GCF_014203735.1 - 34 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JACHJQ010000001.1 (Actinophytocola algeriensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRP-metallophore,NRPS	397,009	455,087	Low	peucechelin	NRPS:Type I
Region 1.2	terpene-precursor	572,294	593,319
Region 1.3	terpene	1,069,268	1,094,302	Low	carotenoid	terpene

NZ_JACHJQ010000002.1 (Actinophytocola algeriensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	RiPP-like	122,549	133,382
Region 2.2	NRPS-like,NRPS	1,175,352	1,236,941
Region 2.3	T3PKS,NRPS	1,267,773	1,319,925	Low	feglymycin	NRPS:Type I

NZ_JACHJQ010000003.1 (Actinophytocola algeriensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	lassopeptide	1	16,667
Region 3.2	terpene-precursor	671,832	692,752
Region 3.3	terpene,betalactone	835,959	874,309	High	geosmin	terpene:Sesquiterpene
Region 3.4	ectoine	1,053,514	1,063,912	High	ectoine	other:ectoine

NZ_JACHJQ010000005.1 (Actinophytocola algeriensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	T1PKS	46,114	89,122	Low	rubiginone A2/rubiginone J/rubiginone K/rubiginone L/rubiginone M/rubiginone N/ochromycinone/rubiginone B2	PKS
Region 5.2	T1PKS	393,974	440,087
Region 5.3	redox-cofactor	643,868	665,883	Low	lankacidin C	NRPS:Type I+PKS
Region 5.4	terpene	772,092	793,114
Region 5.5	NRPS,T1PKS	816,742	868,403

NZ_JACHJQ010000006.1 (Actinophytocola algeriensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	T1PKS,NRPS	16,026	73,460	Low	amycolamycin A/amycolamycin B	PKS
Region 6.2	ectoine	84,261	94,638	Low	showdomycin	other:other
Region 6.3	T1PKS,hglE-KS,NRPS-like,azole-containing-RiPP,NRPS	133,843	295,806	Low	hexacosalactone A	other:other
Region 6.4	NRPS-like	606,128	647,858
Region 6.5	NAPAA,lanthipeptide-class-iii	721,725	759,512	Medium	catenulipeptin	ribosomal:RiPP:Lanthipeptide
Region 6.6	NI-siderophore	837,577	867,268	Low	nonactin/monactin/dinactin/trinactin/tetranactin	PKS

NZ_JACHJQ010000008.1 (Actinophytocola algeriensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	T1PKS,NRPS,NRPS-like	1,972	83,490
Region 8.2	lanthipeptide-class-ii	193,655	216,693
Region 8.3	betalactone	329,229	359,828
Region 8.4	hydrogen-cyanide	424,980	437,670	Low	aborycin	ribosomal:RiPP

NZ_JACHJQ010000009.1 (Actinophytocola algeriensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	NRPS	670	43,735

NZ_JACHJQ010000010.1 (Actinophytocola algeriensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	T1PKS,oligosaccharide	22,540	163,132	Low	eurocidin D/eurocidin E	NRPS:Type I+PKS:Type I
Region 10.2	NRPS-like	172,474	214,156
Region 10.3	NRPS,T1PKS	226,641	311,561

NZ_JACHJQ010000011.1 (Actinophytocola algeriensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	HR-T2PKS	268,040	310,291

NZ_JACHJQ010000012.1 (Actinophytocola algeriensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	T1PKS	114,358	161,638

NZ_JACHJQ010000016.1 (Actinophytocola algeriensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	NRPS-like,NRPS,terpene	29,186	77,738	Low	polyoxypeptin	NRPS:Type I+PKS

NZ_JACHJQ010000017.1 (Actinophytocola algeriensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	phenazine	18,213	38,683	Low	diastaphenazine/izumiphenazine C	other:other

NZ_JACHJQ010000018.1 (Actinophytocola algeriensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	T1PKS,NRPS,NRPS-like	1	42,551

No secondary metabolite regions were found in these records:: NZ_JACHJQ010000004.1 (Actinophytocola algeriensis); NZ_JACHJQ010000007.1 (Actinophytocola algeriensis); NZ_JACHJQ010000013.1 (Actinophytocola algeriensis); NZ_JACHJQ010000014.1 (Actinophytocola algeriensis); NZ_JACHJQ010000015.1 (Actinophytocola algeriensis); NZ_JACHJQ010000019.1 (Actinophytocola algeriensis); NZ_JACHJQ010000020.1 (Actinophytocola algeriensis); NZ_JACHJQ010000021.1 (Actinophytocola algeriensis); NZ_JACHJQ010000022.1 (Actinophytocola algeriensis); NZ_JACHJQ010000023.1 (Actinophytocola algeriensis)

Compact view

NZ_JACHJQ010000001.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 397,009 - 455,087 nt. (total: 58,079 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FHR82_RS01985: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

FHR82_RS02050: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: formyltransferase

FHR82_RS01990: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: hydrolase

FHR82_RS02055: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: hydratase

FHR82_RS01975: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

FHR82_RS01905: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS02000: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.76	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001240.4	0.67	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001240.4	0.67	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.12 out of 23.79

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.16 out of 36.53

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.53 out of 27.04

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.72 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (22):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.42 out of 32.74

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.80 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.83 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.12 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.05 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.63 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.99 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.55 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.02 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.16 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.38 out of 36.53

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.09 out of 27.04

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.56 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.85 out of 23.43

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 397008 - 455087:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn - D-Hpr - OH-Orn - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS01905: X

AMP-binding (19..418): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VLYPFAYGLGSFFGISAGELDGLGSTEALHIFLS
Nearest Stachelhaus code(s):: pNH2-Bz AYNFIAGSTK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

FHR82_RS02000: Fo-OH-Orn - Hpr - OH-Orn - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (437..822): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTAAFDVTVWDMILVVGTEVVAYGLTEATVNSTL
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWIIGAVNK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1815..2178): Hpr

nrpys: Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: pip (Hpr)

Stachelhaus prediction details:

Stachelhaus sequence:: LWLIFDPSLAEWVSFSGGEYNVYGPTEATVLVTS
Nearest Stachelhaus code(s):: aIle DALVFGVVLK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (3178..3586): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4221..4611): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTAAFDVAVFEMILLVGTELAAYGLTEATVNSTL
Nearest Stachelhaus code(s):: OH-Orn DVFILGAVNK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJQ010000001.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 572,294 - 593,319 nt. (total: 21,026 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

FHR82_RS02750: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Lyases: dehydratase

FHR82_RS02765: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase synthetase

FHR82_RS02725: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

FHR82_RS02735: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000665.5	0.45	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000666.5	0.42	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0000663.5	0.42	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001594.3	0.41	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000668.5	0.41	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001501.5	0.40	other (other)	ambiguine P	Fischerella sp. TAU
BGC0001126.4	0.40	other (other), terpene	12-epi-hapalindole J isonitrile, ambiguine A isonitrile, ambiguine B isonitrile, ambiguine C isonitrile, ambiguine D isonitrile, ambiguine E isonitrile, ambiguine K isonitrile, ambiguine L isonitrile, ambiguine I isonitrile, ambiguine J isonitrile	Fischerella ambigua UTEX 1903

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000665.5	0.45	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000666.5	0.42	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0000663.5	0.42	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001594.3	0.41	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000668.5	0.41	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001501.5	0.40	other (other)	ambiguine P	Fischerella sp. TAU
BGC0001126.4	0.40	other (other), terpene	12-epi-hapalindole J isonitrile, ambiguine A isonitrile, ambiguine B isonitrile, ambiguine C isonitrile, ambiguine D isonitrile, ambiguine E isonitrile, ambiguine K isonitrile, ambiguine L isonitrile, ambiguine I isonitrile, ambiguine J isonitrile	Fischerella ambigua UTEX 1903

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

FHR82_RS02735: PT_FPPS_like

Domain 1 (54 - 340): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.64 out of 27.04

Confidence: medium

Additional weak hits (14):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.99 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.08 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.88 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.75 out of 28.14

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.89 out of 25.88

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.42 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.04 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.04 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.35 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.11 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.87 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.55 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.40 out of 25.88

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NZ_JACHJQ010000001.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 1,069,268 - 1,094,302 nt. (total: 25,035 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FHR82_RS05140: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: kinase

FHR82_RS05170: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: amidase

FHR82_RS05090: amidase

smcogs: SMCOG1105: amidase

Ligases: synthetase

FHR82_RS05145: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.58	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.55	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.55	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.55	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.55	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000640.3	0.52	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.51	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.51	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000648.3	0.50	terpene	carotenoid	Myxococcus xanthus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.58	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.55	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.55	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.55	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.55	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000640.3	0.52	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.51	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.51	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000648.3	0.50	terpene	carotenoid	Myxococcus xanthus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

FHR82_RS05130: PT_phytoene_like

Domain 1 (16 - 302): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

FHR82_RS05145: PT_FPPS_like

Domain 1 (56 - 352): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 26.01 out of 29.65

Confidence: medium

Additional weak hits (8):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.46 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.13 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.85 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.32 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.02 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.39 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
LexA variant 1	Repressor of DNA damage response

NZ_JACHJQ010000002.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 122,549 - 133,382 nt. (total: 10,834 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FHR82_RS06850: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Transferases: methyltransferase

FHR82_RS06805: methyltransferase

smcogs: SMCOG1248: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001206.5	0.34	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0001364.3	0.31	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002007.2	0.26	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001765.3	0.26	saccharide	salecan	Agrobacterium tumefaciens
BGC0001705.4	0.25	NRPS, PKS	nodularin	Nostoc sp. CENA543
BGC0000818.5	0.25	NRPS	notoamide A	Aspergillus versicolor
BGC0002297.2	0.24	NRPS, PKS	MC-LR, MC-LHty, MC-HphHty, MC-LHph, MC-HphHph	Phormidium sp. LP904c
BGC0001667.4	0.24	NRPS, PKS	microcystin-LR, microcystin-FR, microcystin-LA, microcystin-LAba, microcystin-LM, microcystin-LV, microcystin-LL	Fischerella sp. CENA161
BGC0002039.3	0.24	other (other)	coformycin, formycin A	Nocardia interforma ATCC 21072
BGC0001016.5	0.24	NRPS, PKS	microcystin	Anabaena sp. 90

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001206.5	0.34	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0001364.3	0.31	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002007.2	0.26	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001765.3	0.26	saccharide	salecan	Agrobacterium tumefaciens
BGC0001705.4	0.25	NRPS, PKS	nodularin	Nostoc sp. CENA543
BGC0000818.5	0.25	NRPS	notoamide A	Aspergillus versicolor
BGC0002297.2	0.24	NRPS, PKS	MC-LR, MC-LHty, MC-HphHty, MC-LHph, MC-HphHph	Phormidium sp. LP904c
BGC0001667.4	0.24	NRPS, PKS	microcystin-LR, microcystin-FR, microcystin-LA, microcystin-LAba, microcystin-LM, microcystin-LV, microcystin-LL	Fischerella sp. CENA161
BGC0002039.3	0.24	other (other)	coformycin, formycin A	Nocardia interforma ATCC 21072
BGC0001016.5	0.24	NRPS, PKS	microcystin	Anabaena sp. 90

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (1):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.21 out of 20.97

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJQ010000002.1 - Region 2 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1,175,352 - 1,236,941 nt. (total: 61,590 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FHR82_RS11675: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHR82_RS11685: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHR82_RS11690: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHR82_RS11730: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHR82_RS11790: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: deaminase esterase peptidase

FHR82_RS11655: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

FHR82_RS11670: thioesterase

smcogs: SMCOG1004: thioesterase

FHR82_RS11700: thioesterase

smcogs: SMCOG1004: thioesterase

FHR82_RS11705: thioesterase

smcogs: SMCOG1004: thioesterase

FHR82_RS11770: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: dehydratase

FHR82_RS11810: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

FHR82_RS11695: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS11715: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS11720: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FHR82_RS11725: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS11745: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.98	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.97	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.93	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.92	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.92	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.91	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.90	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.89	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.89	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.84	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.78	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.76	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.75	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.73	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.53 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.19 out of 30.11

Confidence: medium

Additional weak hits (15):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.10 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.12 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.97 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.39 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.21 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.83 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.27 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.66 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.64 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 1175351 - 1236941:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - X - X) + (Ser) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 1175351 - 1217148:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - X - X) + (Ser) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 1180923 - 1236941:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - X - X) + (Ser) + (Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS11695: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (19..407): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNDAFDASVFEGFLLTGGDHAAYGPTETTVFTSF
Nearest Stachelhaus code(s):: Ile or Val DAFWLGAVFK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

FHR82_RS11715: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (515..899): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDVSMYECSQLFAGEVNLYGTTETTVHASW
Nearest Stachelhaus code(s):: Ser DVYSLALVHK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

FHR82_RS11720: X

AMP-binding (8..409): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISVWQTEIVATGEVNAYGPTECSDDVTH
Nearest Stachelhaus code(s):: Dpr DIWEVTADDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

FHR82_RS11725: fatty_acid - X

CAL_domain (42..479): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 22.5
AHBA: 15.1
NH2: 9.9
shikimic_acid: 8.1
Acetyl-CoA: 0.2

AMP-binding (1134..1536): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HQLAFDISVWQTELLSTGEHNAYGPAECTDDVTA
Nearest Stachelhaus code(s):: Dpr DIWELTADDK (79% 8Å match); Dab DIWELTADDK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor

NZ_JACHJQ010000002.1 - Region 3 - NRPS,T3PKS

Download region GenBank file

Download region SVG

Location: 1,267,773 - 1,319,925 nt. (total: 52,153 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase glycosyltransferase

FHR82_RS12065: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

FHR82_RS12110: aminotransferase

smcogs: SMCOG1019: aminotransferase

FHR82_RS12125: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: hydratase

FHR82_RS12075: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

FHR82_RS12080: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

FHR82_RS12085: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

FHR82_RS12090: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

FHR82_RS12095: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS12105: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.87	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.83	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.83	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.83	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.80	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.79	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.77	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.84 out of 26.85

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 25.31

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (8):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.38 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.70 out of 20.01

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.31 out of 36.54

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.54 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.75 out of 27.04

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.59 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.04 out of 39.62

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 1267772 - 1319925:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 1267772 - 1308903:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 1268948 - 1319925:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS12095: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (480..870): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDASVLEPQALTGGEVNLYGPTETTVYSTC
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

FHR82_RS12105: X - X

AMP-binding (463..850): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LRFCFDGSPWEMTVIVAGEVNSYGPSEATVISTG
Nearest Stachelhaus code(s):: His DTWTIASVSK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1503..1900): X

nrpys: Dhpg, Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDPSFDATTWEGSLTTGGDRTTYGPTEMTLCVTQ
Nearest Stachelhaus code(s):: Dhpg DAYNAGTLCK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJQ010000003.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1 - 16,667 nt. (total: 16,667 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

FHR82_RS12295: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001552.3	0.53	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001781.4	0.53	ribosomal	sphaericin	Planomonospora sphaerica
BGC0000571.3	0.53	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001551.4	0.52	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0000575.5	0.52	ribosomal	lariatin	Rhodococcus jostii
BGC0001634.3	0.52	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001549.3	0.52	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001889.2	0.51	ribosomal	fusilassin	Thermobifida fusca YX
BGC0002425.3	0.44	ribosomal	stlassin	Streptomyces sp.
BGC0000578.3	0.42	ribosomal	SRO15-2005	Streptomyces filamentosus NRRL 15998

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001552.3	0.53	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001781.4	0.53	ribosomal	sphaericin	Planomonospora sphaerica
BGC0000571.3	0.53	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001551.4	0.52	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0000575.5	0.52	ribosomal	lariatin	Rhodococcus jostii
BGC0001634.3	0.52	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001549.3	0.52	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001889.2	0.51	ribosomal	fusilassin	Thermobifida fusca YX
BGC0002425.3	0.44	ribosomal	stlassin	Streptomyces sp.
BGC0000578.3	0.42	ribosomal	SRO15-2005	Streptomyces filamentosus NRRL 15998

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.13 out of 23.43

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.42 out of 19.52

Confidence: strong

Additional weak hits (6):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.19 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.50 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.41 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.31 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.85 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.89 out of 30.25

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 3 - 82; Score: 72.7; RRE type: Lasso_Fused_RRE; Location: 6 - 82; Score: 25.7

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator

NZ_JACHJQ010000003.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 671,832 - 692,752 nt. (total: 20,921 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase aminotransferase

FHR82_RS15545: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

FHR82_RS15555: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Lyases: dehydratase

FHR82_RS15560: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

FHR82_RS15575: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.43	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001747.3	0.42	other (other)	pseudaminic acid	Tannerella forsythia
BGC0001651.3	0.41	other (other)	legionaminic acid	Tannerella forsythia 92A2
BGC0000898.5	0.40	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000906.3	0.40	other (other)	heme D1	Heliophilum fasciatum
BGC0000905.5	0.39	other (other)	heme D1	Heliobacillus mobilis
BGC0000665.5	0.39	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000789.3	0.39	saccharide	O-antigen	Escherichia coli
BGC0001529.5	0.39	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000678.5	0.38	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.43	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001747.3	0.42	other (other)	pseudaminic acid	Tannerella forsythia
BGC0001651.3	0.41	other (other)	legionaminic acid	Tannerella forsythia 92A2
BGC0000898.5	0.40	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000906.3	0.40	other (other)	heme D1	Heliophilum fasciatum
BGC0000905.5	0.39	other (other)	heme D1	Heliobacillus mobilis
BGC0000665.5	0.39	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000789.3	0.39	saccharide	O-antigen	Escherichia coli
BGC0001529.5	0.39	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000678.5	0.38	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

FHR82_RS15575: PT_FPPS_like

Domain 1 (24 - 304): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.49 out of 30.22

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.33 out of 26.85

Confidence: medium

Additional weak hits (5):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.18 out of 27.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.52 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.63 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.51 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.12 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
ClgR	Caseinolytic protease gene regulator
RutR	Regulator of the pyrimidine and purine metabolism

NZ_JACHJQ010000003.1 - Region 3 - betalactone,terpene

Download region GenBank file

Download region SVG

Location: 835,959 - 874,309 nt. (total: 38,351 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

FHR82_RS16430: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHR82_RS16435: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHR82_RS16445: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHR82_RS16455: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

Transferases: acetyltransferase

FHR82_RS16425: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Lyases: cyclase

FHR82_RS16330: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase

FHR82_RS16395: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

FHR82_RS16410: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.54	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.44	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002567.2	0.25	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0002568.2	0.25	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002447.3	0.23	ribosomal	cerecyclin	Bacillus cereus
BGC0000487.5	0.23	ribosomal	carnocyclin	Carnobacterium maltaromaticum
BGC0002487.3	0.23	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0002656.2	0.22	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0000488.4	0.22	ribosomal	circularin A	Clostridium beijerinckii
BGC0002488.3	0.21	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000867.3	0.52	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002707.2	0.51	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0001928.2	0.50	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000866.5	0.50	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000888.5	0.48	other (other)	bacilysin	Bacillus sp. CS93
BGC0001184.4	0.46	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002567.2	0.45	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0002568.2	0.45	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

FHR82_RS16330: T1TS + T1TS

Domain 1 (1 - 325): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (332 - 690): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.93 out of 26.33

Confidence: medium

Additional weak hits (5):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.45 out of 26.85

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.68 out of 36.54

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.74 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.54 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.99 out of 36.53

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJQ010000003.1 - Region 4 - ectoine

Download region GenBank file

Download region SVG

Location: 1,053,514 - 1,063,912 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

FHR82_RS17390: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.81	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000858.3	0.72	other (other)	ectoine	Methylobacter marinus
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000854.3	0.65	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000856.3	0.55	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.55	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.54	other (other)	ectoine	Methylophaga alcalica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.81	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000858.3	0.72	other (other)	ectoine	Methylobacter marinus
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000854.3	0.65	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000856.3	0.55	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.55	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.54	other (other)	ectoine	Methylophaga alcalica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.78 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.08 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.22 out of 30.22

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.14 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.47 out of 26.85

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.63 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_JACHJQ010000005.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 46,114 - 89,122 nt. (total: 43,009 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxygenase reductase

FHR82_RS22830: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

FHR82_RS22840: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

FHR82_RS22930: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

FHR82_RS22970: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: methyltransferase

FHR82_RS22955: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: glucanase hydrolase

FHR82_RS22805: isochorismatase

smcogs: SMCOG1027: isochorismatase

FHR82_RS22860: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

FHR82_RS22950: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: decarboxylase

FHR82_RS22910: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

FHR82_RS22810: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

FHR82_RS22885: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001258.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001258.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (7):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.51 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.74 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.47 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.93 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.92 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 46113 - 89122:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS22885: mmal

PKS_AT (524..820): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 75.0%; Malonyl-CoA: 70.8%; Methoxymalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 150.9
Ethylmalonyl-CoA: 125.8
Methoxymalonyl-CoA: 117.0
Malonyl-CoA: 103.7
2-Methylbutyryl-CoA: 85.4
Isobutyryl-CoA: 84.0
trans-1,2-CPDA: 81.1
Propionyl-CoA: 80.7
Acetyl-CoA: 76.5
Benzoyl-CoA: 59.4
CHC-CoA: 52.0
3-Methylbutyryl-CoA: 49.3
fatty_acid: 24.3
inactive: 23.6

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_JACHJQ010000005.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 393,974 - 440,087 nt. (total: 46,114 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

FHR82_RS24440: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

FHR82_RS24525: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

FHR82_RS46390: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: esterase

FHR82_RS24480: putative esterase

smcogs: SMCOG1104: putative esterase

Ligases: ligase synthase

FHR82_RS24475: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS24485: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (11):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.91 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.28 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.85 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.96 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.28 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.19 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.65 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.81 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.98 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 393973 - 440087:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS24475: NH2

CAL_domain (55..508): NH2

minowa: NH2

Prediction, score:

NH2: 50.6
Acetyl-CoA: 40.8
fatty_acid: 32.8
AHBA: 17.6
shikimic_acid: -0.3

FHR82_RS24485: mmal

PKS_AT (620..912): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; Methylmalonyl-CoA: 62.5%; Propionyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 98.1
Malonyl-CoA: 86.3
Methoxymalonyl-CoA: 85.0
Ethylmalonyl-CoA: 77.8
CHC-CoA: 63.9
fatty_acid: 57.5
2-Methylbutyryl-CoA: 56.5
Propionyl-CoA: 56.0
Isobutyryl-CoA: 50.2
Acetyl-CoA: 31.4
inactive: 27.4
3-Methylbutyryl-CoA: 24.4
Benzoyl-CoA: 23.6
trans-1,2-CPDA: -1.4

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CelR	Cellobiose uptake repressor
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JACHJQ010000005.1 - Region 3 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 643,868 - 665,883 nt. (total: 22,016 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

FHR82_RS25575: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

FHR82_RS25660: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Hydrolases: hydrolase

FHR82_RS25600: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase

FHR82_RS25595: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002163.3	0.53	other (other)	fusatin, fusatinic acid, 8-oxo-fusatin, 8-oxo-isopentenyladenine	Fusarium pseudograminearum CS3096
BGC0002407.3	0.46	other (other), saccharide	angustmycin A, angustmycin C	Streptomyces angustmyceticus
BGC0001223.5	0.43	other (other)	hydroxysporine	uncultured bacterium
BGC0002621.2	0.41	other (other)	angustmycin A, angustmycin B, angustmycin C, aristeromycin, arabinofuranosyladenine	Streptomyces angustmyceticus
BGC0000906.3	0.41	other (other)	heme D1	Heliophilum fasciatum
BGC0001366.5	0.41	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000905.5	0.41	other (other)	heme D1	Heliobacillus mobilis
BGC0001336.5	0.40	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0002554.2	0.40	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0000636.3	0.39	terpene	carotenoid	Brevibacterium linens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002163.3	0.53	other (other)	fusatin, fusatinic acid, 8-oxo-fusatin, 8-oxo-isopentenyladenine	Fusarium pseudograminearum CS3096
BGC0002407.3	0.46	other (other), saccharide	angustmycin A, angustmycin C	Streptomyces angustmyceticus
BGC0001223.5	0.43	other (other)	hydroxysporine	uncultured bacterium
BGC0002621.2	0.41	other (other)	angustmycin A, angustmycin B, angustmycin C, aristeromycin, arabinofuranosyladenine	Streptomyces angustmyceticus
BGC0000906.3	0.41	other (other)	heme D1	Heliophilum fasciatum
BGC0001366.5	0.41	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000905.5	0.41	other (other)	heme D1	Heliobacillus mobilis
BGC0001336.5	0.40	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0002554.2	0.40	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0000636.3	0.39	terpene	carotenoid	Brevibacterium linens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.42 out of 19.52

Confidence: strong

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 27.38 out of 29.65

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.52 out of 24.78

Confidence: strong

Additional weak hits (4):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.44 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.35 out of 27.18

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.58 out of 23.43

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 4 - 83; Score: 78.6

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response

NZ_JACHJQ010000005.1 - Region 4 - terpene

Download region GenBank file

Download region SVG

Location: 772,092 - 793,114 nt. (total: 21,023 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FHR82_RS26355: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase

FHR82_RS26270: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.48	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002496.3	0.42	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000188.5	0.40	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000671.3	0.38	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002346.3	0.38	ribosomal	kyamicin	Saccharopolyspora sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.48	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002496.3	0.42	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000188.5	0.40	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000671.3	0.38	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002346.3	0.38	ribosomal	kyamicin	Saccharopolyspora sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

FHR82_RS26315: Lycopene_cycl

Domain 1 (3 - 333): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.17 out of 23.43

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.76 out of 23.79

Confidence: medium

Additional weak hits (2):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.95 out of 30.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.05 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
IolR	Regulator of the inositol catabolism

NZ_JACHJQ010000005.1 - Region 5 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 816,742 - 868,403 nt. (total: 51,662 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FHR82_RS26530: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHR82_RS26535: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acyltransferase aminotransferase glycosyltransferase kinase

FHR82_RS26515: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

FHR82_RS26525: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

FHR82_RS26545: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

FHR82_RS26555: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

FHR82_RS26595: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

FHR82_RS26625: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

FHR82_RS26675: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: hydrolase

FHR82_RS26505: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: ligase synthase

FHR82_RS26610: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS26615: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHR82_RS26620: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS47625: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0001250.4	0.72	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.72	NRPS	epichloenin A	Epichloe festucae
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.68	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001250.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.36 out of 25.31

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.91 out of 27.18

Confidence: medium

Additional weak hits (11):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.14 out of 25.75

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.77 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.93 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.96 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.54 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.21 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.48 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.75 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.15 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 816741 - 868403:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr) + (Val) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS26595: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (461..861): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LPTHFDFSVWEGSQVLGGEVNMYGITEGTVHVTI
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

FHR82_RS26610: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (531..909): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAFDASTLEVWLFTGGGTNGYGPTENTTFTTT
Nearest Stachelhaus code(s):: Val DALWLGGTFK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

FHR82_RS26615: mal

PKS_AT (520..808): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 94.1
Methoxymalonyl-CoA: 61.1
inactive: 56.1
Methylmalonyl-CoA: 51.9
Propionyl-CoA: 29.8
fatty_acid: 27.5
Ethylmalonyl-CoA: 26.3
2-Methylbutyryl-CoA: 25.5
Isobutyryl-CoA: 17.1
trans-1,2-CPDA: 15.4
Benzoyl-CoA: 13.8
CHC-CoA: 10.3
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

FHR82_RS26620: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (152..546): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAIDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
NrdR	Represses ribonucleotide reductase encoding genes
OsdR	Development and stress management regulator

NZ_JACHJQ010000006.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 16,026 - 73,460 nt. (total: 57,435 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

FHR82_RS27295: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHR82_RS27350: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FHR82_RS27495: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Lyases: dehydratase

FHR82_RS27390: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

FHR82_RS27370: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHR82_RS27400: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

FHR82_RS27405: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.64	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0000056.3	0.59	PKS	esperamicin	Actinomadura verrucosospora
BGC0000357.5	0.57	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001284.4	0.56	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.55	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.54	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.54	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.50	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0000056.3	0.63	PKS	esperamicin	Actinomadura verrucosospora
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.62	PKS	asperlactone	Aspergillus ochraceus
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.75 out of 18.57

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.17 out of 27.04

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.65 out of 23.43

Confidence: medium

Additional weak hits (25):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.44 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.21 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.30 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.48 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.21 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.44 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.21 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.79 out of 29.65

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.59 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.75 out of 20.01

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.32 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.64 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.15 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.63 out of 20.01

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.63 out of 20.01

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.78 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.89 out of 33.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.47 out of 30.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.45 out of 30.22

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 16025 - 73460:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 16025 - 61839:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 30274 - 73460:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS27370: mal

PKS_AT (616..847): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 82.8
Methoxymalonyl-CoA: 50.4
Methylmalonyl-CoA: 42.8
inactive: 39.3
Isobutyryl-CoA: 36.4
Propionyl-CoA: 31.6
Ethylmalonyl-CoA: 22.0
fatty_acid: 16.5
Benzoyl-CoA: 8.9
CHC-CoA: 4.1
2-Methylbutyryl-CoA: 1.7
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

FHR82_RS27405: X

AMP-binding (458..865): X

nrpys: aza-bTyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWFAYDASLVEAQTLLAGEVNLYGPTETILATWY
Nearest Stachelhaus code(s):: aza-bTyr DACELALLAK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
DasR	N-acetylglucosamine dependent repressor
ToxT	Regulator of MSHA biosynthesis

NZ_JACHJQ010000006.1 - Region 2 - ectoine

Download region GenBank file

Download region SVG

Location: 84,261 - 94,638 nt. (total: 10,378 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

FHR82_RS27605: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHR82_RS27620: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: sulfhydrylase

FHR82_RS27615: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Ligases: ligase

FHR82_RS27590: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001778.5	0.61	other (other)	showdomycin	Streptomyces showdoensis
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001778.5	0.61	other (other)	showdomycin	Streptomyces showdoensis
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJQ010000006.1 - Region 3 - NRPS,NRPS-like,T1PKS,azole-containing-RiPP,hglE-KS

Download region GenBank file

Download region SVG

Location: 133,843 - 295,806 nt. (total: 161,964 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FHR82_RS27890: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHR82_RS27915: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHR82_RS27945: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

FHR82_RS27970: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHR82_RS27975: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

FHR82_RS28040: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHR82_RS28050: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHR82_RS28085: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHR82_RS28220: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

FHR82_RS28300: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: acylase glycosyltransferase methyltransferase

FHR82_RS27865: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

FHR82_RS27880: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

FHR82_RS27885: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

FHR82_RS27920: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

FHR82_RS28310: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: dehalogenase esterase hydrolase protease

FHR82_RS27805: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

FHR82_RS27810: putative esterase

smcogs: SMCOG1104: putative esterase

FHR82_RS27870: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

FHR82_RS28070: thioesterase

smcogs: SMCOG1004: thioesterase

FHR82_RS28225: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

FHR82_RS28235: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase synthase

FHR82_RS27935: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS27950: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

FHR82_RS27985: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHR82_RS27990: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHR82_RS27995: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHR82_RS28000: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHR82_RS28030: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHR82_RS28035: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS28145: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS28210: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS47645: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

FHR82_RS28005: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001168.5	2.44	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0001641.4	1.89	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	1.47	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	1.44	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	1.42	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	1.42	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	1.42	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	1.41	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001135.5	1.40	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	1.40	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001168.5	0.79	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0001273.3	0.77	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.77	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.77	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.77	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000067.5	0.68	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 29.64 out of 32.93

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (42):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.57 out of 29.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.33 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.60 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.90 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.56 out of 32.93

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.21 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.49 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.71 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.40 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.96 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.74 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.29 out of 33.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.05 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.18 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.83 out of 30.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.65 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.14 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.07 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.89 out of 27.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.77 out of 21.55

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.16 out of 27.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.93 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.67 out of 24.78

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 24.37 out of 32.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.32 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.37 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.24 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.88 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.55 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.87 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.19 out of 28.19

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Azole RiPPs

Predicted core structure(s)

For candidate cluster 5, location 133842 - 295806:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk) + (mal) + (Arg) + (redmal) + (ccmal) + (ohmal) + (ccmal - ccmal - ccmal) + (AHBA - ccmal - ccmal) + (Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 133842 - 184551:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk) + (mal) + (Arg)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 154267 - 197288:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (redmal) + (Arg) + (mal) + (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 169313 - 268766:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA - ccmal - ccmal) + (ccmal - ccmal - ccmal) + (ohmal) + (ccmal) + (redmal) + (Arg)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 251969 - 295806:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS27880: pk

PKS_AT (594..804): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 11.6
Malonyl-CoA: 4.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

FHR82_RS27885: mal

PKS_AT (1180..1464): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 71.5
Methoxymalonyl-CoA: 42.1
Methylmalonyl-CoA: 35.0
inactive: 34.9
Propionyl-CoA: 18.6
CHC-CoA: 13.5
trans-1,2-CPDA: 10.3
Ethylmalonyl-CoA: 7.7
fatty_acid: 7.2
2-Methylbutyryl-CoA: 5.6
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

FHR82_RS27935: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (12..408): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VELGFDTSIEQVDLIVGGEVNAYGLTETTITSCV
Nearest Stachelhaus code(s):: Arg DTEDIGAITK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

FHR82_RS27990: mal

PKS_AT (561..845): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 220.8
inactive: 118.6
Methoxymalonyl-CoA: 68.0
Methylmalonyl-CoA: 58.1
Isobutyryl-CoA: 31.6
Propionyl-CoA: 29.2
Acetyl-CoA: 17.5
Benzoyl-CoA: 16.3
Ethylmalonyl-CoA: 14.3
fatty_acid: 12.0
trans-1,2-CPDA: 11.5
CHC-CoA: 10.8
2-Methylbutyryl-CoA: 7.3
3-Methylbutyryl-CoA: 0.0

FHR82_RS27995: mal

PKS_AT (550..830): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 209.8
inactive: 104.0
Methoxymalonyl-CoA: 70.3
Methylmalonyl-CoA: 66.5
Propionyl-CoA: 36.1
Isobutyryl-CoA: 34.1
Ethylmalonyl-CoA: 26.4
Acetyl-CoA: 18.5
Benzoyl-CoA: 17.9
2-Methylbutyryl-CoA: 17.4
CHC-CoA: 17.1
fatty_acid: 17.0
trans-1,2-CPDA: 11.5
3-Methylbutyryl-CoA: 6.5

FHR82_RS28000: mal

PKS_AT (534..806): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.7
inactive: 99.8
Methoxymalonyl-CoA: 75.8
Methylmalonyl-CoA: 70.6
Ethylmalonyl-CoA: 38.8
Isobutyryl-CoA: 36.1
Propionyl-CoA: 33.6
trans-1,2-CPDA: 31.2
fatty_acid: 24.6
Acetyl-CoA: 24.0
Benzoyl-CoA: 19.5
CHC-CoA: 18.9
3-Methylbutyryl-CoA: 12.4
2-Methylbutyryl-CoA: -1.7

FHR82_RS28030: mal - mal - mal

PKS_AT (539..794): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 208.2
inactive: 103.8
Methoxymalonyl-CoA: 64.5
Methylmalonyl-CoA: 55.5
Propionyl-CoA: 29.3
Isobutyryl-CoA: 21.6
Ethylmalonyl-CoA: 21.6
Acetyl-CoA: 20.5
Benzoyl-CoA: 18.6
CHC-CoA: 12.2
fatty_acid: 10.0
trans-1,2-CPDA: 9.7
2-Methylbutyryl-CoA: 7.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (2154..2409): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.6
inactive: 108.2
Methoxymalonyl-CoA: 65.2
Methylmalonyl-CoA: 60.0
Isobutyryl-CoA: 34.9
Propionyl-CoA: 30.3
Ethylmalonyl-CoA: 28.5
Benzoyl-CoA: 22.5
Acetyl-CoA: 20.5
2-Methylbutyryl-CoA: 19.8
CHC-CoA: 16.9
trans-1,2-CPDA: 12.7
fatty_acid: 12.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (3765..4035): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 186.5
inactive: 108.8
Methoxymalonyl-CoA: 62.8
Methylmalonyl-CoA: 52.3
Acetyl-CoA: 31.8
Propionyl-CoA: 27.6
Isobutyryl-CoA: 22.6
Ethylmalonyl-CoA: 14.6
Benzoyl-CoA: 14.4
fatty_acid: 9.0
2-Methylbutyryl-CoA: 6.2
CHC-CoA: 5.3
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

FHR82_RS28035: AHBA

CAL_domain (34..449): AHBA

minowa: AHBA

Prediction, score:

AHBA: 225.5
shikimic_acid: 158.0
NH2: 3.9
fatty_acid: 0.0
Acetyl-CoA: 0.0

FHR82_RS28085: AHBA - mal - mal

CAL_domain (34..438): AHBA

minowa: AHBA

Prediction, score:

AHBA: 235.3
shikimic_acid: 192.8
fatty_acid: 0.0
NH2: 0.0
Acetyl-CoA: 0.0

PKS_AT (1472..1736): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 191.7
inactive: 98.4
Methoxymalonyl-CoA: 57.1
Methylmalonyl-CoA: 41.3
Propionyl-CoA: 21.3
Isobutyryl-CoA: 19.0
Acetyl-CoA: 17.9
Ethylmalonyl-CoA: 11.7
Benzoyl-CoA: 11.3
CHC-CoA: 9.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (3100..3359): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 196.1
inactive: 87.9
Methoxymalonyl-CoA: 58.3
Methylmalonyl-CoA: 45.7
Propionyl-CoA: 20.4
Acetyl-CoA: 13.0
Isobutyryl-CoA: 12.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

FHR82_RS28145: X

AMP-binding (12..419): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VALAIGGIWWAGCLIYGGAAQIYGLTETGNTAVC
Nearest Stachelhaus code(s):: Pen or C4:0 IGWCGGVCTK (56% 8Å match); Val DGWFIGIIIK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

FHR82_RS28210: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (465..873): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LHHAFDTSWEGWDIALGGEYNLYGPTECTVDTLH
Nearest Stachelhaus code(s):: Orn DTEDMGLVDK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 11 - 112; Score: 78.8; RRE type: NHLP_CD_RRE; Location: 10 - 90; Score: 69.7; RRE type: Cyanobactin_D_RRE; Location: 11 - 87; Score: 52.0

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
RicR	Copper-responsive regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_JACHJQ010000006.1 - Region 4 - NRPS-like

Download region GenBank file

Download region SVG

Location: 606,128 - 647,858 nt. (total: 41,731 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

FHR82_RS29725: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

FHR82_RS29780: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

FHR82_RS29790: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHR82_RS29890: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: sulfhydrylase

FHR82_RS29830: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: esterase

FHR82_RS29795: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

FHR82_RS29775: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

FHR82_RS29800: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.71	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.71	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.71 out of 27.04

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.08 out of 27.04

Confidence: medium

Additional weak hits (10):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.41 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.89 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.29 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.08 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.84 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.03 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.10 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.95 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 11, location 606127 - 647858:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS29800: X

AMP-binding (22..397): X

nrpys: 6-clTrp, Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FALLFDGWFWCLCMVVAGELNVYGPTEATIAATW
Nearest Stachelhaus code(s):: 6-clTrp or Trp DGWCVAVIAK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DasR	N-acetylglucosamine dependent repressor

NZ_JACHJQ010000006.1 - Region 5 - NAPAA,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 721,725 - 759,512 nt. (total: 37,788 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)
lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: dehalogenase

FHR82_RS30235: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase

FHR82_RS30295: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.56	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.51	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.50	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002174.2	0.48	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0000519.4	0.47	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000513.3	0.47	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000518.3	0.38	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002698.2	0.38	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000553.3	0.33	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002700.2	0.32	ribosomal	bacinapeptin	Bacillus nakamurai

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0000551.5	0.61	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000496.5	0.59	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.33 out of 23.43

Confidence: medium

Additional weak hits (18):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.44 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.06 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.51 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.59 out of 36.54

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.99 out of 27.18

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.19 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.85 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.88 out of 23.43

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.10 out of 23.43

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.86 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.52 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.54 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 12, location 721724 - 759512:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 13, location 721724 - 755549:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS30295: X

AMP-binding (36..409): X

nrpys: Gln, Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTILGGEWNTYGPTEATVVACG
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator

NZ_JACHJQ010000006.1 - Region 6 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 837,577 - 867,268 nt. (total: 29,692 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

FHR82_RS30775: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHR82_RS30790: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHR82_RS30815: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

FHR82_RS30825: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

FHR82_RS30875: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: carboxylase transferase

FHR82_RS30780: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

FHR82_RS30785: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Lyases: decarboxylase

FHR82_RS30820: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.67	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0001478.5	0.64	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002284.3	0.54	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000941.3	0.52	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001453.5	0.52	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.52	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002620.2	0.52	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000244.4	0.50	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.3	0.67	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0001478.5	0.64	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002284.3	0.54	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000941.3	0.52	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001453.5	0.52	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.52	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002620.2	0.52	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000244.4	0.50	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.93 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.57 out of 36.53

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_JACHJQ010000008.1 - Region 1 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1,972 - 83,490 nt. (total: 81,519 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FHR82_RS33865: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHR82_RS33985: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FHR82_RS34040: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

FHR82_RS34050: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

FHR82_RS34060: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHR82_RS48090: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase aminotransferase glycosyltransferase

FHR82_RS33905: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

FHR82_RS33975: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

FHR82_RS33980: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: esterase

FHR82_RS33910: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

FHR82_RS33880: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS33885: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FHR82_RS33915: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

FHR82_RS33920: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHR82_RS33930: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHR82_RS45360: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	1.30	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	1.30	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	1.29	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	1.28	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000342.4	1.06	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.93	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.93	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.92	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.92	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.92	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.18 out of 21.55

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

Additional weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.15 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.34 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.71 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.04 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.25 out of 24.78

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.36 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 1971 - 83490:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal) + (Me-mal - NMe-Ser) + (ccmal) + (AHBA - ccmal - ccmal) + (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS33880: X

AMP-binding (21..380): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAWAGLAFNTSPVALSSAAADYYGIAETGLTFNA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

FHR82_RS33915: mmal

PKS_AT (567..864): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 211.3
Ethylmalonyl-CoA: 198.5
Methoxymalonyl-CoA: 173.7
2-Methylbutyryl-CoA: 141.0
Propionyl-CoA: 121.1
Malonyl-CoA: 116.0
trans-1,2-CPDA: 114.0
CHC-CoA: 104.2
Isobutyryl-CoA: 67.7
Benzoyl-CoA: 58.6
fatty_acid: 53.9
Acetyl-CoA: 40.5
3-Methylbutyryl-CoA: 28.6
inactive: 25.1

FHR82_RS33920: mmal - Ser

Search NORINE for peptide: strict or relaxed

PKS_AT (549..847): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 66.7%; Methoxymalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 178.5
Ethylmalonyl-CoA: 160.3
Methoxymalonyl-CoA: 144.1
2-Methylbutyryl-CoA: 113.6
Propionyl-CoA: 97.8
trans-1,2-CPDA: 94.1
Malonyl-CoA: 86.8
CHC-CoA: 81.0
Benzoyl-CoA: 70.2
Isobutyryl-CoA: 69.5
fatty_acid: 33.9
Acetyl-CoA: 33.5
inactive: 31.5
3-Methylbutyryl-CoA: 22.3

AMP-binding (1520..1919): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQTFDVSVWEWHFIASGEYNLWGATECSVDSTC
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

FHR82_RS33930: mal

PKS_AT (551..853): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 192.5
inactive: 96.2
Methoxymalonyl-CoA: 66.7
Methylmalonyl-CoA: 55.7
Propionyl-CoA: 26.8
Isobutyryl-CoA: 23.2
Ethylmalonyl-CoA: 14.4
Acetyl-CoA: 12.8
Benzoyl-CoA: 10.3
2-Methylbutyryl-CoA: 4.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

FHR82_RS45360: AHBA - mal - mal

CAL_domain (34..441): AHBA

minowa: AHBA

Prediction, score:

AHBA: 312.7
shikimic_acid: 253.2
Acetyl-CoA: 14.1
NH2: 7.8
fatty_acid: 0.0

PKS_AT (1519..1801): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.1
inactive: 93.2
Methoxymalonyl-CoA: 60.8
Methylmalonyl-CoA: 48.8
Propionyl-CoA: 32.6
Acetyl-CoA: 23.8
Isobutyryl-CoA: 23.1
CHC-CoA: 14.4
Benzoyl-CoA: 14.4
Ethylmalonyl-CoA: 8.6
fatty_acid: 8.4
trans-1,2-CPDA: 7.0
2-Methylbutyryl-CoA: 2.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (3209..3491): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 196.5
inactive: 75.5
Methoxymalonyl-CoA: 62.6
Methylmalonyl-CoA: 51.4
Propionyl-CoA: 30.7
Isobutyryl-CoA: 27.4
Acetyl-CoA: 24.7
CHC-CoA: 18.4
Benzoyl-CoA: 15.8
fatty_acid: 12.5
Ethylmalonyl-CoA: 11.1
2-Methylbutyryl-CoA: 6.8
trans-1,2-CPDA: 5.6
3-Methylbutyryl-CoA: 0.0

FHR82_RS33975: mmal

PKS_AT (558..853): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 79.2%; Malonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 192.2
Ethylmalonyl-CoA: 182.1
Methoxymalonyl-CoA: 156.0
2-Methylbutyryl-CoA: 124.4
trans-1,2-CPDA: 99.3
Propionyl-CoA: 96.8
CHC-CoA: 96.3
Isobutyryl-CoA: 89.6
Malonyl-CoA: 77.5
Benzoyl-CoA: 68.5
3-Methylbutyryl-CoA: 42.0
fatty_acid: 40.2
Acetyl-CoA: 28.8
inactive: 19.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
ArcA	Repressor of carbon oxidation

NZ_JACHJQ010000008.1 - Region 2 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 193,655 - 216,693 nt. (total: 23,039 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FHR82_RS34590: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase

FHR82_RS34635: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.58	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002703.2	0.49	ribosomal	archalan α	Halorussus salinus
BGC0000554.4	0.48	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002346.3	0.48	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000503.5	0.46	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001579.4	0.46	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000500.5	0.45	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002110.3	0.45	ribosomal	birimositide	Streptomyces rimosus subsp. rimosus WC-3908
BGC0001660.3	0.44	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001210.5	0.44	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.58	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002703.2	0.49	ribosomal	archalan α	Halorussus salinus
BGC0000554.4	0.48	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002346.3	0.48	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000503.5	0.46	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001579.4	0.46	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000500.5	0.45	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002110.3	0.45	ribosomal	birimositide	Streptomyces rimosus subsp. rimosus WC-3908
BGC0001660.3	0.44	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001210.5	0.44	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for FHR82_RS34635

allorf_200792_201004

Leader:

MPCCGRRLGVPSGG

Core:

SSPEGQVSGMAWGCLVALGAGLPAIPSTSLRAITPAQGGGSEFWCRFCWLCPLDPV

Core with dehydrations:

DhaDhaPEGQVDhaGMAWGCysLVALGAGLPAIPDhaDhbDhaLRAIDhbPAQGGGDhaEFWCysRFCysWLCysPLDPV

antiSMASH-DB 4.0 matches for allorf_200792_201004

100.0%

NZ_JACHJQ010000008.1:

Lanthipeptides: allorf_200792_201004_lanthipeptide

1

SSPEGQVSGMAWGCLVALGAGLPAIPSTSLRAITPAQGGGSEFWCRFCWLCPLDPV

56

SSPEGQVSGMAWGCLVALGAGLPAIPSTSLRAITPAQGGGSEFWCRFCWLCPLDPV

1

SSPEGQVSGMAWGCLVALGAGLPAIPSTSLRAITPAQGGGSEFWCRFCWLCPLDPV

56

14.3%

NZ_CP073318.1:

Lanthipeptides: allorf_01122276_01122440_lanthipeptide

21

GLPAIPSTSLRAITPAQG

38

LPA S R++T +QG

17

NLPACAGNSRRSLTVSQG

34

MIBiG 4.0 matches for allorf_200792_201004

10.7%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

28

TSLRAITPAQGGGSEFWCRF

47

TS+ TP G+ C

2

TSISLCTPGCKTGALMGCNM

21

allorf_200802_200999

Leader:

MLRATVGCALRGLLAG

Core:

GAGLWDGLGLFGCVGCGSACHPVDLPPGYHTGSRGRFRVLVPVLLVVPP

Core with dehydrations:

GAGLWDGLGLFGCysVGCysGDhaACysHPVDLPPGYHDhbGDhaRGRFRVLVPVLLVVPP

antiSMASH-DB 4.0 matches for allorf_200802_200999

100.0%

NZ_JACHJQ010000008.1:

Lanthipeptides: allorf_200802_200999_lanthipeptide

1

GAGLWDGLGLFGCVGCGSACHPVDLPPGYHTGSRGRFRVLVPVLLVVPP

49

GAGLWDGLGLFGCVGCGSACHPVDLPPGYHTGSRGRFRVLVPVLLVVPP

1

GAGLWDGLGLFGCVGCGSACHPVDLPPGYHTGSRGRFRVLVPVLLVVPP

49

26.5%

NZ_QLTT01000004.1:

Lanthipeptides: allorf_749714_749881_lanthipeptide

2

AGLWDGLGLFGCVGCGSACHPVDLPPGYHTGSRGRFRV

39

AGL L + C +A PP G RGR R

7

AGLRRDLNMGDRTPCSAA------PPASRLGDRGRDRA

38

24.5%

NZ_CP038504.1and 2 others:

NZ_CP040557.1 Lanthipeptides: allorf_0664097_0664279_lanthipeptideNZ_MIOB01000009.1 Lanthipeptides: allorf_03891_04073_lanthipeptide

Lanthipeptides: allorf_0568062_0568244_lanthipeptide

2

AGLWDGLGLFGCVGCGSACHPVDLPPGYHTG

32

A LW L GC P LPP H+G

6

AALWVSSSLMNPRGCYPYATPKGLPPT-HSG

35

with 2 more sequence matches

20.4%

NZ_CP012897.1:

Lassopeptides: JL11_RS18110_lassopeptide

32

GSRGRFRVLVPVL-LVVPP

49

SRG F L PVL +PP

2

NSRGEFDELNPVLKYTIPP

20

14.3%

NZ_CM000728.1:

Lanthipeptides: allorf_5589204_5589365_lanthipeptide

5

WDGLGLFGCVGC

16

WD GLFG C

2

WDTGGLFGEAKC

13

MIBiG 4.0 matches for allorf_200802_200999

10.2%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

9

GLFGCVGCGSACH

21

L GC + CH

15

ALMGCNMKTATCH

27

8.2%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

26

PPGYHTGS

33

PG TG+

8

TPGCKTGA

15

allorf_202121_202249

Leader:

MTKPDQGRPGQALPPAQVPAQDAERPGG

Core:

HTPREYVCCQQKCR

Core with dehydrations:

HDhbPREYVCysCysQQKCysR

antiSMASH-DB 4.0 matches for allorf_202121_202249

100.0%

NZ_JACHJQ010000008.1:

Lanthipeptides: allorf_202121_202249_lanthipeptide

1

HTPREYVCCQQKCR

14

HTPREYVCCQQKCR

1

HTPREYVCCQQKCR

14

21.4%

NZ_CP012109.1:

Lanthipeptides: allorf_7970617_7970727_lanthipeptide

1

HTPREYVCCQQ

11

H+PR CC Q

15

HSPRAAECCPQ

25

allorf_202185_202280

Leader:

MRSVPAG

Core:

THRVSTCAASRNVGSDYPCARPGG

Core with dehydrations:

DhbHRVDhaDhbCysAADhaRNVGDhaDYPCysARPGG

antiSMASH-DB 4.0 matches for allorf_202185_202280

100.0%

NZ_JACHJQ010000008.1:

Lanthipeptides: allorf_202185_202280_lanthipeptide

1

THRVSTCAASRNVGSDYPCARPGG

24

THRVSTCAASRNVGSDYPCARPGG

1

THRVSTCAASRNVGSDYPCARPGG

24

52.0%

NZ_CP019699.1:

Lanthipeptides: allorf_1046039_1046143_lanthipeptide

3

RVSTCAASRNVGS--DYPCARPGG

24

RV T A+ VGS D C+RPGG

2

RVET-ASMPPVGSVEDQKCSRPGG

24

29.2%

NZ_SLWS01000023.1:

Lanthipeptides: allorf_49758_49871_lanthipeptide

12

NVGSDYPCARP

22

NVG YPC P

1

NVGISYPCPVP

11

with 5 more sequence matches

25.9%

NZ_JACCKA010000091.1:

Lanthipeptides: allorf_104202_104324_lanthipeptide

7

CAASRNVGSDYPCARP

22

C A RN+ +P RP

4

CPAGRNLRRHHPPKRP

19

20.5%

NZ_LR134504.1:

Lanthipeptides: allorf_1621406_1621576_lanthipeptide

3

RVSTCAASRNVGSDYPCA

20

+ STC A G +PCA

15

QFSTCEAWLWRGVGWPCA

32

19.4%

NZ_FOET01000004.1:

Lanthipeptides: allorf_078361_078546_lanthipeptide

8

AASRNVGSDYPC

19

AA++N+G+ PC

8

AAAKNMGALPPC

19

14.5%

NZ_EQ973330.1:

Lanthipeptides: allorf_437242_437442_lanthipeptide

3

RVSTCAASRNVGSDYPCA

20

++STC A G +PCA

6

QLSTCEAWLWRGVGWPCA

23

11.3%

NZ_CP029190.1:

Lanthipeptides: allorf_1630240_1630437_lanthipeptide

8

AASRNVGSDYPC

19

A R+VG+ +PC

28

ACERHVGNRWPC

39

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.90 out of 36.53

Confidence: medium

Additional weak hits (2):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.12 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.44 out of 29.65

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_200792_201004 - Class II

Cleavage pHMM score: -6.60

RODEO score: 0

Monoisotopic mass: 5603.8 Da

Molecular weight: 5607.4 Da

Number of bridges: 4

Additional modifications: Lac

Alternative weights: (assuming N unmodified Ser/Thr residues); 5625.5 Da N = 1; 5643.5 Da N = 2; 5661.5 Da N = 3; 5679.5 Da N = 4

allorf_200802_200999 - Class II

Cleavage pHMM score: -5.20

RODEO score: 0

Monoisotopic mass: 4943.6 Da

Molecular weight: 4946.8 Da

Number of bridges: 3

allorf_202121_202249 - Class II

Cleavage pHMM score: -4.80

RODEO score: 0

Monoisotopic mass: 1731.8 Da

Molecular weight: 1733.0 Da

Number of bridges: 1

allorf_202185_202280 - Class II

Cleavage pHMM score: -6.90

RODEO score: 0

Monoisotopic mass: 2371.1 Da

Molecular weight: 2372.6 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2390.6 Da N = 1; 2408.6 Da N = 2; 2426.6 Da N = 3

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_JACHJQ010000008.1 - Region 3 - betalactone

Download region GenBank file

Download region SVG

Location: 329,229 - 359,828 nt. (total: 30,600 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

FHR82_RS35140: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

FHR82_RS35160: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHR82_RS35175: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

FHR82_RS35180: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

FHR82_RS35190: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHR82_RS35195: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHR82_RS35225: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: acetyltransferase

FHR82_RS35145: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Lyases: hydratase

FHR82_RS35120: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

FHR82_RS35165: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

FHR82_RS35255: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

FHR82_RS35150: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS35185: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

FHR82_RS35205: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS35240: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001535.3	0.77	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001166.5	0.56	NRPS	HC-toxin	Alternaria jesenskae
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002826.2	0.50	other (other)	closoxazole A, closoxazole B	Clostridium cavendishii DSM 21758
BGC0000866.5	0.47	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.3	0.45	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000131.5	0.45	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000597.4	0.44	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0002493.3	0.44	NRPS	parabactin	Paracoccus denitrificans PD1222

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001535.3	0.77	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001166.5	0.56	NRPS	HC-toxin	Alternaria jesenskae
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002826.2	0.50	other (other)	closoxazole A, closoxazole B	Clostridium cavendishii DSM 21758
BGC0000866.5	0.47	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.3	0.45	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000131.5	0.45	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000597.4	0.44	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0002493.3	0.44	NRPS	parabactin	Paracoccus denitrificans PD1222

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.16 out of 26.33

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (13):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.61 out of 20.01

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.62 out of 25.88

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.88 out of 30.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.57 out of 26.12

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.62 out of 20.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.57 out of 36.53

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.55 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.34 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.97 out of 36.54

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.88 out of 30.98

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.54 out of 25.88

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator

NZ_JACHJQ010000008.1 - Region 4 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 424,980 - 437,670 nt. (total: 12,691 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

FHR82_RS35615: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

FHR82_RS47750: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Transferases: acyltransferase

FHR82_RS35585: acyltransferase

smcogs: SMCOG1141: acyltransferase

Translocases: transporter

FHR82_RS35630: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002285.2	0.40	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001495.3	0.37	PKS	actinoallolide A	Actinoallomurus fulvus
BGC0002657.2	0.32	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0000595.3	0.32	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001553.5	0.31	NRPS, PKS	clifednamide A	Streptomyces sp. JV178
BGC0001093.3	0.28	NRPS, PKS	disorazol A	Sorangium cellulosum
BGC0001406.5	0.27	NRPS	telomycin	Streptomyces canus
BGC0000222.5	0.27	PKS	FD-594	Streptomyces sp. TA-0256
BGC0002358.3	0.26	PKS	cyclofaulknamycin	Streptomyces albidoflavus
BGC0000388.5	0.25	NRPS	mannopeptimycin	Streptomyces hygroscopicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002285.2	0.40	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001495.3	0.37	PKS	actinoallolide A	Actinoallomurus fulvus
BGC0002657.2	0.32	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0000595.3	0.32	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001553.5	0.31	NRPS, PKS	clifednamide A	Streptomyces sp. JV178
BGC0001093.3	0.28	NRPS, PKS	disorazol A	Sorangium cellulosum
BGC0001406.5	0.27	NRPS	telomycin	Streptomyces canus
BGC0000222.5	0.27	PKS	FD-594	Streptomyces sp. TA-0256
BGC0002358.3	0.26	PKS	cyclofaulknamycin	Streptomyces albidoflavus
BGC0000388.5	0.25	NRPS	mannopeptimycin	Streptomyces hygroscopicus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.07 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_JACHJQ010000009.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 670 - 43,735 nt. (total: 43,066 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

FHR82_RS36015: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

FHR82_RS36040: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHR82_RS36055: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHR82_RS36090: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: glucosidase

FHR82_RS36005: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Lyases: cyclase

FHR82_RS36025: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase

FHR82_RS36070: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.89 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

Additional weak hits (12):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.97 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.32 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.85 out of 39.62

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.50 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.67 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.35 out of 24.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.14 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.74 out of 23.43

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.98 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 669 - 43735:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS36070: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (430..816): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LAMTFDVSTVEVQGISGGEVDGYGPTETTVYSTA
Nearest Stachelhaus code(s):: Val DGGQIAGVYK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JACHJQ010000010.1 - Region 1 - T1PKS,oligosaccharide

Download region GenBank file

Download region SVG

Location: 22,540 - 163,132 nt. (total: 140,593 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

FHR82_RS38320: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHR82_RS38325: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHR82_RS38345: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHR82_RS38385: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

FHR82_RS38395: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FHR82_RS38435: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: aminotransferase glycosyltransferase methyltransferase

FHR82_RS38310: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

FHR82_RS38315: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

FHR82_RS38350: methyltransferase

smcogs: SMCOG1089: methyltransferase

FHR82_RS38370: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

FHR82_RS38380: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

FHR82_RS38410: methyltransferase

smcogs: SMCOG1248: methyltransferase

FHR82_RS38415: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

FHR82_RS38420: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Lyases: dehydratase

FHR82_RS38340: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

FHR82_RS38400: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

FHR82_RS38430: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

FHR82_RS38290: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHR82_RS38295: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHR82_RS38300: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

FHR82_RS38330: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHR82_RS38390: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

FHR82_RS47800: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

FHR82_RS48150: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHR82_RS48160: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

FHR82_RS38220: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000019.5	0.47	PKS	angolamycin	Streptomyces eurythermus
BGC0000041.3	0.45	PKS	oronofacic acid	Pseudomonas syringae
BGC0001273.3	0.44	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.44	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.43	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.43	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001817.5	0.43	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000278.3	0.42	PKS	urdamycin	Streptomyces fradiae
BGC0001012.3	0.37	NRPS, PKS	meridamycin	Streptomyces violaceusniger
BGC0000898.5	0.37	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.75	PKS	oronofacic acid	Pseudomonas syringae
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.75	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000067.5	0.66	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.04 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.12 out of 29.72

Confidence: medium

Additional weak hits (22):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.18 out of 27.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.81 out of 39.62

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.49 out of 32.74

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.88 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.12 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.25 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.70 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.33 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.98 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.62 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.42 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.52 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.25 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.56 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.94 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.37 out of 26.12

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.28 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.50 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 22539 - 163132:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (redemal) + (ccmal - ccmal - Me-ohmal - ccmal) + (ccmal - Me-ccmal - ccmal) + (ccmal - ohmal - Me-ohmal - ohmal - mal) + (redmal) + (ccmal)
Non-colinear ordering:: FHR82_RS38300 + FHR82_RS38295 + FHR82_RS38290 + FHR82_RS38340 + FHR82_RS48150 + FHR82_RS38330

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 22539 - 153639:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (redemal) + (ccmal - ccmal - Me-ohmal - ccmal) + (ccmal - Me-ccmal - ccmal) + (ccmal - ohmal - Me-ohmal - ohmal - mal) + (redmal) + (ccmal)
Non-colinear ordering:: FHR82_RS38300 + FHR82_RS38295 + FHR82_RS38290 + FHR82_RS38340 + FHR82_RS48150 + FHR82_RS38330

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS38290: mal - mmal - mal

PKS_AT (544..822): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 169.7
inactive: 73.6
Methoxymalonyl-CoA: 57.9
Methylmalonyl-CoA: 52.9
fatty_acid: 32.8
Acetyl-CoA: 20.7
Propionyl-CoA: 17.6
Benzoyl-CoA: 15.9
Ethylmalonyl-CoA: 15.6
trans-1,2-CPDA: 14.1
2-Methylbutyryl-CoA: 11.4
CHC-CoA: 10.0
Isobutyryl-CoA: 8.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (2256..2545): mmal

ATSignature: Methoxymalonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 83.3%; Methylmalonyl-CoA: 83.3%; Ethylmalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 186.5
Ethylmalonyl-CoA: 181.5
Methoxymalonyl-CoA: 150.7
2-Methylbutyryl-CoA: 137.7
trans-1,2-CPDA: 115.7
Propionyl-CoA: 89.2
Malonyl-CoA: 86.5
CHC-CoA: 79.1
Isobutyryl-CoA: 72.1
Benzoyl-CoA: 63.0
Acetyl-CoA: 48.8
3-Methylbutyryl-CoA: 45.5
inactive: 22.9
fatty_acid: 19.8

PKS_AT (3924..4211): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.0
inactive: 86.6
Methoxymalonyl-CoA: 62.2
Methylmalonyl-CoA: 49.6
Propionyl-CoA: 25.5
Ethylmalonyl-CoA: 24.6
Isobutyryl-CoA: 14.3
fatty_acid: 13.4
CHC-CoA: 6.9
2-Methylbutyryl-CoA: 6.8
Acetyl-CoA: 6.3
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

FHR82_RS38295: mal - mal - mmal - mal

PKS_AT (526..795): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.6
inactive: 87.5
Methoxymalonyl-CoA: 66.3
Methylmalonyl-CoA: 61.6
Ethylmalonyl-CoA: 34.9
Acetyl-CoA: 32.5
Propionyl-CoA: 30.4
fatty_acid: 28.9
Isobutyryl-CoA: 26.9
Benzoyl-CoA: 22.7
2-Methylbutyryl-CoA: 12.2
CHC-CoA: 10.3
3-Methylbutyryl-CoA: 9.2
trans-1,2-CPDA: 8.4

PKS_AT (2130..2400): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 175.2
inactive: 89.6
Methoxymalonyl-CoA: 73.6
Methylmalonyl-CoA: 60.2
Ethylmalonyl-CoA: 28.6
Propionyl-CoA: 28.4
fatty_acid: 25.0
Benzoyl-CoA: 21.1
2-Methylbutyryl-CoA: 18.4
Isobutyryl-CoA: 17.7
Acetyl-CoA: 17.7
trans-1,2-CPDA: 15.5
CHC-CoA: 12.6
3-Methylbutyryl-CoA: 11.4

PKS_AT (3751..4049): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.5
Ethylmalonyl-CoA: 202.5
Methoxymalonyl-CoA: 170.6
2-Methylbutyryl-CoA: 143.7
trans-1,2-CPDA: 120.2
Propionyl-CoA: 104.1
CHC-CoA: 98.2
Malonyl-CoA: 92.5
Isobutyryl-CoA: 78.9
Benzoyl-CoA: 59.5
Acetyl-CoA: 35.9
3-Methylbutyryl-CoA: 28.8
fatty_acid: 26.3
inactive: 13.6

PKS_AT (5188..5457): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 169.0
Methylmalonyl-CoA: 75.1
inactive: 73.5
Methoxymalonyl-CoA: 71.9
Ethylmalonyl-CoA: 45.7
Propionyl-CoA: 44.4
Isobutyryl-CoA: 25.8
2-Methylbutyryl-CoA: 25.1
Acetyl-CoA: 23.6
CHC-CoA: 23.0
fatty_acid: 21.3
Benzoyl-CoA: 20.0
trans-1,2-CPDA: 18.4
3-Methylbutyryl-CoA: 0.0

FHR82_RS38300: emal

PKS_AT (564..858): emal

ATSignature: Ethylmalonyl-CoA, Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 91.7%; Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 195.1
Methylmalonyl-CoA: 189.3
Methoxymalonyl-CoA: 159.6
2-Methylbutyryl-CoA: 136.1
trans-1,2-CPDA: 124.8
Propionyl-CoA: 118.3
CHC-CoA: 102.6
Malonyl-CoA: 94.5
Isobutyryl-CoA: 78.0
Benzoyl-CoA: 54.5
fatty_acid: 51.6
Acetyl-CoA: 48.5
inactive: 27.8
3-Methylbutyryl-CoA: 21.8

FHR82_RS47800: pk - mmal

PKS_AT (574..851): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; Methylmalonyl-CoA: 58.3%; Isobutyryl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 92.7
Methoxymalonyl-CoA: 81.2
Ethylmalonyl-CoA: 76.3
Malonyl-CoA: 62.9
Isobutyryl-CoA: 58.6
2-Methylbutyryl-CoA: 54.0
Propionyl-CoA: 51.3
trans-1,2-CPDA: 36.7
Benzoyl-CoA: 31.8
3-Methylbutyryl-CoA: 17.9
CHC-CoA: 13.8
fatty_acid: 11.6
Acetyl-CoA: 8.1
inactive: 8.0

PKS_AT (985..1280): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 182.4
Ethylmalonyl-CoA: 180.7
Methoxymalonyl-CoA: 149.7
2-Methylbutyryl-CoA: 124.9
trans-1,2-CPDA: 98.4
Propionyl-CoA: 91.7
CHC-CoA: 81.3
Malonyl-CoA: 74.6
Isobutyryl-CoA: 67.9
Benzoyl-CoA: 60.1
Acetyl-CoA: 42.4
3-Methylbutyryl-CoA: 37.3
fatty_acid: 29.2
inactive: 12.5

FHR82_RS38330: mal

PKS_AT (538..814): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 176.2
inactive: 79.0
Methoxymalonyl-CoA: 72.5
Methylmalonyl-CoA: 70.2
Isobutyryl-CoA: 41.6
Propionyl-CoA: 38.8
Ethylmalonyl-CoA: 37.0
Acetyl-CoA: 27.8
CHC-CoA: 21.5
Benzoyl-CoA: 20.4
2-Methylbutyryl-CoA: 19.5
fatty_acid: 19.2
trans-1,2-CPDA: 9.8
3-Methylbutyryl-CoA: 0.0

FHR82_RS48150: mal

PKS_AT (1104..1383): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 196.5
inactive: 87.3
Methoxymalonyl-CoA: 74.7
Methylmalonyl-CoA: 73.7
Isobutyryl-CoA: 40.3
Ethylmalonyl-CoA: 31.8
Acetyl-CoA: 26.8
Benzoyl-CoA: 26.2
Propionyl-CoA: 25.9
fatty_acid: 21.0
trans-1,2-CPDA: 17.5
CHC-CoA: 15.6
2-Methylbutyryl-CoA: 13.6
3-Methylbutyryl-CoA: 8.0

FHR82_RS48160: mal

PKS_AT (553..836): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 204.5
inactive: 91.1
Methoxymalonyl-CoA: 68.2
Methylmalonyl-CoA: 57.5
Isobutyryl-CoA: 44.8
Benzoyl-CoA: 33.8
Ethylmalonyl-CoA: 29.1
Acetyl-CoA: 28.1
Propionyl-CoA: 27.1
fatty_acid: 26.8
2-Methylbutyryl-CoA: 21.2
CHC-CoA: 19.9
trans-1,2-CPDA: 5.1
3-Methylbutyryl-CoA: 3.7

FHR82_RS38340: mal - mal - mmal - mal - mal

PKS_AT (550..840): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 197.9
inactive: 71.1
Methoxymalonyl-CoA: 62.3
Methylmalonyl-CoA: 51.9
Propionyl-CoA: 35.3
Isobutyryl-CoA: 26.3
Acetyl-CoA: 25.6
Ethylmalonyl-CoA: 18.2
trans-1,2-CPDA: 9.4
Benzoyl-CoA: 8.6
CHC-CoA: 7.0
2-Methylbutyryl-CoA: 5.7
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2227..2515): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 222.8
inactive: 115.3
Methylmalonyl-CoA: 69.3
Methoxymalonyl-CoA: 69.0
Propionyl-CoA: 38.2
Isobutyryl-CoA: 35.2
Acetyl-CoA: 30.6
Ethylmalonyl-CoA: 18.7
Benzoyl-CoA: 13.4
2-Methylbutyryl-CoA: 11.9
CHC-CoA: 8.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3695..3988): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.5
Ethylmalonyl-CoA: 203.7
Methoxymalonyl-CoA: 167.3
trans-1,2-CPDA: 130.5
2-Methylbutyryl-CoA: 129.9
CHC-CoA: 128.7
Propionyl-CoA: 115.5
Malonyl-CoA: 95.2
Isobutyryl-CoA: 79.3
Benzoyl-CoA: 68.3
Acetyl-CoA: 39.7
fatty_acid: 32.0
3-Methylbutyryl-CoA: 30.6
inactive: 12.8

PKS_AT (5197..5489): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.6
inactive: 93.0
Methoxymalonyl-CoA: 60.7
Methylmalonyl-CoA: 52.0
Isobutyryl-CoA: 38.2
Propionyl-CoA: 26.8
Acetyl-CoA: 22.0
Ethylmalonyl-CoA: 17.4
Benzoyl-CoA: 17.0
trans-1,2-CPDA: 14.1
fatty_acid: 13.0
2-Methylbutyryl-CoA: 9.0
CHC-CoA: 8.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (6658..6944): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 209.2
inactive: 98.9
Methoxymalonyl-CoA: 62.6
Methylmalonyl-CoA: 53.2
Propionyl-CoA: 34.7
Acetyl-CoA: 16.9
Isobutyryl-CoA: 16.5
fatty_acid: 12.2
Benzoyl-CoA: 11.2
2-Methylbutyryl-CoA: 10.7
Ethylmalonyl-CoA: 10.3
CHC-CoA: 9.2
trans-1,2-CPDA: 5.5
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JACHJQ010000010.1 - Region 2 - NRPS-like

Download region GenBank file

Download region SVG

Location: 172,474 - 214,156 nt. (total: 41,683 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

FHR82_RS38515: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

FHR82_RS38535: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

FHR82_RS38615: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase

FHR82_RS38575: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: ligase

FHR82_RS38545: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FHR82_RS38580: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.62	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.61	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	0.60	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000820.5	0.50	other (other)	physostigmine	Streptomyces griseofuscus
BGC0001488.3	0.50	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0001131.5	0.48	NRPS	ambactin	Xenorhabdus miraniensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.62	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.61	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	0.60	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000820.5	0.50	other (other)	physostigmine	Streptomyces griseofuscus
BGC0001488.3	0.50	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0001131.5	0.48	NRPS	ambactin	Xenorhabdus miraniensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

Additional weak hits (7):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.21 out of 30.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.20 out of 32.74

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.50 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.75 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.19 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.66 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 172473 - 214156:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS38580: X

AMP-binding (14..389): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWSSHDPLVRDSHLVLGGETVVYGCTETPQVVMH
Nearest Stachelhaus code(s):: Glu or D-Glu DPRHSGVVGK (44% 8Å match); D-Glu DPRHSGVVGK (44% 8Å match); D-Asp DPRHVGIFIK (41% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJQ010000010.1 - Region 3 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 226,641 - 311,561 nt. (total: 84,921 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

FHR82_RS38790: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FHR82_RS38805: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHR82_RS38820: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FHR82_RS38830: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

FHR82_RS38885: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

FHR82_RS38890: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

FHR82_RS38900: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHR82_RS38905: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHR82_RS38910: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FHR82_RS38945: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase

FHR82_RS38865: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: dehalogenase esterase

FHR82_RS38770: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

FHR82_RS38840: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

FHR82_RS38845: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

FHR82_RS38810: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FHR82_RS38815: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FHR82_RS38870: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FHR82_RS38875: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FHR82_RS38895: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.84	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.81	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.79	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.79	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.77	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.77	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.76	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.76	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.76	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001873.3	0.74	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.76	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001050.5	0.72	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

Additional weak hits (9):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.26 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.32 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.19 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.44 out of 39.62

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.83 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 226640 - 311561:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2 - X - X - Aad - Asp) + (Cys) + (Me-redmal - Ser - Pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS38815: mmal - Ser - Pro

Search NORINE for peptide: strict or relaxed

PKS_AT (533..832): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 212.4
Ethylmalonyl-CoA: 209.8
Methoxymalonyl-CoA: 173.1
2-Methylbutyryl-CoA: 148.1
Propionyl-CoA: 122.1
trans-1,2-CPDA: 116.1
CHC-CoA: 115.4
Malonyl-CoA: 103.0
Isobutyryl-CoA: 72.7
Benzoyl-CoA: 60.9
Acetyl-CoA: 48.5
inactive: 36.1
3-Methylbutyryl-CoA: 34.8
fatty_acid: 23.6

AMP-binding (2525..2933): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEVNLYGPTETTVDVSY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3572..3969): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWQAFDVSFQESFLVSSGEENQYGPTETHVVLAH
Nearest Stachelhaus code(s):: Pro DVQFVAQVVK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

FHR82_RS38870: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (506..908): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: NDFSFDMSAYDGHSLLGGDVSMGGATEVSMDSTI
Nearest Stachelhaus code(s):: Hpg DAYHLGMLCK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

FHR82_RS38875: NH2 - X - X - Aad - Asp

Search NORINE for peptide: strict or relaxed

CAL_domain (29..477): NH2

minowa: NH2

Prediction, score:

NH2: 18.5
fatty_acid: 3.1
AHBA: 2.9
Acetyl-CoA: 2.3
shikimic_acid: 0.0

AMP-binding (1156..1559): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YSFAFDPCLEESDILIGGEYNRWGTTETTVCSTV
Nearest Stachelhaus code(s):: Ala DGEDFGVVCK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2204..2579): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDASVWEPLLVSGGEVNAYGPTECTVAITA
Nearest Stachelhaus code(s):: Leu DAWLVGAVYK (76% 8Å match); 3OH-Leu DALLVGAVAK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (3236..3661): Aad

nrpys: Aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWMSHDPLHRETHLFFLGDVNLYGSTESQRAVGY
Nearest Stachelhaus code(s):: Aad DPRHFVMRAK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (4325..4730): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HLMAFDISIWQVQLIATGEVNAYGPAECSDDTHL
Nearest Stachelhaus code(s):: L-Dbu DIWQGTADDK (68% 8Å match); dnmeProp or Dab DIWQSTADDK (65% 8Å match); Dpr DIWQSTADDK (65% 8Å match); Asp DIWQSTADDK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

FHR82_RS38895: X

AMP-binding (14..397): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SGLLYGLIVT-GPVGSGGALQGYGLTESSAVVSA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor

NZ_JACHJQ010000011.1 - Region 1 - HR-T2PKS

Download region GenBank file

Download region SVG

Location: 268,040 - 310,291 nt. (total: 42,252 nt) Show pHMM detection rules used

HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

FHR82_RS40880: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

FHR82_RS40890: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: dehydratase

FHR82_RS40910: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

FHR82_RS40845: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002510.2	0.46	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0000272.3	0.44	PKS	spore pigment	Streptomyces collinus
BGC0001161.5	0.43	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0000234.5	0.43	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001343.3	0.43	PKS	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0001162.3	0.42	PKS	1-heptadecene	Moorea producens JHB
BGC0001163.3	0.42	PKS	1-heptadecene	Moorea producens 3L
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002711.2	0.42	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000041.3	0.41	PKS	oronofacic acid	Pseudomonas syringae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002510.2	0.46	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0000272.3	0.44	PKS	spore pigment	Streptomyces collinus
BGC0001161.5	0.43	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0000234.5	0.43	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001343.3	0.43	PKS	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0001162.3	0.42	PKS	1-heptadecene	Moorea producens JHB
BGC0001163.3	0.42	PKS	1-heptadecene	Moorea producens 3L
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002711.2	0.42	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000041.3	0.41	PKS	oronofacic acid	Pseudomonas syringae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.90 out of 23.79

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.64 out of 29.72

Confidence: medium

Additional weak hits (5):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.98 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.96 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.67 out of 36.53

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.95 out of 31.73

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C

NZ_JACHJQ010000012.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 114,358 - 161,638 nt. (total: 47,281 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

FHR82_RS41955: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

FHR82_RS42010: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

FHR82_RS42020: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

FHR82_RS42080: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Hydrolases: peptidase

FHR82_RS42075: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Ligases: synthase

FHR82_RS42015: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.67	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.60	PKS	ACT-Toxin II	Alternaria alternata
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.67	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.60	PKS	ACT-Toxin II	Alternaria alternata
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.62 out of 25.88

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.62 out of 23.79

Confidence: medium

Additional weak hits (13):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.40 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.30 out of 20.01

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.68 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.51 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.41 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.40 out of 26.12

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.78 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.75 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.49 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.78 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.35 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 114357 - 161638:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-Me-redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS42015: mmal

PKS_AT (514..809): mmal

ATSignature: Propionyl-CoA, Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Propionyl-CoA: 70.8%; Malonyl-CoA: 70.8%; Methylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 97.3
Methoxymalonyl-CoA: 82.2
Malonyl-CoA: 82.1
Ethylmalonyl-CoA: 65.0
Isobutyryl-CoA: 56.7
Propionyl-CoA: 48.4
Benzoyl-CoA: 30.2
trans-1,2-CPDA: 22.3
Acetyl-CoA: 21.7
2-Methylbutyryl-CoA: 20.1
fatty_acid: 18.8
inactive: 13.6
CHC-CoA: 12.8
3-Methylbutyryl-CoA: 2.4

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
PsrA	Oleic acid responsive regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJQ010000016.1 - Region 1 - NRPS,NRPS-like,terpene

Download region GenBank file

Download region SVG

Location: 29,186 - 77,738 nt. (total: 48,553 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

FHR82_RS44250: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FHR82_RS44285: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHR82_RS44290: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: halogenase

FHR82_RS44340: halogenase

smcogs: SMCOG1119: halogenase

Ligases: ligase synthetase

FHR82_RS44345: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS44380: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FHR82_RS47150: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

FHR82_RS47155: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002071.2	0.62	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.65	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002071.2	0.64	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.93 out of 26.85

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.54 out of 23.79

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.78 out of 29.72

Confidence: medium

Additional weak hits (16):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.57 out of 32.74

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.53 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.69 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.42 out of 29.65

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.06 out of 26.12

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.24 out of 20.01

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.88 out of 24.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.88 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.18 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.97 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 29185 - 77738:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 29185 - 70652:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 34501 - 77738:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS44345: X

AMP-binding (30..300): X

nrpys: Leu, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWLSFDLSQRSMHCLFGGELHQYGVAECTDVASS
Nearest Stachelhaus code(s):: Leu or Ala DLRHLGQDVK (100% 8Å match); Leu or Ser DLRHLGQDVK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

FHR82_RS44380: X

AMP-binding (481..874): X

nrpys: Ile, Val, aIle

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSSDALALEVWLWTGGDVNGHGPMESTVFAAC
Nearest Stachelhaus code(s):: Ile DALWWGGVFK (76% 8Å match); Val or aIle DALWWGGVFK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJQ010000017.1 - Region 1 - phenazine

Download region GenBank file

Download region SVG

Location: 18,213 - 38,683 nt. (total: 20,471 nt) Show pHMM detection rules used

phenazine: phzB

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

FHR82_RS44660: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: methyltransferase

FHR82_RS44600: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

FHR82_RS44655: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

FHR82_RS44630: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

FHR82_RS44625: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001868.4	0.51	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0000936.5	0.50	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1
BGC0002439.3	0.50	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0002561.3	0.48	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0001850.4	0.45	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0000343.5	0.43	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001302.5	0.43	other (other)	lomofungin	Streptomyces lomondensis
BGC0000885.3	0.42	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001869.4	0.42	NRPS, other (phenazine)	griseoluteic acid, demethoxygriseoluteic acid, phenaszentine A, phenaszentine C, phenaszenketide C, phenaszenketide D	Xenorhabdus szentirmaii DSM 16338
BGC0002474.2	0.42	NRPS	agrobactin	Agrobacterium tumefaciens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001868.4	0.51	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0000936.5	0.50	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1
BGC0002439.3	0.50	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0002561.3	0.48	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0001850.4	0.45	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0000343.5	0.43	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001302.5	0.43	other (other)	lomofungin	Streptomyces lomondensis
BGC0000885.3	0.42	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001869.4	0.42	NRPS, other (phenazine)	griseoluteic acid, demethoxygriseoluteic acid, phenaszentine A, phenaszentine C, phenaszenketide C, phenaszenketide D	Xenorhabdus szentirmaii DSM 16338
BGC0002474.2	0.42	NRPS	agrobactin	Agrobacterium tumefaciens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.00 out of 20.47

Confidence: medium

Additional weak hits (6):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.96 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.84 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.87 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.52 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJQ010000018.1 - Region 1 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 42,551 nt. (total: 42,551 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

FHR82_RS44840: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase esterase

FHR82_RS44850: thioesterase

smcogs: SMCOG1004: thioesterase

FHR82_RS44920: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: lyase

FHR82_RS44800: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

FHR82_RS44805: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

FHR82_RS44830: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

FHR82_RS44860: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Isomerases: racemase

FHR82_RS44795: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase

FHR82_RS44835: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHR82_RS44845: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.04	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	1.04	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	1.03	NRPS	enniatin	Fusarium equiseti
BGC0001050.5	1.02	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0002286.3	1.02	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.02	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.02	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	1.01	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	1.00	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.99	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.67	NRPS	enniatin	Fusarium equiseti
BGC0001050.5	0.67	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.51 out of 25.88

Confidence: medium

Additional weak hits (11):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.05 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.96 out of 21.55

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.27 out of 30.12

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.33 out of 27.04

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.74 out of 25.31

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.36 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.74 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.24 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 42551:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (His) + (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHR82_RS44835: His

Search NORINE for peptide: strict or relaxed

AMP-binding (458..845): His

nrpys: His

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SARSFDSSMAGGLCIVAGEVNEYGPTETTVWASY
Nearest Stachelhaus code(s):: His DSALIAEVWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

FHR82_RS44840: mal

PKS_AT (524..808): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 136.6
inactive: 66.5
Methoxymalonyl-CoA: 63.8
Methylmalonyl-CoA: 52.7
Propionyl-CoA: 29.0
Isobutyryl-CoA: 22.4
fatty_acid: 22.1
Ethylmalonyl-CoA: 20.2
Benzoyl-CoA: 20.2
trans-1,2-CPDA: 17.5
2-Methylbutyryl-CoA: 15.5
CHC-CoA: 8.9
Acetyl-CoA: 4.0
3-Methylbutyryl-CoA: 0.0

FHR82_RS44845: X

AMP-binding (16..408): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LRPAFDTSVLESHLGCGGDINSYGPTEACVASTV
Nearest Stachelhaus code(s):: Leu DALHSGAVAK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
PsrA	Oleic acid responsive regulator