GCF_014203595.1 - 51 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JACHJK010000001.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NI-siderophore	236,492	266,261	High	desferrioxamin B/desferrioxamine E	other:other
Region 1.2	melanin	371,340	381,813
Region 1.3	NRPS	838,918	883,351	Low	cadaside A/cadaside B	NRPS:Type I
Region 1.4	T2PKS	939,066	1,011,607	High	spore pigment	PKS

NZ_JACHJK010000002.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	terpene,melanin	35,275	73,299	Medium	melanin	other:other
Region 2.2	other	322,038	363,411
Region 2.3	T3PKS	686,798	727,862	High	flaviolin/1,3,6,8-tetrahydroxynaphthalene	PKS
Region 2.4	T1PKS,hglE-KS	780,273	833,336

NZ_JACHJK010000003.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	t3nrps-iterative,NRPS	31,932	102,865
Region 3.2	redox-cofactor	136,825	158,990
Region 3.3	NRPS	284,204	328,649
Region 3.4	lassopeptide	408,879	431,255
Region 3.5	terpene,lanthipeptide-class-ii	665,934	709,177	Medium	carotenoid	terpene
Region 3.6	atropopeptide	788,799	810,049

NZ_JACHJK010000004.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	NRPS,arylpolyene	382,491	460,263	High	pepticinnamin E	NRPS:Type I+PKS

NZ_JACHJK010000006.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	hydrogen-cyanide	4,247	17,201	Low	aborycin	ribosomal:RiPP
Region 6.2	T1PKS,polyhalogenated-pyrrole,NRPS	48,714	135,227	Low	X-14547	PKS
Region 6.3	lassopeptide	201,733	224,308	High	citrulassin D	ribosomal:RiPP
Region 6.4	terpene	244,968	265,438
Region 6.5	NRPS	322,344	366,645	Medium	SF2768	NRPS:Type I
Region 6.6	NRPS,RiPP-like	451,975	530,906	Medium	informatipeptin	ribosomal:RiPP:Lanthipeptide

NZ_JACHJK010000007.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	PKS-like	181,293	222,153

NZ_JACHJK010000008.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	RRE-containing	55,137	76,324
Region 8.2	terpene	227,888	248,925	High	albaflavenone	terpene
Region 8.3	terpene-precursor	253,319	274,461	Low	pentalenolactone	terpene

NZ_JACHJK010000009.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	terpene	88,025	114,712	High	hopene	terpene

NZ_JACHJK010000010.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	NRPS-like	1	22,918
Region 10.2	other,T3PKS,terpene,t3nrps-iterative,NAPAA,NRPS,RiPP-like	75,503	164,999	Low	furaquinocin B	terpene+PKS
Region 10.3	NI-siderophore	258,635	289,004	Low	kinamycin	PKS

NZ_JACHJK010000012.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	lassopeptide	295,801	308,618	High	ulleungdin	ribosomal:unmodified

NZ_JACHJK010000013.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	butyrolactone,betalactone	18,631	48,253
Region 13.2	NI-siderophore	61,471	92,710
Region 13.3	terpene	214,111	236,315	High	geosmin	terpene:Sesquiterpene
Region 13.4	RiPP-like,HR-T2PKS,NRPS	263,526	302,204	Low	14-hydroxyisochainin	PKS:Modular type I

NZ_JACHJK010000014.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	T1PKS,NRPS-like,NRPS	12,814	97,297	Low	tripartilactam/niizalactam C	PKS
Region 14.2	CDPS	200,856	221,566	High	prunipeptin	ribosomal:RiPP

NZ_JACHJK010000015.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	ectoine	84,189	94,593	High	ectoine	other:other

NZ_JACHJK010000016.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	NRPS,T1PKS	95,644	150,850	Low	jomthonic acid A/jomthonic acid B/jomthonic acid C	NRPS:Type I

NZ_JACHJK010000019.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	bottromycin	68,522	89,295
Region 19.2	terpene-precursor	95,165	116,235

NZ_JACHJK010000020.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	NRPS,RiPP-like	39,923	116,946

NZ_JACHJK010000021.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	NRPS-like,NRPS	1	67,930	High	echinomycin	NRPS:Type I

NZ_JACHJK010000023.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	NRPS,NRPS-like	1	37,869	High	antipain	NRPS:Type I

NZ_JACHJK010000025.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 25.1	RiPP-like	25,145	37,073

NZ_JACHJK010000026.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	PKS-like,NRPS	1	56,989

NZ_JACHJK010000032.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 32.1	T1PKS,t3nrps-iterative	1	38,277	High	tripartilactam/niizalactam C	PKS

NZ_JACHJK010000043.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 43.1	NRPS-like	1	2,653	Low	FR900359	NRPS:Type I

NZ_JACHJK010000045.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 45.1	NRPS-like	1	2,046

NZ_JACHJK010000046.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 46.1	NRPS	1	2,030	High	rhizomide A/rhizomide B/rhizomide C	NRPS:Type I

NZ_JACHJK010000049.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 49.1	NRPS	1	1,855

NZ_JACHJK010000051.1 (Streptomyces echinatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 51.1	NRPS	1	1,502

No secondary metabolite regions were found in these records:: NZ_JACHJK010000005.1 (Streptomyces echinatus); NZ_JACHJK010000011.1 (Streptomyces echinatus); NZ_JACHJK010000017.1 (Streptomyces echinatus); NZ_JACHJK010000018.1 (Streptomyces echinatus); NZ_JACHJK010000022.1 (Streptomyces echinatus); NZ_JACHJK010000024.1 (Streptomyces echinatus); NZ_JACHJK010000027.1 (Streptomyces echinatus); NZ_JACHJK010000028.1 (Streptomyces echinatus); NZ_JACHJK010000029.1 (Streptomyces echinatus); NZ_JACHJK010000030.1 (Streptomyces echinatus); NZ_JACHJK010000031.1 (Streptomyces echinatus); NZ_JACHJK010000033.1 (Streptomyces echinatus); NZ_JACHJK010000034.1 (Streptomyces echinatus); NZ_JACHJK010000035.1 (Streptomyces echinatus); NZ_JACHJK010000036.1 (Streptomyces echinatus); NZ_JACHJK010000037.1 (Streptomyces echinatus); NZ_JACHJK010000038.1 (Streptomyces echinatus); NZ_JACHJK010000039.1 (Streptomyces echinatus); NZ_JACHJK010000040.1 (Streptomyces echinatus); NZ_JACHJK010000041.1 (Streptomyces echinatus); NZ_JACHJK010000042.1 (Streptomyces echinatus); NZ_JACHJK010000044.1 (Streptomyces echinatus); NZ_JACHJK010000047.1 (Streptomyces echinatus); NZ_JACHJK010000048.1 (Streptomyces echinatus); NZ_JACHJK010000050.1 (Streptomyces echinatus); NZ_JACHJK010000052.1 (Streptomyces echinatus); NZ_JACHJK010000053.1 (Streptomyces echinatus); NZ_JACHJK010000054.1 (Streptomyces echinatus); NZ_JACHJK010000055.1 (Streptomyces echinatus); NZ_JACHJK010000056.1 (Streptomyces echinatus)

Compact view

NZ_JACHJK010000001.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 236,492 - 266,261 nt. (total: 29,770 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FHS34_RS01135: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Lyases: decarboxylase

FHS34_RS01140: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.85	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.63	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002620.2	0.60	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002073.3	0.58	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.85	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.63	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002620.2	0.60	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002073.3	0.58	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.26 out of 23.43

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.11 out of 27.04

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.03 out of 36.53

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.79 out of 25.75

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.09 out of 26.85

Confidence: medium

Additional weak hits (9):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.73 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.45 out of 27.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 39.62

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.68 out of 30.22

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.28 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.05 out of 24.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.99 out of 36.53

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.19 out of 26.85

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
MatP	Cell cycle regulator
RpoN	Regulator of nitrogen assimilation and virulence
RutR	Regulator of the pyrimidine and purine metabolism

NZ_JACHJK010000001.1 - Region 2 - melanin

Download region GenBank file

Download region SVG

Location: 371,340 - 381,813 nt. (total: 10,474 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FHS34_RS01650: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.82	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.79	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.66	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.47	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.38	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000662.5	0.34	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000889.5	0.33	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.32	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.31	other (other)	iso-A82775C	Pestalotiopsis fici

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.82	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.79	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.66	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.47	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.38	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000662.5	0.34	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000889.5	0.33	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.32	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.31	other (other)	iso-A82775C	Pestalotiopsis fici

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.11 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_JACHJK010000001.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 838,918 - 883,351 nt. (total: 44,434 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

FHS34_RS03800: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHS34_RS03805: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHS34_RS03815: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHS34_RS03820: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHS34_RS03845: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHS34_RS03850: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: methyltransferase

FHS34_RS44020: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

FHS34_RS03860: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: dehydratase

FHS34_RS03790: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: mutase

FHS34_RS03705: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase

FHS34_RS03795: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS44015: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.67	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.67	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.90 out of 26.85

Confidence: medium

Additional weak hits (6):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.85 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.37 out of 19.26

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.92 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 838917 - 883351:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS44020: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (480..881): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDISVLEWQALVGGEFNMYGPTETTIWSTV
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS03795: fatty_acid

CAL_domain (45..480): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 46.3
AHBA: 19.6
NH2: 15.0
shikimic_acid: 13.7
Acetyl-CoA: 7.6

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJK010000001.1 - Region 4 - T2PKS

Download region GenBank file

Download region SVG

Location: 939,066 - 1,011,607 nt. (total: 72,542 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

FHS34_RS04275: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

FHS34_RS04350: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FHS34_RS04400: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: methyltransferase transketolase

FHS34_RS04315: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

FHS34_RS04385: transketolase

smcogs: SMCOG1204: transketolase

Hydrolases: hydrolase

FHS34_RS04200: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase dehydratase

FHS34_RS04170: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

FHS34_RS04305: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

FHS34_RS04310: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

FHS34_RS04355: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

FHS34_RS04290: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHS34_RS04295: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.76	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.75	PKS	spore pigment	Streptomyces avermitilis
BGC0000215.5	0.69	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.59	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.58	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001366.5	0.56	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0001723.5	0.56	PKS	oviedomycin	Streptomyces antibioticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.76	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.75	PKS	spore pigment	Streptomyces avermitilis
BGC0000215.5	0.69	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.59	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.58	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001366.5	0.56	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0001723.5	0.56	PKS	oviedomycin	Streptomyces antibioticus

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.21 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 25.31

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

Additional weak hits (21):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.76 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.42 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.72 out of 21.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.63 out of 21.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.36 out of 27.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.42 out of 18.57

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.09 out of 32.74

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.90 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.76 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.93 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.72 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.26 out of 28.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.35 out of 24.78

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 939065 to 1011607
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

FHS34_RS04275: OXY (Score: 265.0; E-value: 3.4e-81)
FHS34_RS04285: CYC C5-C18 (Score: 212.8; E-value: 3.1e-66)
FHS34_RS04290: KS (Score: 728.4; E-value: 5.3e-222)
FHS34_RS04295: CLF (Score: 551.9; E-value: 1.8e-168)
FHS34_RS04300: ACP (Score: 69.0; E-value: 6e-22)
FHS34_RS04305: CYC C9-C14 (Score: 248.4; E-value: 4.8e-77)
FHS34_RS04310: CYC C4-C21/C2-C23|C2-C19 (Score: 161.0; E-value: 1.8e-50)
FHS34_RS04315: MET C6|C8 (Score: 506.7; E-value: 5.6e-155)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism

NZ_JACHJK010000002.1 - Region 1 - melanin,terpene

Download region GenBank file

Download region SVG

Location: 35,275 - 73,299 nt. (total: 38,025 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

FHS34_RS04745: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

FHS34_RS04775: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: methyltransferase

FHS34_RS04825: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

FHS34_RS04710: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: cyclase

FHS34_RS04820: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase synthetase

FHS34_RS04730: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

FHS34_RS04735: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	1.04	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	1.01	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.80	other (other)	melanin	Streptomyces avermitilis
BGC0000909.3	0.60	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.56	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000658.3	0.53	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.53	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.45	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000885.3	0.32	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000662.5	0.26	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.80	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.80	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.79	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.72	other (other)	melanin	Streptomyces avermitilis
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.61	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002397.2	0.58	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.54	terpene	boleracene	Brassica oleracea var. oleracea

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

FHS34_RS04730: PT_FPPS_like

Domain 1 (58 - 337): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

FHS34_RS04820: T1TS

Domain 1 (17 - 344): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (11):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.41 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.94 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.19 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.76 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.10 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.74 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.00 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.19 out of 20.01

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.35 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein

NZ_JACHJK010000002.1 - Region 2 - other

Download region GenBank file

Download region SVG

Location: 322,038 - 363,411 nt. (total: 41,374 nt) Show pHMM detection rules used

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

FHS34_RS06045: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHS34_RS06110: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

FHS34_RS43730: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Hydrolases: hydrolase protease

FHS34_RS06065: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

FHS34_RS06135: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002573.2	0.59	other (other)	phosphoramidon	Streptomyces mozunensis
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000622.5	0.50	ribosomal	megacin	Bacillus megaterium
BGC0001336.5	0.49	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001224.5	0.47	other (other)	reductasporine	uncultured bacterium
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0002514.3	0.44	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0000675.5	0.44	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002347.3	0.43	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002573.2	0.59	other (other)	phosphoramidon	Streptomyces mozunensis
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000622.5	0.50	ribosomal	megacin	Bacillus megaterium
BGC0001336.5	0.49	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001224.5	0.47	other (other)	reductasporine	uncultured bacterium
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0002514.3	0.44	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0000675.5	0.44	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002347.3	0.43	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.07 out of 30.12

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.61 out of 23.43

Confidence: medium

Additional weak hits (9):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.43 out of 32.93

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.98 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.84 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.28 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.09 out of 23.43

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.81 out of 20.01

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.38 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.84 out of 30.98

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJK010000002.1 - Region 3 - T3PKS

Download region GenBank file

Download region SVG

Location: 686,798 - 727,862 nt. (total: 41,065 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase reductase

FHS34_RS07620: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

FHS34_RS07665: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHS34_RS07670: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHS34_RS07675: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FHS34_RS07685: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

FHS34_RS07700: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

FHS34_RS07720: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHS34_RS07730: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acyltransferase aminotransferase

FHS34_RS07780: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

FHS34_RS07795: acyltransferase

smcogs: SMCOG1141: acyltransferase

Hydrolases: deformylase

FHS34_RS07740: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: dehydratase

FHS34_RS07800: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

FHS34_RS07715: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.87	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.75	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001310.5	0.63	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000285.5	0.62	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001078.5	0.47	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000280.5	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000281.3	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001986.3	0.45	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0002347.3	0.43	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.87	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.75	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001310.5	0.63	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000285.5	0.62	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001078.5	0.47	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000280.5	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000281.3	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001986.3	0.45	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0002347.3	0.43	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (7):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.43 out of 31.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.77 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.66 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.35 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.53 out of 35.63

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_JACHJK010000002.1 - Region 4 - T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 780,273 - 833,336 nt. (total: 53,064 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FHS34_RS08130: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acetyltransferase glycosyltransferase transferase

FHS34_RS08160: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

FHS34_RS08185: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

FHS34_RS08220: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

FHS34_RS08270: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Hydrolases: back translocase hydrolase

FHS34_RS08190: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

FHS34_RS08255: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Ligases: synthase

FHS34_RS08200: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

FHS34_RS08210: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: permease

FHS34_RS08125: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.58	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.58	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.56	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.53	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.49	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.44	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000749.3	0.44	saccharide	capsular polysaccharide	Escherichia coli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.55	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000749.3	0.55	saccharide	capsular polysaccharide	Escherichia coli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (20):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.43 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.94 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.15 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.76 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.45 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.06 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.80 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.83 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.50 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.64 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.49 out of 32.74

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.64 out of 21.55

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.54 out of 36.53

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.73 out of 23.43

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.01 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.21 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.89 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.03 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 780272 - 833336:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (mxmal)
Non-colinear ordering:: FHS34_RS08210 + FHS34_RS08200 + FHS34_RS08195

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 780272 - 825486:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (mxmal)
Non-colinear ordering:: FHS34_RS08210 + FHS34_RS08200 + FHS34_RS08195

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 787440 - 833336:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (mxmal)
Non-colinear ordering:: FHS34_RS08210 + FHS34_RS08200 + FHS34_RS08195

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS08200: mxmal

PKS_AT (654..868): mxmal

ATSignature: (unknown)

No matches above 50%

minowa: Methoxymalonyl-CoA

Prediction, score:

Methoxymalonyl-CoA: 16.8
Methylmalonyl-CoA: 10.6
Malonyl-CoA: 4.6
inactive: 0.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0
CHC-CoA: -2.4

FHS34_RS08210: mal

PKS_AT (1387..1680): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 48.8
Methoxymalonyl-CoA: 26.3
inactive: 22.7
Methylmalonyl-CoA: 19.1
trans-1,2-CPDA: 16.9
fatty_acid: 14.6
Propionyl-CoA: 9.6
Ethylmalonyl-CoA: 5.9
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJK010000003.1 - Region 1 - NRPS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 31,932 - 102,865 nt. (total: 70,934 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

FHS34_RS08850: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

FHS34_RS08865: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHS34_RS08915: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Hydrolases: esterase

FHS34_RS08810: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: decarboxylase dehydratase

FHS34_RS08900: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

FHS34_RS08950: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

FHS34_RS08875: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.87	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.86	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.86	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.84	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.83	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.82	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.82	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.82	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.75	NRPS	AbT1	Aureobasidium pullulans
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.70	NRPS	AbT1	Aureobasidium pullulans
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.58 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.91 out of 23.79

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.63 out of 18.46

Confidence: medium

Additional weak hits (9):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.61 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.63 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.25 out of 31.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.64 out of 39.62

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.59 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.03 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.29 out of 29.65

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.45 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 31931 - 102865:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Thr - Tyr - Pro - Phe - NMe-Tyr - Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS08875: X - Thr - Tyr - Pro - Phe - Tyr - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (467..870): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDLTFDASWNQAEA-AGGELNLYGPSECTVNSVT
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1525..1937): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LTTHFDFSVWEGNQVFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2597..3007): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNQTFDASCDQAGGGLGGELNYYGPSECTVDSVC
Nearest Stachelhaus code(s):: Lys DADDGGFVDK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (3667..4062): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHTFDVSVQESFAAQAGEHNHYGPAETHVITAY
Nearest Stachelhaus code(s):: Pro DVQFAAHVVK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4714..5086): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDASFWDSTLVVAGEINAYGPTETTVCATM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5741..6119): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDASVSETTVVVAGEVNAYGPTETTVCATM
Nearest Stachelhaus code(s):: Tyr DASTVAAVCK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (7185..7566): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LTPSFDLSTYEVWLWTGGDVNGYGPTEATTLATC
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (82% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJK010000003.1 - Region 2 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 136,825 - 158,990 nt. (total: 22,166 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Translocases: transport

FHS34_RS09205: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.43	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002316.2	0.41	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0002346.3	0.38	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0002015.4	0.37	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001920.4	0.37	ribosomal	siamycin I	Streptomyces sp.
BGC0002307.3	0.37	ribosomal	humidimycin	Streptomyces humidus
BGC0001674.5	0.37	ribosomal	MS-271	Streptomyces mirabilis
BGC0000503.5	0.35	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000903.3	0.33	other (other)	fluorometabolite	Streptomyces cattleya
BGC0001100.5	0.32	NRPS, PKS	lankacidin C	Streptomyces rochei

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.43	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002316.2	0.41	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0002346.3	0.38	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0002015.4	0.37	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001920.4	0.37	ribosomal	siamycin I	Streptomyces sp.
BGC0002307.3	0.37	ribosomal	humidimycin	Streptomyces humidus
BGC0001674.5	0.37	ribosomal	MS-271	Streptomyces mirabilis
BGC0000503.5	0.35	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000903.3	0.33	other (other)	fluorometabolite	Streptomyces cattleya
BGC0001100.5	0.32	NRPS, PKS	lankacidin C	Streptomyces rochei

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.20 out of 26.85

Confidence: medium

Additional weak hits (9):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.45 out of 26.85

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.83 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.13 out of 36.54

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 26.85

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.65 out of 27.55

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.43 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.13 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.01 out of 33.14

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 20 - 105; Score: 70.4; RRE type: Stand_Alone_Lasso_RRE; Location: 34 - 106; Score: 28.4; RRE type: Pantocin_Microcin_RRE; Location: 44 - 105; Score: 25.7

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_JACHJK010000003.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 284,204 - 328,649 nt. (total: 44,446 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

FHS34_RS10010: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase

FHS34_RS09975: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: ligase

FHS34_RS09980: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FHS34_RS09985: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FHS34_RS09990: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001250.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.61	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.61	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001250.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.61	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.61	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.15 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (13):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.12 out of 18.57

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.31 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.10 out of 20.97

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.45 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.20 out of 29.65

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.76 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.62 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.02 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.72 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 284203 - 328649:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS09985: X

AMP-binding (459..848): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: HMMAFDVHVWQAEALPTGETNAYGPAEAADDITL
Nearest Stachelhaus code(s):: Dab DIWELTADDK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

FHS34_RS09990: X

AMP-binding (16..422): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TALAYDAVLADPVLVSAGEVNAYGPSEAAVCVTT
Nearest Stachelhaus code(s):: Tyr DAATVAAVCK (56% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJK010000003.1 - Region 4 - lassopeptide

Download region GenBank file

Download region SVG

Location: 408,879 - 431,255 nt. (total: 22,377 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

FHS34_RS10525: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

FHS34_RS10535: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

FHS34_RS10550: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.48	ribosomal	albusnodin	Streptomyces albus
BGC0002571.2	0.37	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0000397.5	0.32	NRPS	nostocyclopeptide A2	Nostoc sp. ATCC 53789
BGC0000221.5	0.32	PKS	erdacin	uncultured soil bacterium V167
BGC0000335.4	0.31	NRPS, PKS	cystomanamide A, cystomanamide B, cystomanamide C, cystomanamide D	Cystobacter fuscus
BGC0000224.4	0.29	PKS	fredericamycin A	Streptomyces griseus
BGC0002060.3	0.29	PKS	secimide	Pseudomonas syringae pv. syringae B728a
BGC0001435.4	0.29	NRPS, PKS	ikarugamycin	Streptomyces sp. ZJ306
BGC0001003.5	0.28	NRPS, PKS, saccharide	α-lipomycin	Kitasatospora aureofaciens
BGC0000181.5	0.28	PKS	macrolactin H	Bacillus velezensis FZB42

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.48	ribosomal	albusnodin	Streptomyces albus
BGC0002571.2	0.37	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0000397.5	0.32	NRPS	nostocyclopeptide A2	Nostoc sp. ATCC 53789
BGC0000221.5	0.32	PKS	erdacin	uncultured soil bacterium V167
BGC0000335.4	0.31	NRPS, PKS	cystomanamide A, cystomanamide B, cystomanamide C, cystomanamide D	Cystobacter fuscus
BGC0000224.4	0.29	PKS	fredericamycin A	Streptomyces griseus
BGC0002060.3	0.29	PKS	secimide	Pseudomonas syringae pv. syringae B728a
BGC0001435.4	0.29	NRPS, PKS	ikarugamycin	Streptomyces sp. ZJ306
BGC0001003.5	0.28	NRPS, PKS, saccharide	α-lipomycin	Kitasatospora aureofaciens
BGC0000181.5	0.28	PKS	macrolactin H	Bacillus velezensis FZB42

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.58 out of 23.79

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.34 out of 20.01

Confidence: medium

Additional weak hits (5):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.13 out of 26.85

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.35 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.68 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 28.19

Confidence: weak

Lasso peptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
IolR	Regulator of the inositol catabolism

NZ_JACHJK010000003.1 - Region 5 - lanthipeptide-class-ii,terpene

Download region GenBank file

Download region SVG

Location: 665,934 - 709,177 nt. (total: 43,244 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FHS34_RS11760: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHS34_RS11770: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FHS34_RS11790: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FHS34_RS11810: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

FHS34_RS11795: methyltransferase

smcogs: SMCOG1089: methyltransferase

FHS34_RS11925: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

FHS34_RS11900: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: synthetase

FHS34_RS11805: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.53	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.47	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.42	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.42	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.41	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000842.5	0.22	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0001810.3	0.22	PKS	trehangelin	Polymorphospora rubra
BGC0000648.3	0.21	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.19	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.18	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.81	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.76	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.73	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.73	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.72	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.55	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000639.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for FHS34_RS11900

FHS34_RS11895

Leader:

MSQSSVHTAAVLEAWLSGAESAYG

Core:

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

Core with dehydrations:

QLNPAGPLYVGGAAAEAALDhbDPDhaDDhaLYGFCysDhaDhaPDhaGDhaRGDhaWCysCys

antiSMASH-DB 4.0 matches for FHS34_RS11895

100.0%

NZ_CP098485.1and 3 others:

NZ_CP098485.1 Lanthipeptides: NAT22_RS36135_lanthipeptideNZ_JACHJK010000003.1 Lanthipeptides: FHS34_RS11895_lanthipeptideNZ_JACHJK010000003.1 Lanthipeptides: FHS34_RS11895_lanthipeptide

Lanthipeptides: NAT22_RS36135_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

97.6%

NZ_CP032698.1:

Lanthipeptides: DWB77_RS04745_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

QLNPAGPLYVGG AAEAALTDPSDSLYGFCSSPSGSRGSWCC

1

QLNPAGPLYVGGTAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

97.6%

NZ_CP106798.1:

Lanthipeptides: N8I87_RS37365_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

Q+NPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

1

QINPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

with 77 more sequence matches

Only the first 10 are displayed here.

97.6%

NZ_VISR01000021.1and 1 other:

NZ_VISR01000021.1 Lanthipeptides: FB157_RS31330_lanthipeptide

Lanthipeptides: FB157_RS31330_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGS GSWCC

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

95.2%

NZ_BMUQ01000012.1and 7 others:

NZ_CP041604.2 Lanthipeptides: FNV64_RS07000_lanthipeptideNZ_CP041610.2 Lanthipeptides: FNV62_RS03705_lanthipeptideNZ_CP041611.1 Lanthipeptides: FNV63_RS03970_lanthipeptideNZ_CP041613.2 Lanthipeptides: FNV68_RS05855_lanthipeptideNZ_CP041650.2 Lanthipeptides: FNV59_RS05275_lanthipeptideNZ_CP050974.1 Lanthipeptides: HEP84_RS02235_lanthipeptideNZ_KQ948493.1 Lanthipeptides: AQJ27_RS49365_lanthipeptide

Lanthipeptides: IE289_RS27575_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

Q NPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGS GSWCC

1

QTNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

95.2%

NZ_BMUU01000006.1and 2 others:

NZ_BMUZ01000004.1 Lanthipeptides: IE267_RS12185_lanthipeptideNZ_CP070373.1 Lanthipeptides: GWQ54_RS15625_lanthipeptide

Lanthipeptides: IE233_RS19480_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

QLNPAGPLYVGGAAAEAALTD SDSLYGFCSSPSGS GSWCC

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

95.2%

NZ_CP106795.1and 3 others:

NZ_CP106795.1 Lanthipeptides: N8I86_RS02690_lanthipeptideNZ_LIWA01000005.1 Lanthipeptides: AMK32_RS23965_lanthipeptideNZ_LIWA01000005.1 Lanthipeptides: AMK32_RS23965_lanthipeptide

Lanthipeptides: N8I86_RS02690_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

+LNPAGPLYVGG AAEAALTDPSDSLYGFCSSPSGSRGSWCC

1

ELNPAGPLYVGGTAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

92.9%

NZ_BMVR01000007.1:

Lanthipeptides: IE274_RS20785_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

Q NPAGPLYVGG AAEAALTDPSDSLYGFCSSPSGS GSWCC

1

QPNPAGPLYVGGTAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

92.9%

NZ_CP023690.1and 1 other:

NZ_CP030771.1 Lanthipeptides: C9F11_RS41405_lanthipeptide

Lanthipeptides: CP982_RS40715_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

Q NPAGPLYVGG+AAEAALTDPSDSLYGFCSSPSGS GSWCC

1

QANPAGPLYVGGSAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

92.9%

NZ_CP040916.1and 1 other:

NZ_RHGC01000002.1 Lanthipeptides: EJ355_RS11575_lanthipeptide

Lanthipeptides: FH965_RS39150_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

Q NPAGPLYVGG AAEAALTDPSDSLYGFCSSPSGS GSWCC

1

QANPAGPLYVGGTAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

92.9%

NZ_CP051010.1and 1 other:

NZ_FONR01000009.1 Lanthipeptides: BM303_RS25620_lanthipeptide

Lanthipeptides: HEP87_RS03725_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

+ NPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGS GSWCC

1

RTNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

92.9%

NZ_MQUS01000030.1:

Lanthipeptides: AV521_RS36555_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

Q NPAGPLYVGG AAEAALTDPSDSLYGFCSSPSGS GSWCC

1

QSNPAGPLYVGGTAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

92.9%

NZ_NNBJ01000008.1:

Lanthipeptides: CG740_RS17895_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

QLNPAGPLYVGGAAAEA LTD SDSLYGFCSSPSGS GSWCC

1

QLNPAGPLYVGGAAAEAGLTDSSDSLYGFCSSPSGSHGSWCC

42

allorf_689014_689217

Leader:

MNGTCPGPPGRLPGRPGGGGRPPDAERVRAA

Core:

RLDTVRTTRSPNGRRRPGGTRTPGVRGHSGCPAPQE

Core with dehydrations:

RLDDhbVRDhbDhbRDhaPNGRRRPGGDhbRDhbPGVRGHDhaGCysPAPQE

antiSMASH-DB 4.0 matches for allorf_689014_689217

100.0%

NZ_JACHJK010000003.1:

Lanthipeptides: allorf_689014_689217_lanthipeptide

1

RLDTVRTTRSPNGRRRPGGTRTPGVRGHSGCPAPQE

36

RLDTVRTTRSPNGRRRPGGTRTPGVRGHSGCPAPQE

1

RLDTVRTTRSPNGRRRPGGTRTPGVRGHSGCPAPQE

36

20.6%

NZ_CP029607.1:

Lanthipeptides: allorf_6468650_6468883_lanthipeptide

2

LDTVRTT--RSPNGRRRPGGTRTPGVRGHSGCPA

33

L TVR R+P+ R P R P V PA

1

LRTVRVPGPRAPDYERPPASVRPPSVWTTDAPPA

34

19.0%

NZ_CP050504.1:

Lanthipeptides: allorf_0161193_0161369_lanthipeptide

10

SPNGRRRPGGTRTPGV

25

SP+ + RP GT PG

3

SPDPQARPCGTACPGY

18

allorf_691771_691914

Leader:

MITYSYRMRKPRIPRAMYGS

Core:

WDRLSCLRSARPGTSRSERGVIEPGDY

Core with dehydrations:

WDRLDhaCysLRDhaARPGDhbDhaRDhaERGVIEPGDY

antiSMASH-DB 4.0 matches for allorf_691771_691914

33.3%

NZ_KB905433.1:

Lanthipeptides: A37U_RS52290_lanthipeptide

9

SARPGTSRSERGVIEPG

25

+A PGT SE G+ PG

4

TATPGTCNSECGLTRPG

20

22.2%

NZ_CP040938.1:

Lanthipeptides: allorf_0462507_0462617_lanthipeptide

5

SCLRSARP

12

SCLR+ RP

14

SCLRNKRP

21

15.9%

NZ_CP023465.1:

Lanthipeptides: allorf_5416885_5417064_lanthipeptide

1

WDRLSCLRSARPGTS

15

W+R C RSA G +

27

WNRPKCRRSAAHGCA

41

MIBiG 4.0 matches for allorf_691771_691914

14.8%

BGC0002150.2 (MBO0654592.1):

Lasso peptide: triculamin

8

RSARPGTSRSERGV

21

+ ++PG +GV

2

KKSKPGDGIRGKGV

15

Lanthipeptide(s) for FHS34_RS11905

FHS34_RS11895

Leader:

MSQSSVHTAAVLEAWLSGAESAYG

Core:

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

Core with dehydrations:

QLNPAGPLYVGGAAAEAALDhbDPDhaDDhaLYGFCysDhaDhaPDhaGDhaRGDhaWCysCys

antiSMASH-DB 4.0 matches for FHS34_RS11895

100.0%

NZ_CP098485.1and 3 others:

NZ_CP098485.1 Lanthipeptides: NAT22_RS36135_lanthipeptideNZ_JACHJK010000003.1 Lanthipeptides: FHS34_RS11895_lanthipeptideNZ_JACHJK010000003.1 Lanthipeptides: FHS34_RS11895_lanthipeptide

Lanthipeptides: NAT22_RS36135_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

97.6%

NZ_CP032698.1:

Lanthipeptides: DWB77_RS04745_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

QLNPAGPLYVGG AAEAALTDPSDSLYGFCSSPSGSRGSWCC

1

QLNPAGPLYVGGTAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

97.6%

NZ_CP106798.1:

Lanthipeptides: N8I87_RS37365_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

Q+NPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

1

QINPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

with 77 more sequence matches

Only the first 10 are displayed here.

97.6%

NZ_VISR01000021.1and 1 other:

NZ_VISR01000021.1 Lanthipeptides: FB157_RS31330_lanthipeptide

Lanthipeptides: FB157_RS31330_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGS GSWCC

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

95.2%

NZ_BMUQ01000012.1and 7 others:

NZ_CP041604.2 Lanthipeptides: FNV64_RS07000_lanthipeptideNZ_CP041610.2 Lanthipeptides: FNV62_RS03705_lanthipeptideNZ_CP041611.1 Lanthipeptides: FNV63_RS03970_lanthipeptideNZ_CP041613.2 Lanthipeptides: FNV68_RS05855_lanthipeptideNZ_CP041650.2 Lanthipeptides: FNV59_RS05275_lanthipeptideNZ_CP050974.1 Lanthipeptides: HEP84_RS02235_lanthipeptideNZ_KQ948493.1 Lanthipeptides: AQJ27_RS49365_lanthipeptide

Lanthipeptides: IE289_RS27575_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

Q NPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGS GSWCC

1

QTNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

95.2%

NZ_BMUU01000006.1and 2 others:

NZ_BMUZ01000004.1 Lanthipeptides: IE267_RS12185_lanthipeptideNZ_CP070373.1 Lanthipeptides: GWQ54_RS15625_lanthipeptide

Lanthipeptides: IE233_RS19480_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

QLNPAGPLYVGGAAAEAALTD SDSLYGFCSSPSGS GSWCC

1

QLNPAGPLYVGGAAAEAALTDSSDSLYGFCSSPSGSHGSWCC

42

95.2%

NZ_CP106795.1and 3 others:

NZ_CP106795.1 Lanthipeptides: N8I86_RS02690_lanthipeptideNZ_LIWA01000005.1 Lanthipeptides: AMK32_RS23965_lanthipeptideNZ_LIWA01000005.1 Lanthipeptides: AMK32_RS23965_lanthipeptide

Lanthipeptides: N8I86_RS02690_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

+LNPAGPLYVGG AAEAALTDPSDSLYGFCSSPSGSRGSWCC

1

ELNPAGPLYVGGTAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

92.9%

NZ_BMVR01000007.1:

Lanthipeptides: IE274_RS20785_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

Q NPAGPLYVGG AAEAALTDPSDSLYGFCSSPSGS GSWCC

1

QPNPAGPLYVGGTAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

92.9%

NZ_CP023690.1and 1 other:

NZ_CP030771.1 Lanthipeptides: C9F11_RS41405_lanthipeptide

Lanthipeptides: CP982_RS40715_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

Q NPAGPLYVGG+AAEAALTDPSDSLYGFCSSPSGS GSWCC

1

QANPAGPLYVGGSAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

92.9%

NZ_CP040916.1and 1 other:

NZ_RHGC01000002.1 Lanthipeptides: EJ355_RS11575_lanthipeptide

Lanthipeptides: FH965_RS39150_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

Q NPAGPLYVGG AAEAALTDPSDSLYGFCSSPSGS GSWCC

1

QANPAGPLYVGGTAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

92.9%

NZ_CP051010.1and 1 other:

NZ_FONR01000009.1 Lanthipeptides: BM303_RS25620_lanthipeptide

Lanthipeptides: HEP87_RS03725_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

+ NPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGS GSWCC

1

RTNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

92.9%

NZ_MQUS01000030.1:

Lanthipeptides: AV521_RS36555_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

Q NPAGPLYVGG AAEAALTDPSDSLYGFCSSPSGS GSWCC

1

QSNPAGPLYVGGTAAEAALTDPSDSLYGFCSSPSGSHGSWCC

42

92.9%

NZ_NNBJ01000008.1:

Lanthipeptides: CG740_RS17895_lanthipeptide

1

QLNPAGPLYVGGAAAEAALTDPSDSLYGFCSSPSGSRGSWCC

42

QLNPAGPLYVGGAAAEA LTD SDSLYGFCSSPSGS GSWCC

1

QLNPAGPLYVGGAAAEAGLTDSSDSLYGFCSSPSGSHGSWCC

42

allorf_689014_689217

Leader:

MNGTCPGPPGRLPGRPGGGGRPPDAERVRAA

Core:

RLDTVRTTRSPNGRRRPGGTRTPGVRGHSGCPAPQE

Core with dehydrations:

RLDDhbVRDhbDhbRDhaPNGRRRPGGDhbRDhbPGVRGHDhaGCysPAPQE

antiSMASH-DB 4.0 matches for allorf_689014_689217

100.0%

NZ_JACHJK010000003.1:

Lanthipeptides: allorf_689014_689217_lanthipeptide

1

RLDTVRTTRSPNGRRRPGGTRTPGVRGHSGCPAPQE

36

RLDTVRTTRSPNGRRRPGGTRTPGVRGHSGCPAPQE

1

RLDTVRTTRSPNGRRRPGGTRTPGVRGHSGCPAPQE

36

20.6%

NZ_CP029607.1:

Lanthipeptides: allorf_6468650_6468883_lanthipeptide

2

LDTVRTT--RSPNGRRRPGGTRTPGVRGHSGCPA

33

L TVR R+P+ R P R P V PA

1

LRTVRVPGPRAPDYERPPASVRPPSVWTTDAPPA

34

19.0%

NZ_CP050504.1:

Lanthipeptides: allorf_0161193_0161369_lanthipeptide

10

SPNGRRRPGGTRTPGV

25

SP+ + RP GT PG

3

SPDPQARPCGTACPGY

18

allorf_691771_691914

Leader:

MITYSYRMRKPRIPRAMYGS

Core:

WDRLSCLRSARPGTSRSERGVIEPGDY

Core with dehydrations:

WDRLDhaCysLRDhaARPGDhbDhaRDhaERGVIEPGDY

antiSMASH-DB 4.0 matches for allorf_691771_691914

33.3%

NZ_KB905433.1:

Lanthipeptides: A37U_RS52290_lanthipeptide

9

SARPGTSRSERGVIEPG

25

+A PGT SE G+ PG

4

TATPGTCNSECGLTRPG

20

22.2%

NZ_CP040938.1:

Lanthipeptides: allorf_0462507_0462617_lanthipeptide

5

SCLRSARP

12

SCLR+ RP

14

SCLRNKRP

21

15.9%

NZ_CP023465.1:

Lanthipeptides: allorf_5416885_5417064_lanthipeptide

1

WDRLSCLRSARPGTS

15

W+R C RSA G +

27

WNRPKCRRSAAHGCA

41

MIBiG 4.0 matches for allorf_691771_691914

14.8%

BGC0002150.2 (MBO0654592.1):

Lasso peptide: triculamin

8

RSARPGTSRSERGV

21

+ ++PG +GV

2

KKSKPGDGIRGKGV

15

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

FHS34_RS11800: Lycopene_cycl

Domain 1 (6 - 382): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

FHS34_RS11805: PT_FPPS_like

Domain 1 (48 - 357): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

FHS34_RS11815: PT_phytoene_like

Domain 1 (16 - 309): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 22.44 out of 23.79

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

Additional weak hits (12):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.17 out of 20.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.53 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.39 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.03 out of 30.22

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.51 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.46 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.67 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.52 out of 24.78

Confidence: weak

Lanthipeptides

Terpene

TFBS Finder

Core peptide predictions

FHS34_RS11895 - Class II

Cleavage pHMM score: -4.40

RODEO score: 0

Monoisotopic mass: 4017.9 Da

Molecular weight: 4020.4 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 4038.4 Da N = 1; 4056.4 Da N = 2; 4074.4 Da N = 3; 4092.4 Da N = 4; 4110.5 Da N = 5

allorf_689014_689217 - Class II

Cleavage pHMM score: -6.10

RODEO score: 0

Monoisotopic mass: 3756.0 Da

Molecular weight: 3758.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3776.2 Da N = 1; 3794.2 Da N = 2; 3812.2 Da N = 3; 3830.2 Da N = 4; 3848.2 Da N = 5; 3866.3 Da N = 6

allorf_691771_691914 - Class II

Cleavage pHMM score: -4.60

RODEO score: 0

Monoisotopic mass: 2972.5 Da

Molecular weight: 2974.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2992.3 Da N = 1; 3010.3 Da N = 2; 3028.3 Da N = 3; 3046.3 Da N = 4

FHS34_RS11895 - Class II

Cleavage pHMM score: -4.40

RODEO score: 0

Monoisotopic mass: 4017.9 Da

Molecular weight: 4020.4 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 4038.4 Da N = 1; 4056.4 Da N = 2; 4074.4 Da N = 3; 4092.4 Da N = 4; 4110.5 Da N = 5

allorf_689014_689217 - Class II

Cleavage pHMM score: -6.10

RODEO score: 0

Monoisotopic mass: 3756.0 Da

Molecular weight: 3758.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3776.2 Da N = 1; 3794.2 Da N = 2; 3812.2 Da N = 3; 3830.2 Da N = 4; 3848.2 Da N = 5; 3866.3 Da N = 6

allorf_691771_691914 - Class II

Cleavage pHMM score: -4.60

RODEO score: 0

Monoisotopic mass: 2972.5 Da

Molecular weight: 2974.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2992.3 Da N = 1; 3010.3 Da N = 2; 3028.3 Da N = 3; 3046.3 Da N = 4

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

NZ_JACHJK010000003.1 - Region 6 - atropopeptide

Download region GenBank file

Download region SVG

Location: 788,799 - 810,049 nt. (total: 21,251 nt) Show pHMM detection rules used

atropopeptide: atropopeptide_p450

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FHS34_RS12295: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHS34_RS12330: Biaryl bond formation

MITE: MITE0000172Biaryl bond formation (identity: 75.30%)
smcogs: SMCOG1034: cytochrome P450

Hydrolases: dehalogenase hydrolase

FHS34_RS12345: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

FHS34_RS12370: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: oxygenase

FHS34_RS12330: Biaryl bond formation

MITE: MITE0000172Biaryl bond formation (identity: 75.30%)
smcogs: SMCOG1034: cytochrome P450

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002751.2	0.61	ribosomal	Amyxirubin B	Amycolatopsis xylanica
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000866.5	0.49	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0001928.2	0.45	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.44	other (other)	bacilysin	Bacillus sp. CS93
BGC0001197.5	0.44	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002218.2	0.44	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0001605.3	0.43	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002387.2	0.43	PKS	yangpumicin A	Micromonospora yangpuensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002751.2	0.61	ribosomal	Amyxirubin B	Amycolatopsis xylanica
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000866.5	0.49	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0001928.2	0.45	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.44	other (other)	bacilysin	Bacillus sp. CS93
BGC0001197.5	0.44	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002218.2	0.44	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0001605.3	0.43	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002387.2	0.43	PKS	yangpumicin A	Micromonospora yangpuensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.97 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.79 out of 27.04

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.07 out of 30.12

Confidence: medium

Additional weak hits (9):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.57 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.28 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.80 out of 28.14

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.92 out of 30.22

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.91 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.53 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.07 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
DasR	N-acetylglucosamine dependent repressor
OsdR	Development and stress management regulator

NZ_JACHJK010000004.1 - Region 1 - NRPS,arylpolyene

Download region GenBank file

Download region SVG

Location: 382,491 - 460,263 nt. (total: 77,773 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FHS34_RS14375: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHS34_RS14440: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHS34_RS14490: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FHS34_RS14545: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acyltransferase halogenase

FHS34_RS14390: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

FHS34_RS14515: flavin-dependent tyrosine-like hpg halogenase

halogenases: flavin-dependent tyrosine-like hpg halogenase
MITE: MITE0000040Halogenation (identity: 62.40%)
smcogs: SMCOG1119: halogenase

FHS34_RS14565: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Hydrolases: hydrolase

FHS34_RS14455: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase

FHS34_RS14445: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHS34_RS14460: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHS34_RS14465: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHS34_RS14470: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHS34_RS14495: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

FHS34_RS14500: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHS34_RS14555: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

FHS34_RS14575: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Translocases: transport

FHS34_RS14295: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.95	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.92	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0002014.3	0.80	NRPS, PKS	pepticinnamin E	Actinobacteria bacterium OK006
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	0.71	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.76	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0002014.3	0.75	NRPS, PKS	pepticinnamin E	Actinobacteria bacterium OK006
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000342.4	0.74	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

Additional weak hits (15):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.32 out of 21.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.80 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.85 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.87 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.10 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.37 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.79 out of 30.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.43 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.47 out of 21.55

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.27 out of 30.12

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.54 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.16 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 382490 - 460263:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Tyr - NMe-Tyr) + (NMe-Pro - Ser - Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS14390: Pro - Ser - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (470..862): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: MSQSFDVAFWDMTMSVAGEFNAYGPTETTVIATM
Nearest Stachelhaus code(s):: Ala DVWIYAAVIK (50% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1921..2305): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFISSGEHNLYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2968..3362): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVSDLTAILVGEANLYGPTEACVYATE
Nearest Stachelhaus code(s):: Gly DVSTIVLVYK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS14510: Tyr - Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (459..893): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGQAFDAAFSEMTLNLAGELNAYGPTEATVCATM
Nearest Stachelhaus code(s):: Tyr DASTNAAVCK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1551..1948): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RSEAFDGAFSDMTLIMAGDVNAYGPTEATVCATI
Nearest Stachelhaus code(s):: Tyr DGSTIAAVCK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJK010000006.1 - Region 1 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 4,247 - 17,201 nt. (total: 12,955 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

FHS34_RS17830: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

FHS34_RS17840: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Translocases: permease

FHS34_RS17810: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.63	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.44	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000575.5	0.40	ribosomal	lariatin	Rhodococcus jostii
BGC0000541.5	0.40	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000544.4	0.36	ribosomal	planosporicin	Planomonospora alba
BGC0001657.4	0.35	NRPS	lysocin	Lysobacter sp. RH2180-5
BGC0001418.4	0.35	NRPS, PKS	myxochromide D	Hyalangium minutum
BGC0001419.4	0.35	NRPS, PKS	myxochromide D	Hyalangium minutum
BGC0000916.5	0.35	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000711.5	0.34	saccharide	neomycin	Streptomyces fradiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.63	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.44	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000575.5	0.40	ribosomal	lariatin	Rhodococcus jostii
BGC0000541.5	0.40	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000544.4	0.36	ribosomal	planosporicin	Planomonospora alba
BGC0001657.4	0.35	NRPS	lysocin	Lysobacter sp. RH2180-5
BGC0001418.4	0.35	NRPS, PKS	myxochromide D	Hyalangium minutum
BGC0001419.4	0.35	NRPS, PKS	myxochromide D	Hyalangium minutum
BGC0000916.5	0.35	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000711.5	0.34	saccharide	neomycin	Streptomyces fradiae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.05 out of 22.40

Confidence: strong

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.55 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.54 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 17.67 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
HypR	L-hydroxyproline utilization repressor

NZ_JACHJK010000006.1 - Region 2 - NRPS,T1PKS,polyhalogenated-pyrrole

Download region GenBank file

Download region SVG

Location: 48,714 - 135,227 nt. (total: 86,514 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
polyhalogenated-pyrrole: (Abhydrolase_6 and Trp_halogenase and (Acyl-CoA_dh_N or Acyl-CoA_dh_M or Acyl-CoA_dh_1) and AMP-binding)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FHS34_RS18035: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHS34_RS18045: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHS34_RS18075: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FHS34_RS18150: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: PPTase acylase halogenase

FHS34_RS18060: flavin-dependent pyrrole halogenase

halogenases: flavin-dependent pyrrole halogenase
smcogs: SMCOG1119: halogenase

FHS34_RS18065: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

FHS34_RS18070: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

FHS34_RS18145: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: esterase hydrolase

FHS34_RS18040: thioesterase

smcogs: SMCOG1004: thioesterase

FHS34_RS18135: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

FHS34_RS18155: thioesterase

smcogs: SMCOG1004: thioesterase

FHS34_RS18165: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Ligases: ligase synthase

FHS34_RS18050: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS18100: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS18105: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport transporter

FHS34_RS18010: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

FHS34_RS18095: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.90	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002286.3	0.85	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.83	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.81	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.81	NRPS	AbT1	Aureobasidium pullulans
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.08 out of 18.57

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.32 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

Additional weak hits (22):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.54 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.37 out of 26.12

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.09 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.49 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.98 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.95 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.12 out of 27.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.31 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.33 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.67 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.95 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.82 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.90 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.20 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.90 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.27 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.11 out of 23.43

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.91 out of 29.65

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.48 out of 29.25

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 48713 - 135227:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-ohmal - pk) + (Me-redmal) + (Cys) + (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS18050: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (9..393): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWAAFDLSVLDVYSLFAGEMNLYGPTETNVCTFH
Nearest Stachelhaus code(s):: Pro DLLYLALVCK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS18070: mal - mmal - pk

PKS_AT (535..831): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 70.8%; 2-Methylbutyryl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 145.1
Methylmalonyl-CoA: 121.9
Methoxymalonyl-CoA: 107.1
Ethylmalonyl-CoA: 84.1
2-Methylbutyryl-CoA: 76.0
Propionyl-CoA: 74.3
Isobutyryl-CoA: 74.3
Benzoyl-CoA: 53.2
trans-1,2-CPDA: 46.0
CHC-CoA: 45.2
inactive: 44.3
fatty_acid: 24.1
Acetyl-CoA: 20.7
3-Methylbutyryl-CoA: 7.5

PKS_AT (1918..2215): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 201.8
Ethylmalonyl-CoA: 195.4
Methoxymalonyl-CoA: 168.2
2-Methylbutyryl-CoA: 144.3
trans-1,2-CPDA: 132.9
CHC-CoA: 112.7
Propionyl-CoA: 107.5
Malonyl-CoA: 92.7
Isobutyryl-CoA: 65.2
Benzoyl-CoA: 53.7
Acetyl-CoA: 43.4
inactive: 31.0
fatty_acid: 29.4
3-Methylbutyryl-CoA: 26.8

PKS_AT (3404..3703): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 209.5
Methylmalonyl-CoA: 209.2
Methoxymalonyl-CoA: 179.2
2-Methylbutyryl-CoA: 155.1
trans-1,2-CPDA: 132.8
Malonyl-CoA: 117.1
Propionyl-CoA: 112.0
CHC-CoA: 99.3
Isobutyryl-CoA: 85.6
Benzoyl-CoA: 76.1
Acetyl-CoA: 53.1
3-Methylbutyryl-CoA: 25.3
inactive: 24.6
fatty_acid: 12.7

FHS34_RS18075: mmal

PKS_AT (570..867): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 219.1
Ethylmalonyl-CoA: 218.4
Methoxymalonyl-CoA: 187.3
2-Methylbutyryl-CoA: 151.3
trans-1,2-CPDA: 137.6
Propionyl-CoA: 118.5
Malonyl-CoA: 115.1
CHC-CoA: 95.7
Isobutyryl-CoA: 94.6
Benzoyl-CoA: 65.3
Acetyl-CoA: 55.2
inactive: 47.2
3-Methylbutyryl-CoA: 43.2
fatty_acid: 19.6

FHS34_RS18100: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (536..936): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDLSFDLSVYDGNTMMSGDMSLGGATEASIWSIH
Nearest Stachelhaus code(s):: Cys DLYNMSLIWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS18150: pk

PKS_AT (537..837): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 70.8%; Methoxymalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 116.1
Methoxymalonyl-CoA: 102.9
Malonyl-CoA: 99.8
Ethylmalonyl-CoA: 71.3
Isobutyryl-CoA: 63.9
Propionyl-CoA: 54.0
2-Methylbutyryl-CoA: 50.6
Acetyl-CoA: 44.7
trans-1,2-CPDA: 36.8
CHC-CoA: 30.8
Benzoyl-CoA: 27.8
3-Methylbutyryl-CoA: 27.8
fatty_acid: 22.9
inactive: 18.9

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJK010000006.1 - Region 3 - lassopeptide

Download region GenBank file

Download region SVG

Location: 201,733 - 224,308 nt. (total: 22,576 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

FHS34_RS18595: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Hydrolases: esterase hydrolase

FHS34_RS18555: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

FHS34_RS18565: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Lyases: hydratase

FHS34_RS18575: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001550.3	0.85	ribosomal	citrulassin D	Streptomyces katrae
BGC0001552.3	0.84	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.84	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.81	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001548.4	0.76	ribosomal	citrulassin A	Streptomyces albulus
BGC0001781.4	0.72	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001507.3	0.68	ribosomal	anantin C	Streptomyces olindensis
BGC0002298.2	0.62	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0001889.2	0.61	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001539.4	0.60	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001550.3	0.85	ribosomal	citrulassin D	Streptomyces katrae
BGC0001552.3	0.84	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.84	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.81	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001548.4	0.76	ribosomal	citrulassin A	Streptomyces albulus
BGC0001781.4	0.72	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001507.3	0.68	ribosomal	anantin C	Streptomyces olindensis
BGC0002298.2	0.62	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0001889.2	0.61	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001539.4	0.60	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (9):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.99 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.00 out of 31.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.00 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.39 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.59 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 83; Score: 84.6

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJK010000006.1 - Region 4 - terpene

Download region GenBank file

Download region SVG

Location: 244,968 - 265,438 nt. (total: 20,471 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

FHS34_RS42625: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Translocases: transporter

FHS34_RS18695: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.36	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002285.2	0.31	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002293.2	0.30	NRPS	ohmyungsamycin A, ohmyungsamycin B	Streptomyces sp.
BGC0001513.3	0.28	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000845.5	0.28	other (non-nrp beta-lactam)	clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0001553.5	0.27	NRPS, PKS	clifednamide A	Streptomyces sp. JV178
BGC0000495.5	0.26	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0000388.5	0.25	NRPS	mannopeptimycin	Streptomyces hygroscopicus
BGC0001574.5	0.24	NRPS	SF2768	Streptomyces thioluteus
BGC0002291.3	0.22	PKS	efomycin K, efomycin L	Streptomyces sp. M56

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.36	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002285.2	0.31	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002293.2	0.30	NRPS	ohmyungsamycin A, ohmyungsamycin B	Streptomyces sp.
BGC0001513.3	0.28	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000845.5	0.28	other (non-nrp beta-lactam)	clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0001553.5	0.27	NRPS, PKS	clifednamide A	Streptomyces sp. JV178
BGC0000495.5	0.26	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0000388.5	0.25	NRPS	mannopeptimycin	Streptomyces hygroscopicus
BGC0001574.5	0.24	NRPS	SF2768	Streptomyces thioluteus
BGC0002291.3	0.22	PKS	efomycin K, efomycin L	Streptomyces sp. M56

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.50 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

NZ_JACHJK010000006.1 - Region 5 - NRPS

Download region GenBank file

Download region SVG

Location: 322,344 - 366,645 nt. (total: 44,302 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FHS34_RS19055: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHS34_RS19110: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

Hydrolases: hydrolase

FHS34_RS19060: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: dehydratase

FHS34_RS19045: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

FHS34_RS19100: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

FHS34_RS19120: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS19130: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001574.5	0.67	NRPS	SF2768	Streptomyces thioluteus
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001250.4	0.62	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.62	NRPS	epichloenin A	Epichloe festucae
BGC0001249.5	0.62	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001574.5	0.67	NRPS	SF2768	Streptomyces thioluteus
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001250.4	0.62	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.62	NRPS	epichloenin A	Epichloe festucae
BGC0001249.5	0.62	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.26 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.29 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.48 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.41 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.42 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.42 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.28 out of 32.93

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.32 out of 23.43

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.90 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 322343 - 366645:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS19120: X

AMP-binding (18..414): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IALI-GFHVGGWCVVYGGSAQIYGLTETGNTAVC
Nearest Stachelhaus code(s):: Val DFFCVGIVHK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

FHS34_RS19130: X

AMP-binding (457..844): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FGAAFDTSVEELDLVIGGELNSYGPTEATVAATV
Nearest Stachelhaus code(s):: Lys DIEDVGSVVK (76% 8Å match); Lys or Arg DVEDIGSVAK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_JACHJK010000006.1 - Region 6 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 451,975 - 530,906 nt. (total: 78,932 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FHS34_RS19710: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHS34_RS19800: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase

FHS34_RS19735: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

FHS34_RS19810: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: deacetylase hydrolase

FHS34_RS19660: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

FHS34_RS19715: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

FHS34_RS19780: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: racemase

FHS34_RS19795: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase

FHS34_RS19720: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FHS34_RS19725: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.44	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.42	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.41	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.40	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000518.3	0.39	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001132.4	0.39	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.39	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.38	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.38	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.37	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.69	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.23 out of 32.74

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.53 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.75 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.38 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 451974 - 530906:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - D-Ala - D-Val - D-Ala - Leu) + (D-Orn - Thr - D-X - Val - D-Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS19720: Leu - Ala - Val - Ala - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (39..445): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAASFDASVLEVLIIVGAEINSYGPTETTIVATW
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (71% 8Å match); Leu DALLIGAVVK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1132..1525): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFECSGVLAGEANIYGPTEATVYATA
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2634..3027): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDASTYEVWLWTGGEVDGYGPTETTTFATR
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4135..4531): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFESSAVLAGERNIYGPTEATVYATA
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5703..6088): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAEAFDASVLEVLLIVGADVNSYGPTEATVVATW
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (74% 8Å match); Leu DALLIGAVVK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

FHS34_RS19725: Orn - Thr - X - Val - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (513..900): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAHAFDTSLEGLDVMLGGEHNFYGPTECTVDALS
Nearest Stachelhaus code(s):: Orn DTEDMGFVDK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2012..2419): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LRTHFDFSVWEGNQIFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3081..3473): X

nrpys: Dhpg, Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDHAFDTSWEGLNVLVGGEYNMYGPTETTVDAVY
Nearest Stachelhaus code(s):: Orn DTEDMGYVDK (76% 8Å match); Asp DMKDLGMVDK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (4586..4985): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDSSFDAATFEAWLWTGGDVDGYGPTETTTFATS
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (5637..6018): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAAAFDASVLEVLIIVGAEINSYGPTEATVVATW
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (71% 8Å match); Leu DALLIGAVVK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_JACHJK010000007.1 - Region 1 - PKS-like

Download region GenBank file

Download region SVG

Location: 181,293 - 222,153 nt. (total: 40,861 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

FHS34_RS20745: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: esterase

FHS34_RS20760: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

FHS34_RS20750: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

FHS34_RS20755: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

FHS34_RS20715: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.20 out of 36.53

Confidence: strong

Additional weak hits (8):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.84 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.68 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.93 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.59 out of 35.63

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

FHS34_RS20755: Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (32..425): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNSAFDAAVFEGFVLTGGEVSVYGPTECSVFATY
Nearest Stachelhaus code(s):: Ile DAFFLGVTFK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_JACHJK010000008.1 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 55,137 - 76,324 nt. (total: 21,188 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002317.2	0.44	ribosomal	herbicolin O, mcceh252, pantocin A	Pantoea agglomerans
BGC0000585.5	0.39	ribosomal	microcin C7	Escherichia coli
BGC0000812.3	0.31	other (other)	huperzine A	Shiraia sp. slf14
BGC0001735.5	0.25	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000704.3	0.21	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000703.4	0.20	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0002504.2	0.19	PKS	nocardiopsistin A, nocardiopsistin B, nocardiopsistin C	Nocardiopsis sp.
BGC0000705.3	0.19	saccharide	kanamycin	Streptomyces kanamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002317.2	0.44	ribosomal	herbicolin O, mcceh252, pantocin A	Pantoea agglomerans
BGC0000585.5	0.39	ribosomal	microcin C7	Escherichia coli
BGC0000812.3	0.31	other (other)	huperzine A	Shiraia sp. slf14
BGC0001735.5	0.25	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000704.3	0.21	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000703.4	0.20	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0002504.2	0.19	PKS	nocardiopsistin A, nocardiopsistin B, nocardiopsistin C	Nocardiopsis sp.
BGC0000705.3	0.19	saccharide	kanamycin	Streptomyces kanamyceticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.02 out of 29.51

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (7):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.13 out of 27.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.90 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.00 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.30 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.08 out of 33.14

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 0 - 96; Score: 92.7

TFBS definitions

Regulator	Description
DosR	Hypoxia stress response regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJK010000008.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 227,888 - 248,925 nt. (total: 21,038 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FHS34_RS23325: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: deformylase

FHS34_RS23315: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: cyclase

FHS34_RS23320: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.86	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000674.5	0.45	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000678.5	0.36	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000286.3	0.35	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0002012.4	0.34	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.86	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000674.5	0.45	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000678.5	0.36	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000286.3	0.35	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0002012.4	0.34	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

FHS34_RS23320: T1TS

Domain 1 (2 - 323): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 25.12 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.40 out of 27.18

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.44 out of 27.04

Confidence: medium

Additional weak hits (1):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
NrdR	Represses ribonucleotide reductase encoding genes

NZ_JACHJK010000008.1 - Region 3 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 253,319 - 274,461 nt. (total: 21,143 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

FHS34_RS23485: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

FHS34_RS23440: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000678.5	0.45	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000948.5	0.44	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001928.2	0.39	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000340.5	0.37	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000678.5	0.45	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000948.5	0.44	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001928.2	0.39	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000340.5	0.37	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

FHS34_RS23440: PT_FPPS_like

Domain 1 (86 - 378): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

Additional weak hits (6):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.16 out of 23.43

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.77 out of 32.38

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
ToxT	Regulator of MSHA biosynthesis

NZ_JACHJK010000009.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 88,025 - 114,712 nt. (total: 26,688 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FHS34_RS24745: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FHS34_RS24780: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

FHS34_RS24710: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

FHS34_RS24785: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase

FHS34_RS24795: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase synthetase

FHS34_RS24715: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

FHS34_RS24740: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.81	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000651.5	0.49	terpene	KS-505a	Streptomyces argenteolus
BGC0002283.2	0.48	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.81	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000651.5	0.49	terpene	KS-505a	Streptomyces argenteolus
BGC0002283.2	0.48	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

FHS34_RS24735: T2TS

Domain 1 (29 - 656): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

FHS34_RS24740: PT_FPPS_like

Domain 1 (81 - 377): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

FHS34_RS24750: PT_phytoene_like

Domain 1 (17 - 309): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

FHS34_RS24755: PT_phytoene_like

Domain 1 (15 - 278): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.44 out of 23.79

Confidence: medium

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.01 out of 27.04

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.08 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.27 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JACHJK010000010.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 22,918 nt. (total: 22,918 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

FHS34_RS26110: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Lyases: hydratase

FHS34_RS26115: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

FHS34_RS26080: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS26090: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS26095: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

FHS34_RS26100: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS26145: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Translocases: permease

FHS34_RS26140: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002274.2	0.63	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002193.2	0.62	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002274.2	0.63	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002193.2	0.62	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.35 out of 27.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 22918:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS26080: X

AMP-binding (111..521): X

nrpys: 4Me-Pro, Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHTFDVSAQEEYAGQGGEHNHYGPSETHLVTAH
Nearest Stachelhaus code(s):: 4Me-Pro or Pro DVQYGGHLVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS26090: X

AMP-binding (28..433): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MTTTHTIGPM-AFLIYGGCIQTYGTTESWGISVL
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

FHS34_RS26100: X

AMP-binding (9..410): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NVSLHTFGQLGVMGFSGGSYEGYGLTETSPVVAY
Nearest Stachelhaus code(s):: Leu DFLYFGGVVK (35% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_JACHJK010000010.1 - Region 2 - NAPAA,NRPS,RiPP-like,T3PKS,other,t3nrps-iterative,terpene

Download region GenBank file

Download region SVG

Location: 75,503 - 164,999 nt. (total: 89,497 nt) Show pHMM detection rules used

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
NAPAA: (AMP-binding and TIGR02353)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: Oxidation dehydrogenase oxidase oxygenase

FHS34_RS26345: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

FHS34_RS26350: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

FHS34_RS26395: Oxidation

MITE: MITE0000084Oxidation (identity: 72.00%)

FHS34_RS26430: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

FHS34_RS26505: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FHS34_RS26520: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: aminotransferase carbamoyltransferase methyltransferase

FHS34_RS26370: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

FHS34_RS26390: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

FHS34_RS26540: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

Hydrolases: deaminase esterase

FHS34_RS26425: thioesterase

smcogs: SMCOG1004: thioesterase

FHS34_RS26435: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: decarboxylase hydratase lyase

FHS34_RS26380: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

FHS34_RS26455: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

FHS34_RS26525: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase synthetase

FHS34_RS26375: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

FHS34_RS26410: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS26440: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

FHS34_RS26510: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS42735: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: permease transport transporter

FHS34_RS26360: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

FHS34_RS26485: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

FHS34_RS26535: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002458.3	2.48	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0001641.4	1.78	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.78	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	1.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	1.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	1.72	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	1.50	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	1.49	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002458.3	0.73	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

FHS34_RS26355: T2TS

Domain 1 (186 - 529): Type 2 terpene synthase

Subtype: unknown

FHS34_RS42735: PT_FPPS_like

Domain 1 (427 - 723): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.38 out of 25.88

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.29 out of 27.04

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (15):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.29 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.60 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.05 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.41 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.04 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.96 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.31 out of 21.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.88 out of 30.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.31 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.28 out of 27.04

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.02 out of 27.04

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.00 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 75502 - 164999:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 86369 - 127497:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 95582 - 163142:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS26320: X

AMP-binding (82..462): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HSAA-ELAAAGAVLVAGGARTVCGTAETSYGTFP
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

FHS34_RS26410: X

AMP-binding (34..444): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RPQLHSRTFAALEASSTFDFQIYGQSEVGPAAGR
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

FHS34_RS26425: X

AMP-binding (243..645): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQSQVSVTGELNAYGLTETSDDTNH
Nearest Stachelhaus code(s):: Dpr DIWQSTADDK (94% 8Å match); Asp DIWQSTADDK (82% 8Å match); dnmeProp or Dab DIWQSTADDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS26510: X

AMP-binding (74..460): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TTFPFGLGGLVPFTVSAGEINGIGATEMLHIFIS
Nearest Stachelhaus code(s):: D-Hiv GALHVVGSIK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
PsrA	Oleic acid responsive regulator

NZ_JACHJK010000010.1 - Region 3 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 258,635 - 289,004 nt. (total: 30,370 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FHS34_RS27025: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

FHS34_RS27065: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

FHS34_RS27020: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002692.2	0.51	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002633.2	0.50	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0000852.5	0.50	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.48	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.48	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.48	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.48	other (other)	ectoine	Methylophaga thalassica
BGC0002470.2	0.47	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002692.2	0.51	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002633.2	0.50	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0000852.5	0.50	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.48	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.48	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.48	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.48	other (other)	ectoine	Methylophaga thalassica
BGC0002470.2	0.47	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 25.90 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 26.37 out of 27.18

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.14 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

Additional weak hits (11):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.88 out of 19.26

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.65 out of 27.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.90 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.77 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.60 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.73 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NZ_JACHJK010000012.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 295,801 - 308,618 nt. (total: 12,818 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase

FHS34_RS30300: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: back translocase hydrolase

FHS34_RS30285: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

FHS34_RS30315: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002053.3	0.84	ribosomal	ulleungdin	Streptomyces sp.
BGC0001506.5	0.81	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001507.3	0.77	ribosomal	anantin C	Streptomyces olindensis
BGC0001539.4	0.72	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002074.2	0.71	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001307.3	0.69	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0001493.5	0.66	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001549.3	0.65	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.63	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001889.2	0.62	ribosomal	fusilassin	Thermobifida fusca YX

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002053.3	0.84	ribosomal	ulleungdin	Streptomyces sp.
BGC0001506.5	0.81	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001507.3	0.77	ribosomal	anantin C	Streptomyces olindensis
BGC0001539.4	0.72	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002074.2	0.71	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001307.3	0.69	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0001493.5	0.66	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001549.3	0.65	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.63	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001889.2	0.62	ribosomal	fusilassin	Thermobifida fusca YX

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for FHS34_RS30310

FHS34_RS30310

Leader:

MNENIEISNSEPYEPPTLVEVGEFNEDTL

Full core:

GFIGWGKDIFGHYGGGF

Putative macrolactam:

GFIGWGKD

antiSMASH-DB 4.0 matches for FHS34_RS30310

100.0%

NZ_JACHJK010000012.1:

Lassopeptides: FHS34_RS30310_lassopeptide

1

GFIGWGKDIFGHYGGGF

17

GFIGWGKDIFGHYGGGF

1

GFIGWGKDIFGHYGGGF

17

94.1%

NZ_AP024135.1and 1 other:

NZ_CP011799.1 Lassopeptides: QR97_RS33380_lassopeptide

Lassopeptides: K6K39_RS32965_lassopeptide

1

GFIGWGKDIFGHYGGGF

17

GFIGWGKDIFGHY GGF

1

GFIGWGKDIFGHYSGGF

17

88.2%

NZ_AP026073.1and 12 others:

NZ_BBNO01000002.1 Lassopeptides: TU31_RS37835_lassopeptideNZ_BNCA01000014.1 Lassopeptides: IE314_RS18405_lassopeptideNZ_CP007699.2 Lassopeptides: T261_RS42170_lassopeptideNZ_CP023691.1 Lassopeptides: CP981_RS21655_lassopeptideNZ_CP029042.1 Lassopeptides: DDE74_RS22295_lassopeptideNZ_CP029541.1 Lassopeptides: DKG71_RS23270_lassopeptideNZ_CP049782.1 Lassopeptides: G7Z12_RS16230_lassopeptideNZ_CP050976.1 Lassopeptides: HEP86_RS22775_lassopeptideNZ_CP102609.1 Lassopeptides: NUT86_RS23110_lassopeptideNZ_CP114202.1 Lassopeptides: STRLI_RS17465_lassopeptideNZ_CP114203.1 Lassopeptides: STRNI_RS19305_lassopeptideNZ_JAPKNL010000006.1 Lassopeptides: OSI21_RS10415_lassopeptide

Lassopeptides: HEK616_RS15635_lassopeptide

1

GFIGWGKDIFGHYGG

15

GFIGWGKDIFGHYGG

1

GFIGWGKDIFGHYGG

15

with 6 more sequence matches

88.2%

NZ_BMSE01000003.1and 2 others:

NZ_JACHGV010000006.1 Lassopeptides: HNR57_RS21035_lassopeptideNZ_KZ671966.1 Lassopeptides: BV882_RS06405_lassopeptide

Lassopeptides: IE153_RS10035_lassopeptide

1

GFIGWGKDIFGHYGGGF

17

GFIGWG DIFGHY GGF

1

GFIGWGNDIFGHYSGGF

17

82.4%

NZ_CP026121.1and 1 other:

NZ_CP075896.1 Lassopeptides: KJK29_RS31770_lassopeptide

Lassopeptides: C1703_RS06295_lassopeptide

1

GFIGWGKDIFGHYGGGF

17

GFIGWG DIFGHY G F

1

GFIGWGNDIFGHYSGDF

17

35.3%

NZ_CP086322.1:

Lassopeptides: K9S39_RS27710_lassopeptide

1

GFIGWGKDIFG

11

G +GW D FG

1

GLVGWHHDAFG

11

35.3%

NZ_JAAATY010000035.1:

Lassopeptides: GC106_RS39380_lassopeptide

3

IGWGKDIFGHYGG

15

+GW D F +GG

4

VGWVPDFFCTFGG

16

33.3%

NZ_CP092497.1:

Lassopeptides: allorf_4137077_4137205_lassopeptide

1

GFIGWGKDIFGHYG

14

G GWG+D F G

2

GKCGWGRDRFCRRG

15

16.1%

NZ_CP035758.1:

Lanthipeptides: EPA93_RS48405_lanthipeptide

5

WGKDIFGHY

13

WG GHY

7

WGNTCTGHY

15

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 21.84

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.31 out of 27.04

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

FHS34_RS30310 - Class II: Cleavage pHMM score: 3.50; RODEO score: 20; Monoisotopic mass: 1795.8 Da; Molecular weight: 1797.0 Da; Number of bridges: 0

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 75; Score: 81.9

TFBS definitions

Regulator	Description

NZ_JACHJK010000013.1 - Region 1 - betalactone,butyrolactone

Download region GenBank file

Download region SVG

Location: 18,631 - 48,253 nt. (total: 29,623 nt) Show pHMM detection rules used

butyrolactone: AfsA
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase phosphate reductase

FHS34_RS30455: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHS34_RS30470: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHS34_RS30520: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

FHS34_RS30540: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase kinase

FHS34_RS30440: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

FHS34_RS30485: aminotransferase

smcogs: SMCOG1019: aminotransferase

FHS34_RS30515: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

Ligases: ligase synthase

FHS34_RS30500: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS30535: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.95	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.77	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.59	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002276.2	0.47	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000894.4	0.34	other (other)	citrinin	Monascus aurantiacus
BGC0001928.2	0.34	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002578.2	0.33	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000671.3	0.32	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002404.2	0.31	other (other)	falcarindiol	Solanum lycopersicum
BGC0000234.5	0.27	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.71	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002578.2	0.52	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001928.2	0.51	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000894.4	0.50	other (other)	citrinin	Monascus aurantiacus
BGC0000671.3	0.50	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0000234.5	0.45	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.10 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.96 out of 20.97

Confidence: medium

Additional weak hits (12):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.56 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.86 out of 27.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.29 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.76 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.20 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.23 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.38 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.24 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.90 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.26 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JACHJK010000013.1 - Region 2 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 61,471 - 92,710 nt. (total: 31,240 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FHS34_RS30625: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase

FHS34_RS30715: aminotransferase

smcogs: SMCOG1019: aminotransferase

Isomerases: mutase

FHS34_RS30725: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001374.5	0.49	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000902.4	0.47	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000844.5	0.46	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001485.4	0.44	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000898.5	0.44	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0002007.2	0.43	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001223.5	0.43	other (other)	hydroxysporine	uncultured bacterium
BGC0002347.3	0.43	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001374.5	0.49	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000902.4	0.47	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000844.5	0.46	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001485.4	0.44	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000898.5	0.44	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0002007.2	0.43	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001223.5	0.43	other (other)	hydroxysporine	uncultured bacterium
BGC0002347.3	0.43	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.37 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.66 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.61 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.20 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.92 out of 30.22

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_JACHJK010000013.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 214,111 - 236,315 nt. (total: 22,205 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FHS34_RS31320: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: glucanase hydrolase peptidase

FHS34_RS31285: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

FHS34_RS31295: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

FHS34_RS31315: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

FHS34_RS31310: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.85	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001201.3	0.57	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000850.5	0.47	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002707.2	0.47	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0000849.4	0.45	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001986.3	0.45	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001223.5	0.43	other (other)	hydroxysporine	uncultured bacterium
BGC0002339.3	0.41	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.85	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001201.3	0.57	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000850.5	0.47	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002707.2	0.47	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0000849.4	0.45	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001986.3	0.45	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001223.5	0.43	other (other)	hydroxysporine	uncultured bacterium
BGC0002339.3	0.41	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

FHS34_RS31310: T1TS + T1TS

Domain 1 (2 - 325): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (326 - 694): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (1):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator

NZ_JACHJK010000013.1 - Region 4 - HR-T2PKS,NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 263,526 - 302,204 nt. (total: 38,679 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))
HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

FHS34_RS31520: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FHS34_RS31530: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

FHS34_RS31585: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

FHS34_RS31590: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHS34_RS31610: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: deacetylase

FHS34_RS31465: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Ligases: ligase synthase

FHS34_RS31600: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHS34_RS31605: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

FHS34_RS31615: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.79	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.75 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.98 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.42 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.70 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.15 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.57 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.86 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.78 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 263525 - 302204:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Phe - Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 271940 - 302204:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Phe - Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 275187 - 302204:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Phe - Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS31615: Phe - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (456..853): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LQQAFDAMFWEMTIVVAGEINAYGPTEATVCATM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1515..1920): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEASVDVTH
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJK010000014.1 - Region 1 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 12,814 - 97,297 nt. (total: 84,484 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FHS34_RS31725: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHS34_RS31735: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHS34_RS31860: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FHS34_RS31865: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

FHS34_RS31890: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase glycosyltransferase methyltransferase

FHS34_RS31680: Glycosylation

MITE: MITE0000033Glycosylation (identity: 61.60%)
smcogs: SMCOG1102: glycosyltransferase

FHS34_RS31690: methyltransferase

smcogs: SMCOG1089: methyltransferase

FHS34_RS31805: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

FHS34_RS42830: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: hydrolase

FHS34_RS31810: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Ligases: ligase synthase

FHS34_RS31740: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHS34_RS31745: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHS34_RS31750: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FHS34_RS31770: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS31790: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	1.35	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001244.3	1.28	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	1.27	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	1.27	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001833.4	1.09	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	1.09	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.09	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.09	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.07	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	1.04	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.09 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (18):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.96 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.04 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.24 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.93 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.07 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.09 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.49 out of 30.22

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.91 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.98 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.46 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.09 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.78 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 12813 - 97297:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (ccmal - Me-ccmal - ccmal) + (ohmal) + (ccmal) + (NH2) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 12813 - 83998:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (ccmal - Me-ccmal - ccmal) + (ohmal) + (ccmal) + (NH2) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 47922 - 89911:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - Me-ccmal - ccmal) + (ohmal) + (ccmal) + (NH2) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 51942 - 97297:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - Me-ccmal - ccmal) + (ohmal) + (ccmal) + (NH2) + (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS31735: mal

PKS_AT (553..848): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.5
inactive: 111.3
Methoxymalonyl-CoA: 53.0
Methylmalonyl-CoA: 43.8
Propionyl-CoA: 27.8
Acetyl-CoA: 25.7
Isobutyryl-CoA: 18.9
Benzoyl-CoA: 14.1
Ethylmalonyl-CoA: 8.1
2-Methylbutyryl-CoA: 5.9
CHC-CoA: 5.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

FHS34_RS31740: mal - mmal - mal

PKS_AT (558..838): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 205.8
inactive: 105.3
Methoxymalonyl-CoA: 62.0
Methylmalonyl-CoA: 51.2
Acetyl-CoA: 21.4
Propionyl-CoA: 18.2
Ethylmalonyl-CoA: 17.2
Benzoyl-CoA: 15.2
Isobutyryl-CoA: 14.2
CHC-CoA: 12.6
trans-1,2-CPDA: 6.1
2-Methylbutyryl-CoA: 2.7
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2225..2514): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 219.7
Ethylmalonyl-CoA: 210.9
Methoxymalonyl-CoA: 180.0
2-Methylbutyryl-CoA: 145.0
trans-1,2-CPDA: 135.9
Propionyl-CoA: 115.0
Malonyl-CoA: 105.6
CHC-CoA: 97.0
Isobutyryl-CoA: 83.6
Benzoyl-CoA: 67.9
fatty_acid: 40.5
Acetyl-CoA: 39.8
3-Methylbutyryl-CoA: 27.7
inactive: 25.8

PKS_AT (3919..4203): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 192.7
inactive: 94.1
Methoxymalonyl-CoA: 58.8
Methylmalonyl-CoA: 51.7
Propionyl-CoA: 27.7
Acetyl-CoA: 23.2
Isobutyryl-CoA: 17.8
Benzoyl-CoA: 14.0
CHC-CoA: 13.7
Ethylmalonyl-CoA: 12.7
fatty_acid: 9.9
2-Methylbutyryl-CoA: 5.0
trans-1,2-CPDA: 3.3
3-Methylbutyryl-CoA: 0.0

FHS34_RS31745: mal

PKS_AT (550..826): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 212.7
inactive: 116.5
Methoxymalonyl-CoA: 59.2
Methylmalonyl-CoA: 46.7
Isobutyryl-CoA: 30.3
Propionyl-CoA: 24.3
Ethylmalonyl-CoA: 19.3
Benzoyl-CoA: 18.0
Acetyl-CoA: 17.7
fatty_acid: 11.5
2-Methylbutyryl-CoA: 6.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
CHC-CoA: -2.0

FHS34_RS31750: mal

PKS_AT (557..838): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 182.2
inactive: 92.8
Methoxymalonyl-CoA: 56.3
Methylmalonyl-CoA: 50.5
Propionyl-CoA: 29.3
Ethylmalonyl-CoA: 19.1
Isobutyryl-CoA: 18.7
Benzoyl-CoA: 17.2
fatty_acid: 11.6
Acetyl-CoA: 11.3
trans-1,2-CPDA: 9.4
CHC-CoA: 9.2
2-Methylbutyryl-CoA: 8.4
3-Methylbutyryl-CoA: 0.0

FHS34_RS31770: NH2

CAL_domain (162..470): NH2

minowa: NH2

Prediction, score:

NH2: 151.1
Acetyl-CoA: 50.5
fatty_acid: 48.9
AHBA: 21.7
shikimic_acid: 14.9

FHS34_RS31790: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (925..1328): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVASGEHNLYGPTEASVDVSA
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism

NZ_JACHJK010000014.1 - Region 2 - CDPS

Download region GenBank file

Download region SVG

Location: 200,856 - 221,566 nt. (total: 20,711 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

FHS34_RS32350: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

FHS34_RS32390: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHS34_RS32415: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Hydrolases: hydrolase

FHS34_RS32435: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002725.3	0.78	ribosomal	prunipeptin	Streptomyces prunicolor NBRC 13075
BGC0001986.3	0.59	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001948.3	0.51	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001224.5	0.45	other (other)	reductasporine	uncultured bacterium
BGC0002482.2	0.39	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001529.5	0.38	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001374.5	0.37	other (other)	thienodolin	Streptomyces albogriseolus
BGC0002582.3	0.37	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002725.3	0.78	ribosomal	prunipeptin	Streptomyces prunicolor NBRC 13075
BGC0001986.3	0.59	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001948.3	0.51	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001224.5	0.45	other (other)	reductasporine	uncultured bacterium
BGC0002482.2	0.39	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001529.5	0.38	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001374.5	0.37	other (other)	thienodolin	Streptomyces albogriseolus
BGC0002582.3	0.37	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.28 out of 29.51

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (6):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.68 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.01 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.29 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.37 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.73 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.03 out of 20.97

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DosR	Hypoxia stress response regulator
OsdR	Development and stress management regulator

NZ_JACHJK010000015.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 84,189 - 94,593 nt. (total: 10,405 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

FHS34_RS33095: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

FHS34_RS33105: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

FHS34_RS33120: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

Additional weak hits (6):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.27 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.79 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.00 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.79 out of 28.19

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.03 out of 30.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJK010000016.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 95,644 - 150,850 nt. (total: 55,207 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

FHS34_RS34545: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: acylase methyltransferase

FHS34_RS34415: methyltransferase

smcogs: SMCOG1089: methyltransferase

FHS34_RS34425: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

FHS34_RS34440: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

FHS34_RS34445: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase hydrolase

FHS34_RS34430: thioesterase

smcogs: SMCOG1004: thioesterase

FHS34_RS34530: isochorismatase

smcogs: SMCOG1027: isochorismatase

Ligases: ligase

FHS34_RS34435: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

FHS34_RS34570: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.65	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.02 out of 23.79

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.64 out of 25.31

Confidence: medium

Additional weak hits (7):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.35 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.32 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.90 out of 18.57

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 95643 - 150850:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS34435: X

AMP-binding (469..864): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SAQAFDASVFELVMVLGGEFNVYGHTETSIWATV
Nearest Stachelhaus code(s):: Gly DIAQVGVIWK (62% 8Å match); Ph-Ser or Phe DAFTVAAIWK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

FHS34_RS34440: mal

PKS_AT (564..861): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.7
inactive: 121.6
Methoxymalonyl-CoA: 94.9
Methylmalonyl-CoA: 90.9
Ethylmalonyl-CoA: 63.0
Propionyl-CoA: 61.3
Isobutyryl-CoA: 53.7
2-Methylbutyryl-CoA: 49.0
CHC-CoA: 41.2
Benzoyl-CoA: 38.3
trans-1,2-CPDA: 31.8
fatty_acid: 24.1
Acetyl-CoA: 12.1
3-Methylbutyryl-CoA: 6.7

FHS34_RS34445: mmal - pk

PKS_AT (613..903): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Methylmalonyl-CoA: 75.0%; Ethylmalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 139.7
Methoxymalonyl-CoA: 118.8
Ethylmalonyl-CoA: 109.9
Isobutyryl-CoA: 96.6
Malonyl-CoA: 93.1
Benzoyl-CoA: 86.7
2-Methylbutyryl-CoA: 81.0
Propionyl-CoA: 80.1
Acetyl-CoA: 76.2
trans-1,2-CPDA: 60.0
CHC-CoA: 52.1
3-Methylbutyryl-CoA: 48.9
fatty_acid: 38.2
inactive: 30.5

PKS_AT (1052..1348): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; Methylmalonyl-CoA: 58.3%; CE-Malonyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 101.4
Methoxymalonyl-CoA: 92.6
Malonyl-CoA: 90.9
Isobutyryl-CoA: 72.4
Ethylmalonyl-CoA: 62.3
Propionyl-CoA: 51.1
CHC-CoA: 41.7
inactive: 37.0
Acetyl-CoA: 33.1
2-Methylbutyryl-CoA: 31.3
trans-1,2-CPDA: 27.4
fatty_acid: 25.3
Benzoyl-CoA: 19.9
3-Methylbutyryl-CoA: 9.7

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_JACHJK010000019.1 - Region 1 - bottromycin

Download region GenBank file

Download region SVG

Location: 68,522 - 89,295 nt. (total: 20,774 nt) Show pHMM detection rules used

bottromycin: botH

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

FHS34_RS36675: Methylation

MITE: MITE0000001Methylation (identity: 86.70%)
smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

FHS34_RS36650: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002509.3	0.33	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0001441.5	0.31	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0001440.5	0.31	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0001904.2	0.29	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria
BGC0000565.5	0.29	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000213.4	0.25	PKS	colabomycin E	Streptomyces aureus
BGC0001967.4	0.25	NRPS, PKS	acyldepsipeptide 1	Streptomyces hawaiiensis
BGC0002362.3	0.25	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001022.5	0.24	NRPS, PKS	myxalamid, myxalamid A, myxalamid C, myxalamid D	Stigmatella aurantiaca
BGC0001169.5	0.23	PKS	piericidin A1	Streptomyces sp. SCSIO 03032

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002509.3	0.33	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0001441.5	0.31	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0001440.5	0.31	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0001904.2	0.29	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria
BGC0000565.5	0.29	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000213.4	0.25	PKS	colabomycin E	Streptomyces aureus
BGC0001967.4	0.25	NRPS, PKS	acyldepsipeptide 1	Streptomyces hawaiiensis
BGC0002362.3	0.25	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001022.5	0.24	NRPS, PKS	myxalamid, myxalamid A, myxalamid C, myxalamid D	Stigmatella aurantiaca
BGC0001169.5	0.23	PKS	piericidin A1	Streptomyces sp. SCSIO 03032

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.24 out of 26.85

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.47 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.83 out of 20.97

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (4):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.88 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.44 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.98 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism

NZ_JACHJK010000019.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 95,165 - 116,235 nt. (total: 21,071 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FHS34_RS36750: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

FHS34_RS36760: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthetase

FHS34_RS36770: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001775.3	0.39	terpene	sespendole	Cordana terrestris
BGC0000846.5	0.39	other (other)	tabtoxin	Pseudomonas syringae
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0000313.4	0.36	NRPS	beauvericin	Beauveria bassiana
BGC0002216.3	0.36	terpene	HEx-tc1 terpene	Trichoderma virens Gv29-8
BGC0001456.3	0.36	terpene	isorenieratene	Streptomyces argillaceus
BGC0000894.4	0.35	other (other)	citrinin	Monascus aurantiacus
BGC0002229.2	0.35	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0001227.3	0.34	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000594.5	0.34	ribosomal	microviridin K	Planktothrix agardhii NIVA-CYA 126/8

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001775.3	0.39	terpene	sespendole	Cordana terrestris
BGC0000846.5	0.39	other (other)	tabtoxin	Pseudomonas syringae
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0000313.4	0.36	NRPS	beauvericin	Beauveria bassiana
BGC0002216.3	0.36	terpene	HEx-tc1 terpene	Trichoderma virens Gv29-8
BGC0001456.3	0.36	terpene	isorenieratene	Streptomyces argillaceus
BGC0000894.4	0.35	other (other)	citrinin	Monascus aurantiacus
BGC0002229.2	0.35	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0001227.3	0.34	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000594.5	0.34	ribosomal	microviridin K	Planktothrix agardhii NIVA-CYA 126/8

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

FHS34_RS36770: PT_FPPS_like

Domain 1 (48 - 335): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.91 out of 23.43

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 23.43

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.60 out of 23.43

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.20 out of 28.19

Confidence: medium

Additional weak hits (7):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.75 out of 23.43

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.15 out of 30.22

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.75 out of 23.43

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.57 out of 26.85

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.91 out of 20.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_JACHJK010000020.1 - Region 1 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 39,923 - 116,946 nt. (total: 77,024 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FHS34_RS37065: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FHS34_RS37155: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

FHS34_RS37275: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: acetyltransferase

FHS34_RS37215: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

FHS34_RS37255: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

FHS34_RS37210: isochorismatase

smcogs: SMCOG1027: isochorismatase

Ligases: ligase

FHS34_RS37130: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS37135: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FHS34_RS37260: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS37265: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS37280: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FHS34_RS43910: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.65	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.64	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.75	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.68	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.79 out of 25.75

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

Additional weak hits (10):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.41 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.60 out of 24.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.53 out of 26.85

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.80 out of 28.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 30.98

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.82 out of 20.01

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.87 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 39922 - 116946:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - Cys) + (X) + (NMe-Asn) + (Asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 39922 - 94286:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (NMe-Asn) + (Asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 84181 - 116946:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS37130: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (475..894): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWSSFDLTVTSLKLVVGGEFNEYGPTETAVGVCV
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS37135: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (521..922): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSAKLVVGGEVNEYGPTETAVACAA
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

FHS34_RS43910: X

AMP-binding (473..901): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LATGFDITAFEGSLFVVGEHNGYGPSENATFSTT
Nearest Stachelhaus code(s):: Val DAFFFGGTFK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

FHS34_RS37260: Acetyl-CoA - Cys

Search NORINE for peptide: strict or relaxed

CAL_domain (50..500): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 32.2
NH2: 9.7
AHBA: 7.1
shikimic_acid: 0.0
fatty_acid: 0.0

AMP-binding (1191..1597): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVSFDLSVFDGNSLWSGDVSLGGATEAAIWSIC
Nearest Stachelhaus code(s):: Cys DLFNLSLIWK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS37265: X

AMP-binding (30..429): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LATNAALACPGGSLQIGSATRWFGTTEGFLAHTR
Nearest Stachelhaus code(s):: COOH-Qui ALPTQGWLTK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

FHS34_RS37280: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (450..793): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
MatP	Cell cycle regulator
MexT	Global virulence regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JACHJK010000021.1 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 67,930 nt. (total: 67,930 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxidoreductase oxygenase reductase

FHS34_RS37300: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHS34_RS37310: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

FHS34_RS37335: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

FHS34_RS37360: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

FHS34_RS37385: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase halogenase methyltransferase

FHS34_RS37305: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

FHS34_RS37315: flavin-dependent trp 6 7 halogenase

halogenases: flavin-dependent trp 6 7 halogenase
MITE: MITE0000029Halogenation (identity: 68.20%)
smcogs: SMCOG1119: halogenase

FHS34_RS37345: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase hydrolase

FHS34_RS37290: thioesterase

smcogs: SMCOG1004: thioesterase

FHS34_RS37320: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

FHS34_RS37430: thioesterase

smcogs: SMCOG1004: thioesterase

FHS34_RS37470: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase

FHS34_RS37330: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS37380: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS37410: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS37435: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS43620: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FHS34_RS44250: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	1.48	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	1.43	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.43	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	1.40	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	1.40	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	1.38	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	1.35	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	1.34	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	1.31	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	1.31	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000339.5	0.77	NRPS	echinomycin	Streptomyces lasaliensis
BGC0001132.4	0.74	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.74	NRPS	enniatin	Fusarium equiseti
BGC0001249.5	0.74	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 26.53 out of 30.22

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (10):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.52 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.54 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.12 out of 28.14

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.48 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.12 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.01 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.25 out of 20.01

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.95 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 67930:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ser - Ala) + (NMe-Cys - NMe-Val) + (Trp) + (Val) + (NMe-X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 34096:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Cys - NMe-Val) + (Trp) + (Val) + (NMe-X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 0 - 24175:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (NMe-X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 5770 - 47522:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ser - Ala) + (NMe-Cys - NMe-Val) + (Trp) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 10714 - 67930:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ser - Ala) + (NMe-Cys - NMe-Val) + (Trp) + (Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS37285: X

AMP-binding (147..545): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: -AWSFDASVYEPWAATGGDVNIYGPTETTVNATT
Nearest Stachelhaus code(s):: Val DAYWWGGVFK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

FHS34_RS37330: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (11..409): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LGAAFDAATLEGWLLAGGDINGYGPTENTTFTCC
Nearest Stachelhaus code(s):: Val DALWLGGTFK (88% 8Å match); bOH-Val DALWLGGTFK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS37380: Trp

Search NORINE for peptide: strict or relaxed

AMP-binding (4..400): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MTQAFDAAFWDLVLMSTGDFNGYGPTEVTVGATI
Nearest Stachelhaus code(s):: Trp DAWVMTGVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS43620: Cys - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (477..880): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: LWCTFDLSVFDGDSYLSGDVSLGGATEATVWSNY
Nearest Stachelhaus code(s):: Cys DLFDFSLVWK (97% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1935..2318): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDGSFDASTYEVWLWAGGDVNGYGPTETTTFASR
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS44250: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (14..395): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LGMAFDIAALELQAISTGETNLYGPTETTVYATA
Nearest Stachelhaus code(s):: Ala DILQITLVYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS37410: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (474..867): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVCSGEHNLYGPTEAAVDVTE
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS37435: X

AMP-binding (32..429): X

nrpys: COOH-Qui

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VACNAALACPGGTVQVGSAQRWYGISEGLLTYTR
Nearest Stachelhaus code(s):: COOH-Qui ALPTQGWLTK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
ClgR	Caseinolytic protease gene regulator

NZ_JACHJK010000023.1 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 37,869 nt. (total: 37,869 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase protease

FHS34_RS38145: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

FHS34_RS38225: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

FHS34_RS38235: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

FHS34_RS38245: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: dehydratase

FHS34_RS38175: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

FHS34_RS38180: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS38185: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS38190: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS38195: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002051.2	0.96	NRPS	antipain	Streptomyces sp.
BGC0001249.5	0.83	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002051.2	0.77	NRPS	antipain	Streptomyces sp.
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (16):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.94 out of 33.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.47 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.41 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.05 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.31 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.95 out of 32.74

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.27 out of 30.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.73 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.78 out of 23.43

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.76 out of 24.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.40 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.89 out of 29.65

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.34 out of 26.12

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.65 out of 30.98

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.96 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 37869:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (Phe) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 32781:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (Phe) + (Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS38180: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (33..420): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LAPSFDASTFEVFFVVGGEVNGYGPTETTTFATA
Nearest Stachelhaus code(s):: Val DAFFVGGTFK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS38185: Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (51..456): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AWYIFDPHLLEAVAVVGGDHNAYGPAEATVVTTT
Nearest Stachelhaus code(s):: Phe DPLVVGAVVK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS38190: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (462..852): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HATAFDVALEEPNLVLGGELNVYGVTEAAISSTV
Nearest Stachelhaus code(s):: Arg DVENVGVISK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_JACHJK010000025.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 25,145 - 37,073 nt. (total: 11,929 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FHS34_RS39075: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.41	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000468.5	0.40	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.40	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.39	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.37	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000598.5	0.35	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001753.3	0.34	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000896.5	0.29	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0001148.5	0.28	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0001561.4	0.28	NRPS	curacomycin	Streptomyces curacoi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.41	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000468.5	0.40	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.40	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.39	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.37	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000598.5	0.35	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001753.3	0.34	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000896.5	0.29	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0001148.5	0.28	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0001561.4	0.28	NRPS	curacomycin	Streptomyces curacoi

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.18 out of 23.79

Confidence: medium

Additional weak hits (3):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.38 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.32 out of 29.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JACHJK010000026.1 - Region 1 - NRPS,PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 56,989 nt. (total: 56,989 nt) Show pHMM detection rules used

Region on contig edge.

PKS-like: (t2pks2 or ksIII)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FHS34_RS39270: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHS34_RS39280: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase aminotransferase

FHS34_RS39320: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

FHS34_RS39420: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: deaminase hydrolase

FHS34_RS39310: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

FHS34_RS39365: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: decarboxylase lyase

FHS34_RS39330: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

FHS34_RS39355: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

FHS34_RS39335: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

FHS34_RS39370: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

FHS34_RS39375: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS39380: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: permease

FHS34_RS39325: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.82	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.82	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.79	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.78	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.78	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002071.2	0.72	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001133.4	0.69	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002071.2	0.69	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.60 out of 23.79

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.77 out of 29.72

Confidence: medium

Additional weak hits (11):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.42 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.53 out of 30.25

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.17 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.89 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.34 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 56989:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - Ser) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 40984:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - Ser) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 9301 - 56989:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - Ser) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS39375: Ser - X

Search NORINE for peptide: strict or relaxed

AMP-binding (261..660): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFASGEVNLYGPTEAAVDVTH
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match); Ala or Ser DVWHFSLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1322..1731): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISVWQSEVLVTGEVNAYGPTETSDDVTH
Nearest Stachelhaus code(s):: Dpr DIWELTADDK (94% 8Å match); Dab DIWELTADDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS39380: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (14..407): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDTAFDAATFEGWVLTGGDVNGYGPTENTTFTTT
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C

NZ_JACHJK010000032.1 - Region 1 - T1PKS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 1 - 38,277 nt. (total: 38,277 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FHS34_RS40770: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FHS34_RS40775: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase

FHS34_RS40720: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

FHS34_RS40760: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

FHS34_RS40815: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase esterase

FHS34_RS40765: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

FHS34_RS40785: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: decarboxylase

FHS34_RS40740: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

FHS34_RS40725: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

FHS34_RS40745: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FHS34_RS40750: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.84	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.81	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002517.3	0.77	PKS	tripartilactam, niizalactam C	Streptomyces sp.
BGC0001770.4	0.62	PKS	sceliphrolactam	Streptomyces sp. SD85
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002154.2	0.59	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.72	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002517.3	0.71	PKS	tripartilactam, niizalactam C	Streptomyces sp.
BGC0001770.4	0.65	PKS	sceliphrolactam	Streptomyces sp. SD85
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.18 out of 23.79

Confidence: medium

Additional weak hits (3):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.02 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.94 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.71 out of 29.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 38277:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal) + (Me-ccmal) + (mal)
Non-colinear ordering:: FHS34_RS40725 + FHS34_RS40720 + FHS34_RS40815

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS40720: mmal

PKS_AT (562..857): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 226.3
Ethylmalonyl-CoA: 213.4
Methoxymalonyl-CoA: 189.2
2-Methylbutyryl-CoA: 144.5
trans-1,2-CPDA: 141.2
Malonyl-CoA: 113.1
Propionyl-CoA: 112.1
CHC-CoA: 108.1
Isobutyryl-CoA: 93.5
Benzoyl-CoA: 80.0
Acetyl-CoA: 58.3
3-Methylbutyryl-CoA: 55.6
fatty_acid: 40.9
inactive: 36.6

FHS34_RS40725: mal - mal

PKS_AT (749..1043): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 200.8
inactive: 104.7
Methoxymalonyl-CoA: 67.6
Methylmalonyl-CoA: 57.0
Isobutyryl-CoA: 38.2
CHC-CoA: 23.8
Propionyl-CoA: 23.6
fatty_acid: 15.5
Ethylmalonyl-CoA: 14.4
Acetyl-CoA: 14.2
Benzoyl-CoA: 14.1
trans-1,2-CPDA: 6.8
2-Methylbutyryl-CoA: 4.2
3-Methylbutyryl-CoA: 0.0

PKS_AT (2438..2726): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 185.4
inactive: 97.4
Methoxymalonyl-CoA: 67.4
Methylmalonyl-CoA: 56.8
Isobutyryl-CoA: 31.4
Propionyl-CoA: 29.3
Acetyl-CoA: 21.9
Ethylmalonyl-CoA: 20.8
fatty_acid: 16.5
Benzoyl-CoA: 11.5
CHC-CoA: 5.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

FHS34_RS40745: X

AMP-binding (23..415): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAIFWDYGLYKLPITNTGAVIQFGQTECKRVSVL
Nearest Stachelhaus code(s):: 3S-Abu DYYPTTQRIK (91% 8Å match); Asp DYYPTTMRVK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

FHS34_RS40750: X

AMP-binding (12..410): X

nrpys: bMe-Asp, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YLLFFDCAMFDCFSFFAGEENLYGPTELTITVAA
Nearest Stachelhaus code(s):: bMe-Asp DCFFFALITK (94% 8Å match); Ala DCFFFALITK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

FHS34_RS40760: pk

PKS_AT (30..281): pk

ATSignature: (unknown)

No matches above 50%

minowa: CHC-CoA

Prediction, score:

CHC-CoA: 11.3
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

FHS34_RS40815: mal

PKS_AT (144..421): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.9
inactive: 99.2
Methoxymalonyl-CoA: 67.4
Methylmalonyl-CoA: 55.8
Isobutyryl-CoA: 36.4
Propionyl-CoA: 28.0
Benzoyl-CoA: 16.0
fatty_acid: 12.1
CHC-CoA: 7.4
2-Methylbutyryl-CoA: 5.7
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -0.4
Acetyl-CoA: -0.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JACHJK010000043.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 2,653 nt. (total: 2,653 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

FHS34_RS43680: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000444.5	0.50	NRPS	thaxtomin A	Streptomyces turgidiscabies Car8
BGC0001050.5	0.50	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001657.4	0.47	NRPS	lysocin	Lysobacter sp. RH2180-5
BGC0000461.5	0.47	NRPS	WAP-8294A2	Lysobacter enzymogenes
BGC0002089.2	0.47	NRPS	thaxtomin D, thaxtomin A, thaxtomin C, thaxtomin B	Streptomyces scabiei 87.22
BGC0001425.4	0.46	NRPS, PKS	myxochromide A	Myxococcus xanthus DK 1622
BGC0001426.4	0.46	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001417.4	0.46	NRPS, PKS	myxochromide D	Cystobacterineae bacterium
BGC0001428.4	0.46	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001427.4	0.46	NRPS, PKS	myxochromide A	Myxococcus xanthus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000444.5	0.50	NRPS	thaxtomin A	Streptomyces turgidiscabies Car8
BGC0001050.5	0.50	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001657.4	0.47	NRPS	lysocin	Lysobacter sp. RH2180-5
BGC0000461.5	0.47	NRPS	WAP-8294A2	Lysobacter enzymogenes
BGC0002089.2	0.47	NRPS	thaxtomin D, thaxtomin A, thaxtomin C, thaxtomin B	Streptomyces scabiei 87.22
BGC0001425.4	0.46	NRPS, PKS	myxochromide A	Myxococcus xanthus DK 1622
BGC0001426.4	0.46	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001417.4	0.46	NRPS, PKS	myxochromide D	Cystobacterineae bacterium
BGC0001428.4	0.46	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001427.4	0.46	NRPS, PKS	myxochromide A	Myxococcus xanthus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NZ_JACHJK010000045.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 2,046 nt. (total: 2,046 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

FHS34_RS41785: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.65	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002171.2	0.61	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.61	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.65	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002171.2	0.61	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.61	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 2046:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FHS34_RS41785: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (114..500): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: CELTFDVSVFEASTVLAGEFNAYGQTESFYATTT
Nearest Stachelhaus code(s):: Leu DVFSVAAYAK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_JACHJK010000046.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,030 nt. (total: 2,030 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

FHS34_RS41790: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NZ_JACHJK010000049.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 1,855 nt. (total: 1,855 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

FHS34_RS41810: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.61	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.59	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.61	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.59	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

FHS34_RS41810: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (222..613): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFEASAVLAGETNIYGPTEATVYATM
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

NZ_JACHJK010000051.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 1,502 nt. (total: 1,502 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

FHS34_RS41820: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000393.5	0.55	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0002660.2	0.51	NRPS	pentacitidin A, pentacitidin B	Chitinophaga eiseniae
BGC0001131.5	0.47	NRPS	ambactin	Xenorhabdus miraniensis
BGC0002424.3	0.46	NRPS	saccharochelin A, saccharochelin B, saccharochelin C, saccharochelin D, saccharochelin E, saccharochelin F, saccharochelin G, saccharochelin H	Saccharothrix sp.
BGC0001050.5	0.45	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0000423.5	0.44	NRPS	scabichelin	Streptomyces scabiei 87.22
BGC0000353.5	0.44	NRPS	tacrolimus	Streptomyces sp. MA6548

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000393.5	0.55	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0002660.2	0.51	NRPS	pentacitidin A, pentacitidin B	Chitinophaga eiseniae
BGC0001131.5	0.47	NRPS	ambactin	Xenorhabdus miraniensis
BGC0002424.3	0.46	NRPS	saccharochelin A, saccharochelin B, saccharochelin C, saccharochelin D, saccharochelin E, saccharochelin F, saccharochelin G, saccharochelin H	Saccharothrix sp.
BGC0001050.5	0.45	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0000423.5	0.44	NRPS	scabichelin	Streptomyces scabiei 87.22
BGC0000353.5	0.44	NRPS	tacrolimus	Streptomyces sp. MA6548

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains