000009.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 369,453 - 391,660 nt. (total: 22,208 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IEY95_RS25440: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: glucanase hydrolase peptidase protease

IEY95_RS25430: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

IEY95_RS25445: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IEY95_RS25475: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

IEY95_RS25485: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

Lyases: cyclase

IEY95_RS25450: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.85	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0001201.3	0.57	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0001986.3	0.44	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001485.4	0.42	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001336.5	0.42	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001483.4	0.41	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002347.3	0.40	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.85	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0001201.3	0.57	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0001986.3	0.44	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001485.4	0.42	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001336.5	0.42	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001483.4	0.41	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002347.3	0.40	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

IEY95_RS25450: T1TS + T1TS

Domain 1 (2 - 325): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (339 - 694): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.96 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

Additional weak hits (5):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.00 out of 27.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.06 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.21 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.80 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_BMMM01000010.1 - Region 1 - blactam

Download region GenBank file

Download region SVG

Location: 116,519 - 140,157 nt. (total: 23,639 nt) Show pHMM detection rules used

blactam: (BLS or CAS or tabtoxin)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

IEY95_RS26195: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IEY95_RS26200: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IEY95_RS26220: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

IEY95_RS26235: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Hydrolases: hydrolase

IEY95_RS26230: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Translocases: permease

IEY95_RS26255: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000845.5	0.69	other (non-nrp beta-lactam)	clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0000841.5	0.65	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate, clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0001151.5	0.61	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000844.5	0.51	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002031.3	0.47	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0000843.5	0.46	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0000846.5	0.46	other (other)	tabtoxin	Pseudomonas syringae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000845.5	0.69	other (non-nrp beta-lactam)	clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0000841.5	0.65	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate, clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0001151.5	0.61	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000844.5	0.51	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002031.3	0.47	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0000843.5	0.46	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0000846.5	0.46	other (other)	tabtoxin	Pseudomonas syringae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.42 out of 27.18

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.44 out of 27.18

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.43 out of 27.04

Confidence: strong

Additional weak hits (5):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.31 out of 27.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.32 out of 27.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.21 out of 20.01

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.21 out of 30.97

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.39 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
NrdR	Represses ribonucleotide reductase encoding genes
NtrC	Nitrogen regulatory protein C

NZ_BMMM01000010.1 - Region 2 - PKS-like,T2PKS,oligosaccharide

Download region GenBank file

Download region SVG

Location: 141,385 - 213,849 nt. (total: 72,465 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

IEY95_RS26285: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IEY95_RS26320: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

IEY95_RS26390: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

IEY95_RS26400: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase aminotransferase glycosyltransferase methyltransferase transferase

IEY95_RS26305: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

IEY95_RS26335: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

IEY95_RS26340: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

IEY95_RS26355: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

IEY95_RS26360: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

IEY95_RS26380: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

IEY95_RS26385: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

IEY95_RS26395: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

IEY95_RS26410: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Hydrolases: hydrolase

IEY95_RS26415: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: cyclase dehydratase

IEY95_RS26300: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

IEY95_RS26310: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

IEY95_RS26375: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

IEY95_RS26405: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IEY95_RS26425: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

IEY95_RS26430: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001439.5	1.55	PKS, saccharide	antibiotic HKI 10311129, antibiotic A2121-1, cervimycin D, cervimycin C, cervimycin A	Streptomyces sp. CS113
BGC0000231.5	1.09	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.89	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000272.3	0.82	PKS	spore pigment	Streptomyces collinus
BGC0000278.3	0.81	PKS	urdamycin	Streptomyces fradiae
BGC0001723.5	0.76	PKS	oviedomycin	Streptomyces antibioticus
BGC0001197.5	0.69	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001817.5	0.67	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000217.5	0.66	PKS	daunorubicin	Streptomyces sp.
BGC0000221.5	0.65	PKS	erdacin	uncultured soil bacterium V167

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001439.5	0.83	PKS, saccharide	antibiotic HKI 10311129, antibiotic A2121-1, cervimycin D, cervimycin C, cervimycin A	Streptomyces sp. CS113
BGC0000231.5	0.69	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000278.3	0.64	PKS	urdamycin	Streptomyces fradiae
BGC0000234.5	0.63	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

Additional weak hits (21):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.47 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.89 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.96 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.91 out of 30.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.14 out of 27.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.37 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.20 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.95 out of 27.55

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.56 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.91 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.61 out of 32.74

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.81 out of 20.01

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.39 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.98 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.84 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.86 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.01 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.59 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.93 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

IEY95_RS26305: mal

PKS_AT (15..297): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 55.8
Methoxymalonyl-CoA: 31.4
Methylmalonyl-CoA: 31.1
inactive: 20.7
Propionyl-CoA: 20.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 141384 to 213849
Starter unit(s):: malonamyl-CoA (Score: 849.0; E-value: 0)
propionyl-CoA (Score: 382.0; E-value: 2.53e-136)
Malonyl elongations:: 8|9 (Score: 682.8; E-value: 3.1e-208)
Product class(es):: anthracycline
aureolic acid
tetracycline
Product molecular weight(s):: malonamyl-CoA_8: 1292 Da
malonamyl-CoA_9: 1334 Da
propionyl-CoA_8: 1263 Da
propionyl-CoA_9: 1305 Da

IEY95_RS26285: OXY (Score: 424.3; E-value: 1.6e-129)
IEY95_RS26290: CYC C5-C14/C3-C16 (Score: 444.8; E-value: 2.2e-136)
IEY95_RS26295: CYC C1-C18|C2-C19 (Score: 204.2; E-value: 1.7e-63)
IEY95_RS26300: CYC C7-C12 (Score: 379.1; E-value: 3e-116)
IEY95_RS26305: AT (Score: 427.3; E-value: 9e-131); AT BAB72049.1_Aklavinone_propionyl-CoA (Score: 382.0; E-value: 2.53e-136)
IEY95_RS26340: GT (Score: 330.5; E-value: 4.2e-101)
IEY95_RS26355: GT (Score: 436.9; E-value: 2.1e-133)
IEY95_RS26360: GT (Score: 387.1; E-value: 2.8e-118)
IEY95_RS26380: GT (Score: 380.3; E-value: 3.3e-116)
IEY95_RS26385: MET C11O (Score: 420.8; E-value: 8e-129)
IEY95_RS26395: GT (Score: 410.9; E-value: 1.7e-125)
IEY95_RS26400: KR (Score: 187.0; E-value: 1.2e-57)
IEY95_RS26415: AMID (Score: 1079.2; E-value: 0.0); AMID ADE34521.1_SF2575_malonamyl-CoA (Score: 849.0; E-value: 0.0)
IEY95_RS26420: ACP (Score: 103.6; E-value: 9.8e-33)
IEY95_RS26425: CLF 8|9 (Score: 682.8; E-value: 3.1e-208)
IEY95_RS26430: KS (Score: 732.3; E-value: 3.4e-223)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMMM01000010.1 - Region 3 - NRPS-like,azole-containing-RiPP,benzoxazole

Download region GenBank file

Download region SVG

Location: 241,090 - 304,440 nt. (total: 63,351 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
benzoxazole: (ksIII and AMP-binding and PP-binding and Amidohydro_1)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase phosphate reductase

IEY95_RS26775: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IEY95_RS26805: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

IEY95_RS26825: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IEY95_RS26880: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IEY95_RS26920: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: transketolase

IEY95_RS26810: transketolase

smcogs: SMCOG1204: transketolase

Hydrolases: back translocase deacetylase hydrolase

IEY95_RS26755: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

IEY95_RS26770: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

IEY95_RS26850: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IEY95_RS26875: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

IEY95_RS26870: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

IEY95_RS26905: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

IEY95_RS26815: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

IEY95_RS26820: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS26855: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS26865: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IEY95_RS26895: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS26900: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001444.5	0.81	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0001249.5	0.77	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.62	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.58	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.56	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.55	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.55	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002493.3	0.53	NRPS	parabactin	Paracoccus denitrificans PD1222

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001444.5	0.72	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0001249.5	0.71	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.64	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002493.3	0.60	NRPS	parabactin	Paracoccus denitrificans PD1222

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

Additional weak hits (13):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.18 out of 20.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.36 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.12 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.76 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.97 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.29 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.14 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.50 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.81 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.75 out of 28.19

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Azole RiPPs

Predicted core structure(s)

For candidate cluster 5, location 241089 - 304440:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 253518 - 304440:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IEY95_RS26820: X

AMP-binding (34..457): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MAQSHQAFTWNMMGATGSAYALWGMTENCVTVTR
Nearest Stachelhaus code(s):: Asn DVAMAGMVTK (35% 8Å match); Leu DAWMYGAVIK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

IEY95_RS26855: X

AMP-binding (201..599): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSMAYGMIEVEPLLRVCGEINLYGSAEATVVASC
Nearest Stachelhaus code(s):: Boz GMVLRAVVVK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

IEY95_RS26895: Hpr

Search NORINE for peptide: strict or relaxed

AMP-binding (33..446): Hpr

nrpys: Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: pip (Hpr)

Stachelhaus prediction details:

Stachelhaus sequence:: QTVLFAWGCPGGSVQIGGAQQVFGMAEGLLTMTR
Nearest Stachelhaus code(s):: Hpa TWPSQGVLCK (82% 8Å match); Hpr PFPSQGVLTK (79% 8Å match); Sal ALPSQGVLNK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 11 - 106; Score: 75.7; RRE type: NHLP_CD_RRE; Location: 10 - 102; Score: 70.4; RRE type: Cyanobactin_D_RRE; Location: 7 - 86; Score: 52.3

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_BMMM01000012.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 252,475 - 273,584 nt. (total: 21,110 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

IEY95_RS30210: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000677.5	0.38	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.34	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.34	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000677.5	0.38	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.34	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.34	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IEY95_RS30210: PT_FPPS_like

Domain 1 (82 - 367): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.91 out of 23.79

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.09 out of 23.43

Confidence: medium

Additional weak hits (4):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.27 out of 23.43

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.73 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.89 out of 23.43

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMMM01000012.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 290,246 - 311,331 nt. (total: 21,086 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IEY95_RS30375: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: deformylase

IEY95_RS30385: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: cyclase

IEY95_RS30380: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.85	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001262.3	0.40	PKS	AK-toxin I	Alternaria alternata
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002339.3	0.37	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000678.5	0.36	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.85	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001262.3	0.40	PKS	AK-toxin I	Alternaria alternata
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002339.3	0.37	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000678.5	0.36	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

IEY95_RS30380: T1TS

Domain 1 (4 - 339): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 26.40 out of 27.18

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.55 out of 18.46

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.21 out of 27.18

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (4):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.85 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.19 out of 30.22

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
NrdR	Represses ribonucleotide reductase encoding genes
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMMM01000013.1 - Region 1 - NAPAA

Download region GenBank file

Download region SVG

Location: 121,309 - 156,511 nt. (total: 35,203 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IEY95_RS31355: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

IEY95_RS31415: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IEY95_RS31420: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: deaminase

IEY95_RS31360: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Ligases: ligase synthase

IEY95_RS31340: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

IEY95_RS31350: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

IEY95_RS31295: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.51 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.13 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

Additional weak hits (5):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.79 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.76 out of 27.04

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 121308 - 156511:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IEY95_RS31350: X

AMP-binding (248..650): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQAQVSVTGEVNAYGLTETSDDTNH
Nearest Stachelhaus code(s):: Dpr DIWQSTADDK (94% 8Å match); dnmeProp or Dab DIWQSTADDK (85% 8Å match); Asp DIWQSTADDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMMM01000013.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 166,038 - 187,111 nt. (total: 21,074 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IEY95_RS31550: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: methyltransferase

IEY95_RS31535: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

IEY95_RS31540: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

IEY95_RS31500: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.80	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.80	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000902.4	0.45	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001168.5	0.39	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0000285.5	0.38	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001841.2	0.38	NRPS, PKS	detoxin P1, detoxin P2, detoxin P3	Amycolatopsis jejuensis
BGC0000597.4	0.37	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0002347.3	0.37	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.80	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.80	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000902.4	0.45	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001168.5	0.39	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0000285.5	0.38	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001841.2	0.38	NRPS, PKS	detoxin P1, detoxin P2, detoxin P3	Amycolatopsis jejuensis
BGC0000597.4	0.37	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0002347.3	0.37	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

IEY95_RS31540: T1TS

Domain 1 (20 - 351): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.48 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.94 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.91 out of 23.79

Confidence: medium

Additional weak hits (6):

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.56 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.18 out of 27.04

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.47 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.47 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.07 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.83 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMMM01000014.1 - Region 1 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 96,544 - 145,057 nt. (total: 48,514 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

IEY95_RS32840: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

IEY95_RS32855: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

IEY95_RS32930: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: kinase

IEY95_RS32885: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: back translocase

IEY95_RS32865: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Ligases: ligase synthase

IEY95_RS32830: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS32900: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.71	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.70	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.61	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002175.3	0.59	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.58	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.58	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.68	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.68	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (10):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.45 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.45 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.65 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.88 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.02 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.94 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.16 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.23 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.10 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 96543 - 145057:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA - ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IEY95_RS32830: X

AMP-binding (23..478): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: PTLLYGLMIQGLYAQQTGR-----------FALA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

IEY95_RS32900: AHBA - mal

CAL_domain (36..447): AHBA

minowa: AHBA

Prediction, score:

AHBA: 276.6
shikimic_acid: 215.1
fatty_acid: 0.0
Acetyl-CoA: 0.0
NH2: -3.4

PKS_AT (1162..1450): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 173.4
inactive: 93.6
Methoxymalonyl-CoA: 61.1
Methylmalonyl-CoA: 53.0
Isobutyryl-CoA: 31.2
Propionyl-CoA: 25.5
Benzoyl-CoA: 18.4
Ethylmalonyl-CoA: 17.5
fatty_acid: 15.4
Acetyl-CoA: 15.3
trans-1,2-CPDA: 15.1
2-Methylbutyryl-CoA: 14.4
CHC-CoA: 9.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_BMMM01000019.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 21,782 - 31,991 nt. (total: 10,210 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase

IEY95_RS38520: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Lyases: dehydratase

IEY95_RS38525: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.34	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002637.3	0.23	NRPS	rimomycin A, rimomycin B, rimomycin C	Streptomyces sp. WAC 06783
BGC0002104.3	0.21	NRPS, PKS	eurocidin D, eurocidin E	Streptomyces eurocidicus ATCC 27428
BGC0002671.2	0.21	PKS	kendomycin B	Verrucosispora sp.
BGC0001094.5	0.19	NRPS, PKS	enacyloxin IIa	Burkholderia ambifaria AMMD

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.34	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002637.3	0.23	NRPS	rimomycin A, rimomycin B, rimomycin C	Streptomyces sp. WAC 06783
BGC0002104.3	0.21	NRPS, PKS	eurocidin D, eurocidin E	Streptomyces eurocidicus ATCC 27428
BGC0002671.2	0.21	PKS	kendomycin B	Verrucosispora sp.
BGC0001094.5	0.19	NRPS, PKS	enacyloxin IIa	Burkholderia ambifaria AMMD

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.75 out of 23.79

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.09 out of 23.43

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

Additional weak hits (6):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.85 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.61 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.25 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.84 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.08 out of 25.88

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BMMM01000019.1 - Region 2 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 176,872 - 189,817 nt. (total: 12,946 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

IEY95_RS39190: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

IEY95_RS39200: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Hydrolases: peptidase

IEY95_RS39185: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.40	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002436.2	0.39	other (other)	coformycin	Streptomyces citricolor
BGC0001782.3	0.33	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0001364.3	0.32	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002407.3	0.31	other (other), saccharide	angustmycin A, angustmycin C	Streptomyces angustmyceticus
BGC0001065.5	0.31	PKS	herboxidiene	Streptomyces chromofuscus
BGC0001007.5	0.29	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001810.3	0.28	PKS	trehangelin	Polymorphospora rubra
BGC0001006.5	0.27	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.40	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002436.2	0.39	other (other)	coformycin	Streptomyces citricolor
BGC0001782.3	0.33	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0001364.3	0.32	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002407.3	0.31	other (other), saccharide	angustmycin A, angustmycin C	Streptomyces angustmyceticus
BGC0001065.5	0.31	PKS	herboxidiene	Streptomyces chromofuscus
BGC0001007.5	0.29	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001810.3	0.28	PKS	trehangelin	Polymorphospora rubra
BGC0001006.5	0.27	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 22.40

Confidence: strong

Additional weak hits (7):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.55 out of 31.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.74 out of 24.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.22 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.43 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.15 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 17.67 out of 22.40

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.84 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
HypR	L-hydroxyproline utilization repressor

NZ_BMMM01000020.1 - Region 1 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 90,992 - 113,065 nt. (total: 22,074 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

IEY95_RS39675: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IEY95_RS39690: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001733.3	0.39	ribosomal	PcpA	Pleurocapsa sp. PCC 7327
BGC0002425.3	0.35	ribosomal	stlassin	Streptomyces sp.
BGC0000218.5	0.34	PKS	doxorubicin	Streptomyces peucetius
BGC0000916.5	0.32	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0001510.5	0.31	other (other)	anisomycin	Streptomyces hygrospinosus
BGC0000678.5	0.30	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001100.5	0.30	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0000188.5	0.30	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0002220.2	0.29	terpene	Ent-kauren-16alpha-ol	Punctularia strigosozonata HHB-11173 SS5

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001733.3	0.39	ribosomal	PcpA	Pleurocapsa sp. PCC 7327
BGC0002425.3	0.35	ribosomal	stlassin	Streptomyces sp.
BGC0000218.5	0.34	PKS	doxorubicin	Streptomyces peucetius
BGC0000916.5	0.32	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0001510.5	0.31	other (other)	anisomycin	Streptomyces hygrospinosus
BGC0000678.5	0.30	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001100.5	0.30	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0000188.5	0.30	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0002220.2	0.29	terpene	Ent-kauren-16alpha-ol	Punctularia strigosozonata HHB-11173 SS5

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 25.13 out of 30.22

Confidence: medium

Additional weak hits (2):

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.60 out of 30.98

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.77 out of 23.43

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 1 - 62; Score: 47.9

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMMM01000022.1 - Region 1 - melanin,terpene-precursor

Download region GenBank file

Download region SVG

Location: 35,265 - 60,535 nt. (total: 25,271 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

IEY95_RS40975: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthetase

IEY95_RS40955: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000908.3	0.71	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.27	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.26	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.26	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0001485.4	0.21	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000909.3	0.21	other (other)	melanin	Streptomyces avermitilis
BGC0002397.2	0.20	terpene	astallatene	Arabidopsis thaliana
BGC0000678.5	0.19	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002400.2	0.18	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001366.5	0.16	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000908.3	0.72	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.61	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.60	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.53	other (other)	melanin	Streptomyces avermitilis
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.50	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002398.2	0.44	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000885.3	0.42	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

IEY95_RS40955: PT_FPPS_like

Domain 1 (57 - 348): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.47 out of 23.79

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.66 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 26.03 out of 30.11

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 19.46 out of 20.01

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.86 out of 21.84

Confidence: medium

Additional weak hits (10):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.15 out of 30.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.37 out of 25.75

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.39 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.13 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.48 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.63 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.55 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.56 out of 26.06

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.54 out of 20.01

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
CRP	Cyclic AMP receptor protein
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMMM01000022.1 - Region 2 - CDPS

Download region GenBank file

Download region SVG

Location: 103,152 - 123,319 nt. (total: 20,168 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: reductase

IEY95_RS41295: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

Transferases: methyltransferase

IEY95_RS41315: methyltransferase

smcogs: SMCOG1089: methyltransferase

IEY95_RS41370: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.44	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0001468.5	0.36	other (trna-derived)	bicyclomycin	Streptomyces cinnamoneus
BGC0001366.5	0.35	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0002208.3	0.34	NRPS	oxepinamide F	Aspergillus ustus
BGC0002285.2	0.34	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001440.5	0.33	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0002000.4	0.32	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000821.5	0.31	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001333.5	0.31	other (other)	BE-54017	uncultured bacterium AB1650
BGC0000207.5	0.31	PKS	chartreusin	Streptomyces chartreusis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.44	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0001468.5	0.36	other (trna-derived)	bicyclomycin	Streptomyces cinnamoneus
BGC0001366.5	0.35	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0002208.3	0.34	NRPS	oxepinamide F	Aspergillus ustus
BGC0002285.2	0.34	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001440.5	0.33	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0002000.4	0.32	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000821.5	0.31	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001333.5	0.31	other (other)	BE-54017	uncultured bacterium AB1650
BGC0000207.5	0.31	PKS	chartreusin	Streptomyces chartreusis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 28.54 out of 32.93

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 32.38 out of 32.38

Confidence: strong

Additional weak hits (6):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.81 out of 30.22

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.80 out of 24.78

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.11 out of 32.38

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.18 out of 32.38

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CsoR	Copper-responsive repressor
RicR	Copper-responsive regulator

NZ_BMMM01000025.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 76,601 - 107,791 nt. (total: 31,191 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

IEY95_RS43365: aminotransferase

smcogs: SMCOG1019: aminotransferase

Isomerases: mutase

IEY95_RS43370: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.49	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002007.2	0.43	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002584.2	0.42	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002387.2	0.41	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000285.5	0.40	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.49	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002007.2	0.43	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002584.2	0.42	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002387.2	0.41	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000285.5	0.40	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.10 out of 28.19

Confidence: medium

Additional weak hits (6):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.69 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.53 out of 26.85

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.47 out of 25.88

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.58 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_BMMM01000025.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 130,109 - 153,505 nt. (total: 23,397 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IEY95_RS43595: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IEY95_RS43600: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase halogenase

IEY95_RS43575: aminotransferase

smcogs: SMCOG1019: aminotransferase

IEY95_RS43605: flavin-dependent tyrosine-like hpg halogenase

halogenases: flavin-dependent tyrosine-like hpg halogenase
MITE: MITE0000028Halogenation (identity: 72.70%)
smcogs: SMCOG1119: halogenase

Ligases: ligase

IEY95_RS43620: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.76	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0001641.4	0.68	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.76	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0001641.4	0.68	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.91 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.36 out of 27.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.23 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BMMM01000027.1 - Region 1 - T1PKS,T3PKS,polyhalogenated-pyrrole

Download region GenBank file

Download region SVG

Location: 66,127 - 137,960 nt. (total: 71,834 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
polyhalogenated-pyrrole: (Abhydrolase_6 and Trp_halogenase and (Acyl-CoA_dh_N or Acyl-CoA_dh_M or Acyl-CoA_dh_1) and AMP-binding)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

IEY95_RS44540: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

IEY95_RS44610: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

IEY95_RS44615: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

IEY95_RS44630: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

IEY95_RS44640: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: PPTase acylase halogenase methyltransferase transferase

IEY95_RS44525: methyltransferase

smcogs: SMCOG1089: methyltransferase

IEY95_RS44555: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

IEY95_RS44650: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

IEY95_RS44660: flavin-dependent pyrrole halogenase

halogenases: flavin-dependent pyrrole halogenase
smcogs: SMCOG1119: halogenase

IEY95_RS44665: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

IEY95_RS44675: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

IEY95_RS44680: ambiguous flavin-dependent halogenase

halogenases: ambiguous flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

Hydrolases: dehalogenase esterase hydrolase

IEY95_RS44585: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

IEY95_RS44645: thioesterase

smcogs: SMCOG1004: thioesterase

IEY95_RS44710: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase synthase

IEY95_RS44560: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IEY95_RS44575: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

IEY95_RS44635: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS44670: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	1.34	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0000131.5	0.94	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0001641.4	0.84	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.83	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.79	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.78	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.78	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.78	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001464.3	0.77	other (other)	tetrabromopyrrole	Pseudoalteromonas sp. PS5
BGC0001261.3	0.77	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000131.5	0.65	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001258.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.73 out of 23.79

Confidence: medium

Additional weak hits (14):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.36 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.84 out of 30.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.18 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.64 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.67 out of 20.01

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.64 out of 31.73

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.17 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.62 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.69 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.33 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 66126 - 137960:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - pk) + (ccmal)
Non-colinear ordering:: IEY95_RS44665 + IEY95_RS44670

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 66126 - 107188:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 87054 - 137960:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - pk) + (ccmal)
Non-colinear ordering:: IEY95_RS44665 + IEY95_RS44670

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IEY95_RS44635: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (9..393): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWAAFDLSVFDAYSVFAGELNWYGPTETNVCTSY
Nearest Stachelhaus code(s):: Pro DLFYVAWVCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

IEY95_RS44665: mal - pk

PKS_AT (539..831): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 70.8%; CE-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 106.7
Methylmalonyl-CoA: 105.8
Methoxymalonyl-CoA: 96.1
Propionyl-CoA: 75.8
Isobutyryl-CoA: 61.8
Ethylmalonyl-CoA: 59.2
2-Methylbutyryl-CoA: 56.5
trans-1,2-CPDA: 50.6
3-Methylbutyryl-CoA: 44.3
Benzoyl-CoA: 36.3
CHC-CoA: 35.6
Acetyl-CoA: 35.1
inactive: 29.6
fatty_acid: 21.8

PKS_AT (1632..1929): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 58.3%; Ethylmalonyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 131.2
Methoxymalonyl-CoA: 111.1
Ethylmalonyl-CoA: 104.9
2-Methylbutyryl-CoA: 83.6
Malonyl-CoA: 83.2
Isobutyryl-CoA: 70.9
Benzoyl-CoA: 69.0
Propionyl-CoA: 64.1
trans-1,2-CPDA: 61.1
CHC-CoA: 60.5
Acetyl-CoA: 55.3
fatty_acid: 51.1
inactive: 23.8
3-Methylbutyryl-CoA: 23.4

IEY95_RS44670: mal

PKS_AT (566..860): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.0
inactive: 123.4
Methoxymalonyl-CoA: 92.9
Methylmalonyl-CoA: 77.4
Propionyl-CoA: 56.0
Ethylmalonyl-CoA: 45.0
CHC-CoA: 40.2
2-Methylbutyryl-CoA: 35.3
Acetyl-CoA: 24.9
trans-1,2-CPDA: 24.7
Isobutyryl-CoA: 20.2
Benzoyl-CoA: 19.9
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_BMMM01000029.1 - Region 1 - NRPS,PKS-like,T3PKS

Download region GenBank file

Download region SVG

Location: 18,928 - 114,905 nt. (total: 95,978 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
PKS-like: (t2pks2 or ksIII)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

IEY95_RS45510: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

IEY95_RS45565: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IEY95_RS45615: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

IEY95_RS45645: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase methyltransferase sulfhydrylase

IEY95_RS45380: methyltransferase

smcogs: SMCOG1089: methyltransferase

IEY95_RS45520: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

IEY95_RS45595: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

IEY95_RS45700: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: back translocase deaminase esterase

IEY95_RS45530: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

IEY95_RS45535: thioesterase

smcogs: SMCOG1004: thioesterase

IEY95_RS45605: thioesterase

smcogs: SMCOG1004: thioesterase

IEY95_RS45660: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Lyases: hydratase

IEY95_RS45675: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

IEY95_RS45680: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

IEY95_RS45730: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

IEY95_RS45490: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS45495: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS45505: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS45545: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IEY95_RS45555: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IEY95_RS45560: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS45570: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

IEY95_RS45610: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

IEY95_RS45620: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS45630: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IEY95_RS45695: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

IEY95_RS45705: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.26	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	1.23	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	1.20	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.19	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	1.19	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	1.19	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	1.19	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001249.5	1.18	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001758.4	1.15	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	1.13	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.78	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.76	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.76	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001249.5	0.75	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.73	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

Additional weak hits (19):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.88 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.43 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.41 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.54 out of 20.01

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.58 out of 26.12

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.36 out of 39.62

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.54 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.08 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.65 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.62 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.58 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.58 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.26 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.48 out of 27.04

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.75 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.03 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 18927 - 114905:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Dhpg) + (X) + (NH2 - X - X) + (X) + (Val) + (Pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IEY95_RS45490: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (464..855): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWQAFDVAFQESFLATAGEDNQYGPSETHVVVAE
Nearest Stachelhaus code(s):: Pro DVQFAAQVVK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

IEY95_RS45495: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (110..504): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LPDAWDAFSLEGWLLTGGEINGYGPVESCVFATT
Nearest Stachelhaus code(s):: Val DALWLGGVFK (59% 8Å match)
Stachelhaus code match:: 100% (strong)

IEY95_RS45505: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (14..406): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDGCFDPSAFEGWLLGGGEVNGYGPTEDTCFTSC
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

IEY95_RS45545: X

AMP-binding (513..904): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDVSMYEGSQLFAGEVNMYGITETTVHASW
Nearest Stachelhaus code(s):: Ser DVYSLALVHK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

IEY95_RS45555: X

AMP-binding (13..422): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISVWQTEIVATGEVNAYGPTECSDDVTH
Nearest Stachelhaus code(s):: Dpr DIWEVTADDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

IEY95_RS45560: NH2 - X

CAL_domain (39..454): NH2

minowa: NH2

Prediction, score:

NH2: 113.9
fatty_acid: 40.3
Acetyl-CoA: 11.0
AHBA: 7.2
shikimic_acid: 0.0

AMP-binding (1086..1483): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HQLAFDISVWQTELLSTGEHNAYGPAECTDDVTA
Nearest Stachelhaus code(s):: Dpr DIWELTADDK (79% 8Å match); Dab DIWELTADDK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

IEY95_RS45620: X

AMP-binding (237..632): X

nrpys: Piz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MWQAFDVSFQEGFLNTAGEGNHYGQSESAMVSSY
Nearest Stachelhaus code(s):: Piz DVQFNAHMVK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

IEY95_RS45630: X

AMP-binding (5..415): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: YHVFFDPSVYDTNSLFCGEENIYGPTEMTVTCAE
Nearest Stachelhaus code(s):: Cys DPYNMCIVTK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

IEY95_RS45705: Dhpg

Search NORINE for peptide: strict or relaxed

AMP-binding (10..406): Dhpg

nrpys: Dhpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDAAFDASLHGMEMSTGGDRATYGPTETTLYATQ
Nearest Stachelhaus code(s):: Dhpg DAHQAGTLYK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BMMM01000030.1 - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 1 - 42,710 nt. (total: 42,710 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IEY95_RS45770: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IEY95_RS45805: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

IEY95_RS45810: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

IEY95_RS45865: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IEY95_RS45885: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: carboxylase methyltransferase transferase

IEY95_RS45755: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

IEY95_RS45760: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

IEY95_RS45905: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: dehalogenase hydrolase

IEY95_RS45830: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

IEY95_RS45900: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: cyclase

IEY95_RS45765: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

IEY95_RS45790: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

IEY95_RS45780: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

IEY95_RS45785: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.82	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.75	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.68	PKS	oviedomycin	Streptomyces antibioticus
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0002047.2	0.61	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0002012.4	0.60	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0001596.3	0.59	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002514.3	0.58	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0001904.2	0.58	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.82	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.75	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.68	PKS	oviedomycin	Streptomyces antibioticus
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0002047.2	0.61	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0002012.4	0.60	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0001596.3	0.59	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002514.3	0.58	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0001904.2	0.58	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.22 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (6):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.68 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.89 out of 21.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.43 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.94 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.20 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.14 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 0 to 42710
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 8|9 (Score: 671.3; E-value: 9.7e-205)
Product molecular weight(s):: acetyl-CoA_8: 337 Da
acetyl-CoA_9: 379 Da

IEY95_RS45765: CYC C7-C12 (Score: 451.8; E-value: 2.1e-138)
IEY95_RS45770: KR C9 (Score: 466.4; E-value: 5.5e-143)
IEY95_RS45775: ACP (Score: 117.0; E-value: 6.4e-37)
IEY95_RS45780: CLF 8|9 (Score: 671.3; E-value: 9.7e-205)
IEY95_RS45785: KS (Score: 787.3; E-value: 6.8e-240)
IEY95_RS45790: CYC (Score: 60.0; E-value: 6.2e-19)
IEY95_RS45805: KR (Score: 124.0; E-value: 1.9e-38)
IEY95_RS45830: CYC C5-C14 (Score: 454.0; E-value: 4.6e-139)
IEY95_RS45885: KR (Score: 184.9; E-value: 5e-57)

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BMMM01000031.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 18,149 - 62,024 nt. (total: 43,876 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

IEY95_RS46315: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

IEY95_RS46345: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

IEY95_RS46410: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

Transferases: halogenase

IEY95_RS46360: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

IEY95_RS46365: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

Hydrolases: deacetylase hydrolase

IEY95_RS46355: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

IEY95_RS46390: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: lyase

IEY95_RS46380: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase

IEY95_RS46375: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.62	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.62	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.48 out of 23.79

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 26.06 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.19 out of 30.11

Confidence: medium

Additional weak hits (5):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.47 out of 30.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.73 out of 21.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.75 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.45 out of 32.93

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 18148 - 62024:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IEY95_RS46375: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (252..654): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDLSVFECNTNVAGELNLYGPSEDTTYSTC
Nearest Stachelhaus code(s):: Ala DLFNNALTYK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism

NZ_BMMM01000038.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 8,517 nt. (total: 8,517 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

IEY95_RS48275: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS48280: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.62	NRPS	enniatin	Fusarium equiseti
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.62	NRPS	enniatin	Fusarium equiseti
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 8517:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IEY95_RS48275: Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (1224..1620): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDAAVSEMTVVVAGEVNAYGPTEATVCAAM
Nearest Stachelhaus code(s):: Tyr DASTVAAVCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_BMMM01000040.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 7,365 nt. (total: 7,365 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

IEY95_RS48335: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

IEY95_RS48345: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 7365:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Trp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

IEY95_RS48325: X

AMP-binding (10..152): X

nrpys: Ser, Thr, Dhpg, Hpg

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: --------------LTGGDRHLYGPTETTLCATW
Nearest Stachelhaus code(s):: Hpg DAFHLGLLCK (59% 8Å match)
Stachelhaus code match:: 60% (weak)

IEY95_RS48335: Trp

Search NORINE for peptide: strict or relaxed

AMP-binding (633..1036): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: trp (Trp)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRVFDVSMADPAMIVGGEYSEYGVTEATVASTV
Nearest Stachelhaus code(s):: Trp DVAAVGEVTK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

NZ_BMMM01000042.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 4,147 nt. (total: 4,147 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

IEY95_RS48390: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

IEY95_RS48395: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

IEY95_RS48395: Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (466..800): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LERAFDVSLFEVHLLTGGDRHLYGPTEVTLCATW
Nearest Stachelhaus code(s):: Hpg DVFHLGLLCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor