GCF_013363995.1 - 25 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JABWGO010000010.1 (Nonomuraea rhodomycinica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	RRE-containing	185,190	206,251

NZ_JABWGO010000013.1 (Nonomuraea rhodomycinica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	NRPS	53,419	103,581

NZ_JABWGO010000014.1 (Nonomuraea rhodomycinica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	lanthipeptide-class-iv	62,776	85,442

NZ_JABWGO010000015.1 (Nonomuraea rhodomycinica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	other	147,703	174,826	Low	phosphoramidon	other:other

NZ_JABWGO010000016.1 (Nonomuraea rhodomycinica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	NI-siderophore	107,910	139,116

NZ_JABWGO010000017.1 (Nonomuraea rhodomycinica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	terpene,lanthipeptide-class-iii	29,225	70,183	Medium	catenulipeptin	ribosomal:RiPP:Lanthipeptide

NZ_JABWGO010000018.1 (Nonomuraea rhodomycinica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	hserlactone	1	18,026

NZ_JABWGO010000001.1 (Nonomuraea rhodomycinica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	crocagin,t3nrps-iterative	169,996	215,059
Region 11.2	other,T2PKS,PKS-like	1,209,576	1,290,609	Low	cytorhodin	PKS
Region 11.3	terpene-precursor	1,591,127	1,612,194
Region 11.4	terpene	1,744,559	1,765,566
Region 11.5	hydrogen-cyanide	2,308,810	2,321,950	Low	aborycin	ribosomal:RiPP

NZ_JABWGO010000002.1 (Nonomuraea rhodomycinica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 22.1	NRPS	786,205	837,747
Region 22.2	azole-containing-RiPP,RRE-containing	956,845	982,552

NZ_JABWGO010000003.1 (Nonomuraea rhodomycinica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 27.1	NI-siderophore	339,095	372,231

NZ_JABWGO010000004.1 (Nonomuraea rhodomycinica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 28.1	HR-T2PKS,T1PKS	44,687	158,123	Low	epemicin B/epemicin A	PKS:Type I
Region 28.2	other	181,354	222,280
Region 28.3	NRPS,T1PKS	451,630	505,929

NZ_JABWGO010000005.1 (Nonomuraea rhodomycinica)

Region	Type	From	To
Region 29.1	T1PKS,terpene	71,913	121,063
Region 29.2	terpene	202,878	223,798
Region 29.3	T3PKS	452,377	493,396

NZ_JABWGO010000007.1 (Nonomuraea rhodomycinica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 31.1	terpene	185,588	211,781	High	geosmin	terpene:Sesquiterpene
Region 31.2	T3PKS	255,933	296,985	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III

NZ_JABWGO010000009.1 (Nonomuraea rhodomycinica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 33.1	lanthipeptide-class-iv	120,362	142,995
Region 33.2	lanthipeptide-class-iv	378,881	401,499

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	RRE-containing	185,190	206,251
Region 4.1	NRPS	53,419	103,581
Region 5.1	lanthipeptide-class-iv	62,776	85,442
Region 6.1	other	147,703	174,826	Low	phosphoramidon	other:other
Region 7.1	NI-siderophore	107,910	139,116
Region 8.1	terpene,lanthipeptide-class-iii	29,225	70,183	Medium	catenulipeptin	ribosomal:RiPP:Lanthipeptide
Region 9.1	hserlactone	1	18,026
Region 11.1	crocagin,t3nrps-iterative	169,996	215,059
Region 11.2	other,T2PKS,PKS-like	1,209,576	1,290,609	Low	cytorhodin	PKS
Region 11.3	terpene-precursor	1,591,127	1,612,194
Region 11.4	terpene	1,744,559	1,765,566
Region 11.5	hydrogen-cyanide	2,308,810	2,321,950	Low	aborycin	ribosomal:RiPP
Region 22.1	NRPS	786,205	837,747
Region 22.2	azole-containing-RiPP,RRE-containing	956,845	982,552
Region 27.1	NI-siderophore	339,095	372,231
Region 28.1	HR-T2PKS,T1PKS	44,687	158,123	Low	epemicin B/epemicin A	PKS:Type I
Region 28.2	other	181,354	222,280
Region 28.3	NRPS,T1PKS	451,630	505,929
Region 29.1	T1PKS,terpene	71,913	121,063
Region 29.2	terpene	202,878	223,798
Region 29.3	T3PKS	452,377	493,396
Region 31.1	terpene	185,588	211,781	High	geosmin	terpene:Sesquiterpene
Region 31.2	T3PKS	255,933	296,985	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 33.1	lanthipeptide-class-iv	120,362	142,995
Region 33.2	lanthipeptide-class-iv	378,881	401,499

No secondary metabolite regions were found in these records:: NZ_JABWGO010000011.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000012.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000019.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000020.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000021.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000022.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000023.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000024.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000025.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000026.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000027.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000028.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000029.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000030.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000031.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000032.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000033.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000006.1 (Nonomuraea rhodomycinica); NZ_JABWGO010000008.1 (Nonomuraea rhodomycinica)

Compact view

NZ_JABWGO010000010.1 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 185,190 - 206,251 nt. (total: 21,062 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

HT134_RS32890: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase

HT134_RS32990: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000585.5	0.48	ribosomal	microcin C7	Escherichia coli
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002317.2	0.45	ribosomal	herbicolin O, mcceh252, pantocin A	Pantoea agglomerans
BGC0001267.3	0.44	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0001364.3	0.44	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000285.5	0.39	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001483.4	0.38	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001841.2	0.37	NRPS, PKS	detoxin P1, detoxin P2, detoxin P3	Amycolatopsis jejuensis
BGC0001043.4	0.37	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000585.5	0.48	ribosomal	microcin C7	Escherichia coli
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002317.2	0.45	ribosomal	herbicolin O, mcceh252, pantocin A	Pantoea agglomerans
BGC0001267.3	0.44	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0001364.3	0.44	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000285.5	0.39	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001483.4	0.38	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001841.2	0.37	NRPS, PKS	detoxin P1, detoxin P2, detoxin P3	Amycolatopsis jejuensis
BGC0001043.4	0.37	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (9):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.45 out of 21.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.48 out of 32.74

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.15 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.74 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.65 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.90 out of 24.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.48 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.32 out of 33.14

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 0 - 89; Score: 53.0

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JABWGO010000013.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 53,419 - 103,581 nt. (total: 50,163 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

HT134_RS37350: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase phosphatase

HT134_RS37480: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

HT134_RS37540: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: ligase synthase

HT134_RS37375: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

HT134_RS37450: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HT134_RS37455: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.24 out of 27.55

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.42 out of 27.18

Confidence: medium

Additional weak hits (14):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.97 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.96 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.70 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.96 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.72 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.63 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.30 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.14 out of 21.84

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.79 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.38 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.19 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 53418 - 103581:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

HT134_RS37450: X - X

AMP-binding (13..398): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHETFDPSVTQLYGMAGGEVNVYGPTECTVTCTS
Nearest Stachelhaus code(s):: bMe-Asp DLTKMGVVNK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1041..1431): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDVFGFDVTAVSIGEWNSYGPTETTVYSTM
Nearest Stachelhaus code(s):: Ala DVFSVALVYK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

HT134_RS37455: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (479..871): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YAVSSDLVMTCGKMILAGEQIHCGPTETTVSVLS
Nearest Stachelhaus code(s):: Asp DLTKIGHVGK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
GnfM	Regulator of nitrogen-fixation genes
NrdR	Represses ribonucleotide reductase encoding genes
VqsM	Regulator of quorum-sensing signalling systems

NZ_JABWGO010000014.1 - Region 1 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 62,776 - 85,442 nt. (total: 22,667 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

HT134_RS38950: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000563.4	0.53	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.52	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.48	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.46	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000527.5	0.42	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000518.3	0.42	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0000584.5	0.41	ribosomal	colicin V	Escherichia coli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000563.4	0.53	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.52	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.48	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.46	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000527.5	0.42	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000518.3	0.42	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0000584.5	0.41	ribosomal	colicin V	Escherichia coli

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

Additional weak hits (3):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.14 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.08 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.42 out of 29.65

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JABWGO010000015.1 - Region 1 - other

Download region GenBank file

Download region SVG

Location: 147,703 - 174,826 nt. (total: 27,124 nt) Show pHMM detection rules used

Region on contig edge.

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

HT134_RS40505: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: hydrolase

HT134_RS47375: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: lyase

HT134_RS40540: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002573.2	0.59	other (other)	phosphoramidon	Streptomyces mozunensis
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0001184.4	0.43	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001294.5	0.41	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001810.3	0.41	PKS	trehangelin	Polymorphospora rubra
BGC0002064.2	0.39	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001610.5	0.36	other (other)	gougerotin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0002185.2	0.36	PKS	gregatin A	Penicillium sp.
BGC0002246.3	0.36	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0001954.2	0.36	NRPS, PKS	wortmanamide A, wortmanamide B	Talaromyces wortmannii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002573.2	0.59	other (other)	phosphoramidon	Streptomyces mozunensis
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0001184.4	0.43	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001294.5	0.41	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001810.3	0.41	PKS	trehangelin	Polymorphospora rubra
BGC0002064.2	0.39	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001610.5	0.36	other (other)	gougerotin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0002185.2	0.36	PKS	gregatin A	Penicillium sp.
BGC0002246.3	0.36	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0001954.2	0.36	NRPS, PKS	wortmanamide A, wortmanamide B	Talaromyces wortmannii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 23.43

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.69 out of 19.26

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.52 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.03 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.34 out of 29.51

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.08 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_JABWGO010000016.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 107,910 - 139,116 nt. (total: 31,207 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

HT134_RS41215: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

HT134_RS41180: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

HT134_RS41210: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: decarboxylase

HT134_RS41145: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.66	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000947.5	0.49	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002633.2	0.45	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002683.2	0.43	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000943.5	0.42	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002470.2	0.40	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0002584.2	0.37	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002466.3	0.37	NRPS	peucechelin	Streptomyces peucetius subsp. caesius ATCC 27952

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.66	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000947.5	0.49	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002633.2	0.45	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002683.2	0.43	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000943.5	0.42	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002470.2	0.40	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0002584.2	0.37	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002466.3	0.37	NRPS	peucechelin	Streptomyces peucetius subsp. caesius ATCC 27952

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.62 out of 36.53

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.51 out of 30.11

Confidence: medium

Additional weak hits (14):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.95 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.66 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.73 out of 36.53

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.23 out of 33.14

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.04 out of 30.11

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.96 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.29 out of 35.63

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.91 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.12 out of 30.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.11 out of 24.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.16 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor

NZ_JABWGO010000017.1 - Region 1 - lanthipeptide-class-iii,terpene

Download region GenBank file

Download region SVG

Location: 29,225 - 70,183 nt. (total: 40,959 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

HT134_RS41520: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

HT134_RS41525: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

HT134_RS41570: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

HT134_RS41625: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

HT134_RS46520: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Hydrolases: hydrolase

HT134_RS41545: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase decarboxylase

HT134_RS41510: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

HT134_RS41620: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Translocases: transporter

HT134_RS41465: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.32	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.32	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.27	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.27	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.27	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000843.5	0.26	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0000660.5	0.24	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001334.5	0.23	other (other)	caldoniamide A, cladoniamide B, cladoniamide C7, cladoniamide D, cladoniamide E, cladoniamide F, cladoniamide G	Streptomyces uncialis
BGC0000495.5	0.23	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0001484.3	0.23	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.65	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000660.5	0.57	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000518.3	0.56	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000553.3	0.53	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0001911.3	0.53	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.53	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for HT134_RS41580

HT134_RS41585

Leader:

MVLLDLQGLESPASSDVAS

Core:

GGSTLTVLGCHSGTPSNLSVAVCH

Core with dehydrations:

GGDhaDhbLDhbVLGCysHDhaGDhbPDhaNLDhaVAVCysH

antiSMASH-DB 4.0 matches for HT134_RS41585

100.0%

NZ_JABWGO010000017.1:

Lanthipeptides: HT134_RS41585_lanthipeptide

1

GGSTLTVLGCHSGTPSNLSVAVCH

24

GGSTLTVLGCHSGTPSNLSVAVCH

1

GGSTLTVLGCHSGTPSNLSVAVCH

24

95.8%

NZ_JABWGN010000023.1:

Lanthipeptides: HTZ77_RS41305_lanthipeptide

1

GGSTLTVLGCHSGTPSNLSVAVCH

24

GGSTLTVLGCHSG PSNLSVAVCH

1

GGSTLTVLGCHSGAPSNLSVAVCH

24

91.7%

NZ_JAIWLT010000005.1and 1 other:

NZ_JAIWLU010000020.1 Lanthipeptides: LDL05_RS29535_lanthipeptide

Lanthipeptides: LDL08_RS14700_lanthipeptide

1

GGSTLTVLGCHSGTPSNLSVAVCH

24

GGSTLTVLGCHSG PSNLSVA+CH

1

GGSTLTVLGCHSGKPSNLSVALCH

24

with 55 more sequence matches

Only the first 10 are displayed here.

87.5%

NZ_CP017717.1and 2 others:

NZ_FNDJ01000002.1 Lanthipeptides: BLS95_RS05705_lanthipeptideNZ_FNVT01000002.1 Lanthipeptides: C4V41_RS07345_lanthipeptide

Lanthipeptides: BKM31_RS59280_lanthipeptide

1

GGSTLTVLGCHSGTPSNLSVAVCH

24

GGSTLTVL CHSG PSNLSVA+CH

1

GGSTLTVLSCHSGKPSNLSVALCH

24

87.5%

NZ_CP084058.1:

Lanthipeptides: LCN96_RS39235_lanthipeptide

1

GGSTLTVLGCHSGTPSNLSVAVCH

24

GGSTLTVL CHSG PSNLSVA+CH

1

GGSTLTVLSCHSGAPSNLSVALCH

24

87.5%

NZ_JACHIN010000017.1:

Lanthipeptides: HNR40_RS44190_lanthipeptide

1

GGSTLTVLGCHSGTPSNLSVAVCH

24

GGSTLTVL CHSG PSNLSVA+CH

1

GGSTLTVLTCHSGKPSNLSVALCH

24

79.2%

NZ_JACDUR010000006.1and 2 others:

NZ_JPMW01000001.1 Lanthipeptides: EV45_RS41010_lanthipeptideNZ_JPMW01000001.1 Lanthipeptides: EV45_RS41005_lanthipeptide

Lanthipeptides: HNR30_RS31115_lanthipeptide

1

GGSTLTVLGCHSGTPSNLSVAVCH

24

GGSTLT L C+SG PSNLSVA+CH

1

GGSTLTALTCNSGKPSNLSVALCH

24

79.2%

NZ_JAHFZZ010000011.1:

Lanthipeptides: KLK06_RS32640_lanthipeptide

1

GGSTLTVLGCHSGTPSNLSVAVCH

24

GGSTLT L C SG PSNLSVA+CH

1

GGSTLTALTCQSGHPSNLSVALCH

24

79.2%

NZ_WBMT01000033.1:

Lanthipeptides: F8566_RS47085_lanthipeptide

1

GGSTLTVLGCHSGTPSNLSVAVCH

24

GGSTLT+L CHSG PSNLS A+CH

1

GGSTLTLLTCHSGKPSNLSAALCH

24

76.0%

NZ_CP029711.1:

Lanthipeptides: DKM19_RS31650_lanthipeptide

1

GGSTLTVLGCHSGTPSNLSVAVCH

24

GGSTLTVLGC S TPSNLS+ +CH

2

GGSTLTVLGCASVTPSNLSLVLCH

25

76.0%

NZ_SHKR01000011.1and 7 others:

NZ_SLWR01000003.1 Lanthipeptides: EV646_RS09945_lanthipeptideNZ_SNWS01000006.1 Lanthipeptides: EV651_RS15130_lanthipeptideNZ_SODF01000002.1 Lanthipeptides: EV650_RS20180_lanthipeptideNZ_SODP01000004.1 Lanthipeptides: EV653_RS35635_lanthipeptideNZ_SODT01000012.1 Lanthipeptides: EV647_RS27100_lanthipeptideNZ_SODU01000003.1 Lanthipeptides: EV137_RS31660_lanthipeptideNZ_SZPZ01000003.1 Lanthipeptides: FDA38_RS24670_lanthipeptide

Lanthipeptides: EV645_RS10765_lanthipeptide

1

GGSTLTVLGCHSGTPSNLSVAVCH

24

GGSTLTVLGC S TPSNLS+ +CH

2

GGSTLTVLGCASQTPSNLSLLLCH

25

75.0%

NZ_JACHJP010000003.1and 2 others:

NZ_JACHJP010000003.1 Lanthipeptides: FHS44_RS18405_lanthipeptideNZ_JACHJP010000003.1 Lanthipeptides: FHS44_RS18400_lanthipeptide

Lanthipeptides: FHS44_RS18410_lanthipeptide

2

GSTLTVLGCHSGTPSNLSVAVCH

24

GSTLTVLGC S TPSNLS+ +CH

1

GSTLTVLGCESHTPSNLSLVLCH

23

75.0%

NZ_JAKRKC020000001.1:

Lanthipeptides: MF672_RS25655_lanthipeptide

1

GGSTLTVLGCHSGTPSNLSVAVCH

24

GGS+LTV C S TPSNLSVA+CH

1

GGSSLTVATCGSHTPSNLSVALCH

24

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

HT134_RS41510: T1TS

Domain 1 (64 - 308): Type 1 terpene synthase

Subtype: unknown

HT134_RS41515: T2TS

Domain 1 (311 - 587): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.45 out of 26.33

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.84 out of 20.97

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (17):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.46 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.94 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.53 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.38 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.49 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.73 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.30 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.13 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.78 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.73 out of 19.26

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.79 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.30 out of 33.14

Confidence: weak

Lanthipeptides

Terpene

TFBS Finder

Core peptide predictions

HT134_RS41585 - Class III

Cleavage pHMM score: 12.90

RODEO score: 0

Monoisotopic mass: 2170.1 Da

Molecular weight: 2171.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2189.4 Da N = 1; 2207.5 Da N = 2; 2225.5 Da N = 3; 2243.5 Da N = 4; 2261.5 Da N = 5

Glossary

Acronym	Full name
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A

NZ_JABWGO010000018.1 - Region 1 - hserlactone

Download region GenBank file

Download region SVG

Location: 1 - 18,026 nt. (total: 18,026 nt) Show pHMM detection rules used

Region on contig edge.

hserlactone: Autoind_synth

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

HT134_RS41830: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001948.3	0.48	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.43	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000908.3	0.39	other (other)	melanin	Streptomyces avermitilis
BGC0001336.5	0.37	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001868.4	0.37	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001959.4	0.36	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0002301.2	0.36	PKS	(P)-ustilaginoidin A	Aschersonia paraphysata
BGC0000665.5	0.35	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001948.3	0.48	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.43	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000908.3	0.39	other (other)	melanin	Streptomyces avermitilis
BGC0001336.5	0.37	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001868.4	0.37	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001959.4	0.36	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0002301.2	0.36	PKS	(P)-ustilaginoidin A	Aschersonia paraphysata
BGC0000665.5	0.35	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.83 out of 28.19

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (9):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.86 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.10 out of 26.33

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.81 out of 24.78

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.12 out of 32.74

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.33 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.72 out of 28.14

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.71 out of 27.04

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
ZuR variant 1	Zinc-responsive repressor

NZ_JABWGO010000001.1 - Region 1 - crocagin,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 169,996 - 215,059 nt. (total: 45,064 nt) Show pHMM detection rules used

crocagin: (PhyH and Carbam_trans_N)
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

HT134_RS00870: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

HT134_RS00980: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

HT134_RS01055: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: methyltransferase transketolase

HT134_RS00930: transketolase

smcogs: SMCOG1204: transketolase

HT134_RS00990: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: hydrolase

HT134_RS00920: hydrolase

smcogs: SMCOG1179: hydrolase

HT134_RS01015: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

HT134_RS01030: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: decarboxylase

HT134_RS00965: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

HT134_RS00925: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

HT134_RS00960: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HT134_RS00985: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.52	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000820.5	0.36	other (other)	physostigmine	Streptomyces griseofuscus
BGC0002674.2	0.31	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0001588.3	0.30	saccharide	exopolysaccharides	Burkholderia pseudomallei 1026b
BGC0000131.5	0.30	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0001778.5	0.30	other (other)	showdomycin	Streptomyces showdoensis
BGC0000041.3	0.29	PKS	oronofacic acid	Pseudomonas syringae
BGC0001187.4	0.29	NRPS, PKS	xenolozoyenone	Glarea lozoyensis
BGC0000719.5	0.29	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0000353.5	0.28	NRPS	tacrolimus	Streptomyces sp. MA6548

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000820.5	0.50	other (other)	physostigmine	Streptomyces griseofuscus
BGC0002318.2	0.49	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0002674.2	0.46	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0001588.3	0.46	saccharide	exopolysaccharides	Burkholderia pseudomallei 1026b
BGC0000131.5	0.45	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000519.4	0.45	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002700.2	0.45	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0001778.5	0.45	other (other)	showdomycin	Streptomyces showdoensis
BGC0001187.4	0.45	NRPS, PKS	xenolozoyenone	Glarea lozoyensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (11):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.42 out of 26.33

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.82 out of 30.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.77 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 19.26

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.96 out of 24.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.95 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.87 out of 26.06

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.82 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.72 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

HT134_RS00960: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (13..402): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAILFDYGLYQLPVTNTGAVFMFGITECKRVSIS
Nearest Stachelhaus code(s):: Asp DYYPTTMRVK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_JABWGO010000001.1 - Region 2 - PKS-like,T2PKS,other

Download region GenBank file

Download region SVG

Location: 1,209,576 - 1,290,609 nt. (total: 81,034 nt) Show pHMM detection rules used

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
T2PKS: (t2ks and t2clf)
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

HT134_RS05655: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

HT134_RS05710: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

HT134_RS05725: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

HT134_RS05745: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

HT134_RS05770: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

HT134_RS05780: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

HT134_RS05830: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HT134_RS05840: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HT134_RS05865: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HT134_RS05875: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

HT134_RS05925: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HT134_RS05930: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HT134_RS05975: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

HT134_RS05995: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: acylase acyltransferase aminotransferase glycosyltransferase methyltransferase transferase

HT134_RS05635: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

HT134_RS05695: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

HT134_RS05735: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

HT134_RS05760: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

HT134_RS05775: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

HT134_RS05790: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

HT134_RS05800: methyltransferase

smcogs: SMCOG1089: methyltransferase

HT134_RS05805: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

HT134_RS05845: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

HT134_RS05970: acyltransferase

smcogs: SMCOG1141: acyltransferase

Hydrolases: hydrolase

HT134_RS05785: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase dehydratase

HT134_RS05700: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

HT134_RS05730: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

HT134_RS05835: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

HT134_RS05810: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

HT134_RS05815: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

HT134_RS05820: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000217.5	1.14	PKS	daunorubicin	Streptomyces sp.
BGC0000218.5	1.11	PKS	doxorubicin	Streptomyces peucetius
BGC0000231.5	0.74	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000272.3	0.65	PKS	spore pigment	Streptomyces collinus
BGC0001817.5	0.64	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002276.2	0.59	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000898.5	0.59	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0001275.3	0.58	PKS	6-methylsalicyclic acid	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000218.5	0.83	PKS	doxorubicin	Streptomyces peucetius
BGC0000217.5	0.83	PKS	daunorubicin	Streptomyces sp.
BGC0000231.5	0.70	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.57 out of 26.33

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.80 out of 23.79

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.18 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.35 out of 23.79

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (32):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.22 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.23 out of 27.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.85 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.82 out of 26.06

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.63 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.08 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.98 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.24 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.89 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.44 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.71 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.07 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.63 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.07 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.71 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.81 out of 27.04

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 25.75

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.12 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.22 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.43 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.91 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.12 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.93 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.15 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.82 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.78 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.55 out of 35.63

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

HT134_RS05805: mal

PKS_AT (6..287): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 58.6
Methylmalonyl-CoA: 37.1
Methoxymalonyl-CoA: 32.9
Propionyl-CoA: 26.7
inactive: 23.4
Ethylmalonyl-CoA: 19.6
Acetyl-CoA: 11.0
fatty_acid: 9.5
2-Methylbutyryl-CoA: 8.7
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 1218136 to 1290609
Starter unit(s):: propionyl-CoA (Score: 861.0; E-value: 2.21e-176)
Malonyl elongations:: 8|9 (Score: 629.3; E-value: 5.2e-192)
Product class(es):: anthracycline
Product molecular weight(s):: propionyl-CoA_8: 729 Da
propionyl-CoA_9: 771 Da

HT134_RS05715: CYC C5-C14/C3-C16 (Score: 437.3; E-value: 4.1e-134)
HT134_RS05745: OXY (Score: 263.7; E-value: 8.4e-81)
HT134_RS05775: GT (Score: 452.6; E-value: 3.5e-138)
HT134_RS05790: MET (Score: 291.7; E-value: 1.6e-89)
HT134_RS05795: CYC C2-C19 (Score: 267.6; E-value: 4.7e-83)
HT134_RS05800: MET carboxy_O (Score: 352.1; E-value: 3.5e-108)
HT134_RS05805: AT (Score: 408.6; E-value: 4.6e-125); AT WP_100109099.1_Doxorubicin_propionyl-CoA (Score: 374.0; E-value: 2.9e-132)
HT134_RS05810: KSIII (Score: 477.2; E-value: 6.3e-146); KSIII WP_100109100.1_Doxorubicin_propionyl-CoA (Score: 487.0; E-value: 2.21e-176)
HT134_RS05815: CLF 8|9 (Score: 629.3; E-value: 5.2e-192)
HT134_RS05820: KS (Score: 726.4; E-value: 2.1e-221)
HT134_RS05830: KR C9 (Score: 455.7; E-value: 1e-139)
HT134_RS05835: CYC C7-C12 (Score: 457.2; E-value: 4.8e-140)
HT134_RS05840: KR C17 (Score: 369.5; E-value: 1.8e-113)
HT134_RS05845: GT (Score: 440.3; E-value: 1.9e-134)
HT134_RS05855: CYC C1-C18|C2-C19 (Score: 180.4; E-value: 3.5e-56)
HT134_RS05860: ACP (Score: 90.5; E-value: 1.2e-28)
HT134_RS05865: KR (Score: 84.1; E-value: 2.9e-26)
HT134_RS05925: KR (Score: 146.9; E-value: 2e-45)
HT134_RS05930: KR (Score: 169.8; E-value: 2e-52)

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator

NZ_JABWGO010000001.1 - Region 3 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1,591,127 - 1,612,194 nt. (total: 21,068 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

HT134_RS07355: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

HT134_RS07395: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

HT134_RS07400: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: phosphorylase

HT134_RS07385: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

Ligases: synthetase

HT134_RS07380: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001521.3	0.42	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002345.2	0.40	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000665.5	0.39	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000706.3	0.39	saccharide	kanamycin	Streptomyces kanamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001521.3	0.42	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002345.2	0.40	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000665.5	0.39	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000706.3	0.39	saccharide	kanamycin	Streptomyces kanamyceticus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

HT134_RS07380: PT_FPPS_like

Domain 1 (46 - 347): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.16 out of 30.11

Confidence: medium

Additional weak hits (13):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.23 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.87 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.24 out of 24.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.21 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.43 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.14 out of 26.12

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.06 out of 32.93

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.85 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.95 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.60 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor

NZ_JABWGO010000001.1 - Region 4 - terpene

Download region GenBank file

Download region SVG

Location: 1,744,559 - 1,765,566 nt. (total: 21,008 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

HT134_RS08050: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

HT134_RS08065: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: cyclase hydratase

HT134_RS08085: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

HT134_RS08110: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000503.5	0.41	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000583.5	0.41	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000903.3	0.40	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000885.3	0.39	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001810.3	0.37	PKS	trehangelin	Polymorphospora rubra
BGC0002346.3	0.37	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000595.3	0.37	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000516.4	0.36	ribosomal	geobacillin II	Geobacillus thermodenitrificans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000503.5	0.41	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000583.5	0.41	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000903.3	0.40	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000885.3	0.39	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001810.3	0.37	PKS	trehangelin	Polymorphospora rubra
BGC0002346.3	0.37	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000595.3	0.37	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000516.4	0.36	ribosomal	geobacillin II	Geobacillus thermodenitrificans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

HT134_RS08085: T1TS

Domain 1 (56 - 332): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (6):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.10 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.13 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.58 out of 31.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.44 out of 35.63

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.47 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_JABWGO010000001.1 - Region 5 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 2,308,810 - 2,321,950 nt. (total: 13,141 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

HT134_RS10590: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

HT134_RS10605: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

HT134_RS47595: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Hydrolases: hydrolase peptidase

HT134_RS10580: isochorismatase

smcogs: SMCOG1027: isochorismatase

HT134_RS10625: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.40	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002339.3	0.39	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0002436.2	0.37	other (other)	coformycin	Streptomyces citricolor
BGC0001007.5	0.33	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0002294.3	0.33	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0001006.5	0.32	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0001819.3	0.28	PKS	Venemycin	Streptomyces venezuelae
BGC0001281.3	0.27	PKS	ustilagic acid	Ustilago maydis 521
BGC0000014.5	0.26	PKS	ambruticin	Sorangium cellulosum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.40	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002339.3	0.39	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0002436.2	0.37	other (other)	coformycin	Streptomyces citricolor
BGC0001007.5	0.33	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0002294.3	0.33	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0001006.5	0.32	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0001819.3	0.28	PKS	Venemycin	Streptomyces venezuelae
BGC0001281.3	0.27	PKS	ustilagic acid	Ustilago maydis 521
BGC0000014.5	0.26	PKS	ambruticin	Sorangium cellulosum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 22.40

Confidence: strong

Additional weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.92 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.52 out of 26.85

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 15.87 out of 30.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 14.59 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.89 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
HypR	L-hydroxyproline utilization repressor

NZ_JABWGO010000002.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 786,205 - 837,747 nt. (total: 51,543 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

HT134_RS14775: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: formyltransferase

HT134_RS14720: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: hydrolase

HT134_RS14735: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

HT134_RS14755: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: dehydratase

HT134_RS14715: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

HT134_RS14730: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

HT134_RS14635: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

HT134_RS14685: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

HT134_RS14690: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

HT134_RS14695: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

HT134_RS14700: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HT134_RS14710: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0002071.2	0.69	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0002071.2	0.69	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.29 out of 27.55

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (20):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.45 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.55 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.23 out of 30.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 25.75

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.61 out of 39.62

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.54 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.57 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.02 out of 28.14

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.19 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.54 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.34 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.85 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.35 out of 30.98

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.04 out of 27.18

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.60 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 786204 - 837747:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Lys) + (Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

HT134_RS14685: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (492..883): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNSMMSGDVSLGGATEGSIWSIA
Nearest Stachelhaus code(s):: Cys DLYNMSLIWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

HT134_RS14690: Gly - Lys

Search NORINE for peptide: strict or relaxed

AMP-binding (460..816): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LGMTFDIAGLELQALTGGELNMYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1479..1845): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMASDTHAEEPDLILGGEVNTYGPTETTIIATA
Nearest Stachelhaus code(s):: Lys DTEDIGSVIK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

HT134_RS14700: X

AMP-binding (13..387): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: PHPFTNAGQVMHFVGSAAAVNYYTSTEAAPAQTI
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
GnfM	Regulator of nitrogen-fixation genes
VqsM	Regulator of quorum-sensing signalling systems

NZ_JABWGO010000002.1 - Region 2 - RRE-containing,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 956,845 - 982,552 nt. (total: 25,708 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002311.3	0.42	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0001472.5	0.29	ribosomal	berninamycin A	Streptomyces bernensis
BGC0002316.2	0.26	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0002363.3	0.23	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0001400.3	0.22	PKS	citreoviridin	Aspergillus terreus NIH2624
BGC0000565.5	0.22	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000615.4	0.22	ribosomal	TP-1161	Nocardiopsis sp. TFS65-07
BGC0001753.3	0.21	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0002635.2	0.21	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0002120.3	0.21	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002311.3	0.53	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0001472.5	0.45	ribosomal	berninamycin A	Streptomyces bernensis
BGC0002316.2	0.42	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0002363.3	0.40	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0000565.5	0.39	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000615.4	0.38	ribosomal	TP-1161	Nocardiopsis sp. TFS65-07
BGC0001400.3	0.38	PKS	citreoviridin	Aspergillus terreus NIH2624
BGC0002635.2	0.38	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001753.3	0.38	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0002120.3	0.37	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (11):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.92 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.15 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.40 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.26 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.27 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.36 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.27 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.82 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.63 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.98 out of 33.14

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 26 - 103; Score: 39.2
: RRE type: Stand_Alone_Lasso_RRE; Location: 26 - 103; Score: 39.2

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_JABWGO010000003.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 339,095 - 372,231 nt. (total: 33,137 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

HT134_RS17340: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HT134_RS45665: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: aminotransferase

HT134_RS17400: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: dehalogenase

HT134_RS17425: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: decarboxylase

HT134_RS17395: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

HT134_RS17405: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.67	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001478.5	0.62	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0001572.3	0.61	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002692.2	0.61	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002683.2	0.61	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000941.3	0.60	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001499.5	0.60	other (other)	aerobactin	Pantoea ananatis
BGC0002633.2	0.59	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0000295.5	0.59	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002305.2	0.59	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.67	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001478.5	0.62	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0001572.3	0.61	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002692.2	0.61	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002683.2	0.61	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000941.3	0.60	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001499.5	0.60	other (other)	aerobactin	Pantoea ananatis
BGC0002633.2	0.59	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0000295.5	0.59	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002305.2	0.59	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.03 out of 36.53

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.36 out of 25.31

Confidence: medium

Additional weak hits (14):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.30 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.62 out of 32.74

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.54 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.18 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.84 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.84 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.45 out of 24.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.97 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.82 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.14 out of 36.53

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.19 out of 27.04

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 18.89 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor

NZ_JABWGO010000004.1 - Region 1 - HR-T2PKS,T1PKS

Download region GenBank file

Download region SVG

Location: 44,687 - 158,123 nt. (total: 113,437 nt) Show pHMM detection rules used

HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

HT134_RS19015: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

HT134_RS19025: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

HT134_RS19065: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

HT134_RS19070: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HT134_RS19100: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

HT134_RS19240: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HT134_RS19245: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HT134_RS19255: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

HT134_RS19285: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

HT134_RS19290: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HT134_RS47685: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase acylase aminotransferase glycosyltransferase methyltransferase transferase

HT134_RS19020: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

HT134_RS19040: methyltransferase

smcogs: SMCOG1089: methyltransferase

HT134_RS19050: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

HT134_RS19055: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

HT134_RS19110: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

HT134_RS19160: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

HT134_RS19170: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

HT134_RS19280: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

HT134_RS44740: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase esterase hydrolase phosphatase

HT134_RS19105: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

HT134_RS19125: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

HT134_RS19270: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

HT134_RS19275: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

HT134_RS19155: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

HT134_RS19090: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

HT134_RS19180: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

HT134_RS19190: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HT134_RS19195: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

HT134_RS19235: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

HT134_RS19250: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

HT134_RS19295: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

HT134_RS19345: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002164.2	0.60	NRPS	peramine	Epichloe festucae
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti
BGC0001166.5	0.58	NRPS	HC-toxin	Alternaria jesenskae
BGC0001251.4	0.58	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.58	NRPS	epichloenin A	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.75	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 17.93 out of 23.79

Confidence: medium

Additional weak hits (27):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.68 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.20 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.49 out of 30.22

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.70 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.20 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.48 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.98 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.73 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.42 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.18 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.67 out of 25.88

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.94 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.12 out of 21.84

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.79 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.43 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.10 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.53 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.19 out of 24.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.88 out of 39.62

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.62 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.68 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.35 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.06 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.48 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 44686 - 158123:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-ccmal) + (ccmal) + (Me-ccmal) + (ohmal) + (ccmal) + (ohmal - ccmal)
Non-colinear ordering:: HT134_RS44740 + HT134_RS19235 + HT134_RS19240 + HT134_RS19245 + HT134_RS19295 + HT134_RS19250

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 68339 - 158123:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-ccmal) + (ccmal) + (Me-ccmal) + (ohmal) + (ccmal) + (ohmal - ccmal)
Non-colinear ordering:: HT134_RS44740 + HT134_RS19235 + HT134_RS19240 + HT134_RS19245 + HT134_RS19295 + HT134_RS19250

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

HT134_RS19110: mal

PKS_AT (4..278): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 72.8
inactive: 33.2
Methoxymalonyl-CoA: 27.8
fatty_acid: 20.0
Methylmalonyl-CoA: 18.9
Benzoyl-CoA: 14.0
Isobutyryl-CoA: 12.1
Ethylmalonyl-CoA: 9.6
Propionyl-CoA: 5.2
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

HT134_RS19190: X

AMP-binding (11..422): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: YHVFFDLSVFDAFSLFCGEENLYGPTELTISCTE
Nearest Stachelhaus code(s):: Gly DLFFLCLLSK (94% 8Å match); foGly DLFFLCLIAK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

HT134_RS44740: mmal - mmal

PKS_AT (671..966): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 187.6
Ethylmalonyl-CoA: 176.8
Methoxymalonyl-CoA: 151.3
trans-1,2-CPDA: 118.9
2-Methylbutyryl-CoA: 115.9
Propionyl-CoA: 114.9
CHC-CoA: 105.3
Malonyl-CoA: 91.7
Benzoyl-CoA: 59.5
Isobutyryl-CoA: 46.0
Acetyl-CoA: 43.2
3-Methylbutyryl-CoA: 32.3
fatty_acid: 23.4
inactive: 22.8

PKS_AT (1735..2030): mmal

ATSignature: Methylmalonyl-CoA, Ethylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 75.0%; Ethylmalonyl-CoA: 75.0%; Methoxymalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 169.1
Ethylmalonyl-CoA: 159.6
Methoxymalonyl-CoA: 131.0
2-Methylbutyryl-CoA: 98.6
trans-1,2-CPDA: 95.0
CHC-CoA: 80.9
Propionyl-CoA: 77.9
Malonyl-CoA: 76.1
Isobutyryl-CoA: 61.4
Benzoyl-CoA: 56.7
3-Methylbutyryl-CoA: 30.2
inactive: 19.6
Acetyl-CoA: 17.7
fatty_acid: 16.0

HT134_RS19235: mal

PKS_AT (624..920): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 169.9
inactive: 85.4
Methoxymalonyl-CoA: 66.6
Methylmalonyl-CoA: 55.8
Ethylmalonyl-CoA: 29.4
Acetyl-CoA: 21.1
fatty_acid: 18.6
Propionyl-CoA: 18.3
Isobutyryl-CoA: 17.5
Benzoyl-CoA: 13.3
trans-1,2-CPDA: 10.5
CHC-CoA: 4.7
2-Methylbutyryl-CoA: 2.0
3-Methylbutyryl-CoA: 0.0

HT134_RS19240: mmal

PKS_AT (577..870): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 196.3
Ethylmalonyl-CoA: 189.0
Methoxymalonyl-CoA: 158.9
2-Methylbutyryl-CoA: 121.4
trans-1,2-CPDA: 107.1
Malonyl-CoA: 96.2
Propionyl-CoA: 95.6
Isobutyryl-CoA: 72.2
Benzoyl-CoA: 71.9
CHC-CoA: 63.9
3-Methylbutyryl-CoA: 38.9
Acetyl-CoA: 32.8
fatty_acid: 31.0
inactive: 25.6

HT134_RS19245: mal

PKS_AT (594..913): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 112.8
inactive: 65.3
Methoxymalonyl-CoA: 27.6
Methylmalonyl-CoA: 23.9
Propionyl-CoA: 8.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

HT134_RS19250: mal - mal

PKS_AT (535..836): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 119.2
inactive: 75.4
Methoxymalonyl-CoA: 56.5
Methylmalonyl-CoA: 54.0
Isobutyryl-CoA: 34.0
Propionyl-CoA: 22.8
Ethylmalonyl-CoA: 21.2
Benzoyl-CoA: 12.0
CHC-CoA: 10.8
2-Methylbutyryl-CoA: 8.9
Acetyl-CoA: 8.8
3-Methylbutyryl-CoA: 6.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0

PKS_AT (2186..2489): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; 2-Rhyd-Malonyl-CoA: 66.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 125.5
inactive: 61.3
Methoxymalonyl-CoA: 60.2
Methylmalonyl-CoA: 50.0
Propionyl-CoA: 45.3
Ethylmalonyl-CoA: 20.2
2-Methylbutyryl-CoA: 16.5
CHC-CoA: 15.0
Isobutyryl-CoA: 12.5
fatty_acid: 10.2
Benzoyl-CoA: 6.2
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

HT134_RS19295: mal

PKS_AT (532..836): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 86.8
Methoxymalonyl-CoA: 57.2
inactive: 45.1
Methylmalonyl-CoA: 41.8
Ethylmalonyl-CoA: 25.1
Propionyl-CoA: 18.7
Isobutyryl-CoA: 16.2
fatty_acid: 14.5
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism

NZ_JABWGO010000004.1 - Region 2 - other

Download region GenBank file

Download region SVG

Location: 181,354 - 222,280 nt. (total: 40,927 nt) Show pHMM detection rules used

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

HT134_RS19615: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

HT134_RS19650: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HT134_RS19655: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HT134_RS19695: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase transketolase

HT134_RS19560: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

HT134_RS19595: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

HT134_RS19690: transketolase

smcogs: SMCOG1204: transketolase

Translocases: transporter

HT134_RS19590: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.50	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000866.5	0.50	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0001361.3	0.47	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.47	terpene	sodorifen	Serratia plymuthica
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0002000.4	0.45	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.50	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000866.5	0.50	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0001361.3	0.47	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.47	terpene	sodorifen	Serratia plymuthica
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0002000.4	0.45	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.35 out of 23.79

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.77 out of 29.72

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

Additional weak hits (18):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.60 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.77 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.87 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.77 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.85 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.43 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.22 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.65 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.63 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.40 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.69 out of 21.55

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.03 out of 25.88

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.79 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.40 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.80 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.04 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
ToxT	Regulator of MSHA biosynthesis

NZ_JABWGO010000004.1 - Region 3 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 451,630 - 505,929 nt. (total: 54,300 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase synthase

HT134_RS20855: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

HT134_RS20860: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

HT134_RS20895: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.84	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.83	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.80	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.80	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.79	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.77	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (13):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.73 out of 32.74

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.85 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.13 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.52 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.30 out of 29.65

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.79 out of 27.04

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.12 out of 27.04

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.27 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.84 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.27 out of 20.01

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.87 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 451629 - 505929:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Pro) + (mal - Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

HT134_RS20855: mal - Gly

Search NORINE for peptide: strict or relaxed

PKS_AT (1037..1311): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 179.1
inactive: 104.5
Methoxymalonyl-CoA: 51.3
Methylmalonyl-CoA: 46.6
Propionyl-CoA: 39.7
Isobutyryl-CoA: 28.7
Ethylmalonyl-CoA: 24.5
Benzoyl-CoA: 21.3
fatty_acid: 17.6
Acetyl-CoA: 10.3
CHC-CoA: 10.1
2-Methylbutyryl-CoA: 6.1
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

AMP-binding (1936..2319): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDISVLELQALCGGEWNMYGPTETTIWSTL
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

HT134_RS20860: X - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (17..391): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWSTFDPSVWEMYASTGGDVNLYGPAECAVNAIA
Nearest Stachelhaus code(s):: Arg DPWGFGLVDK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (984..1370): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHTFDVSVQESFLITAGEHNQYGPTEGAIIDIA
Nearest Stachelhaus code(s):: Pro DVQFIAHVIK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_JABWGO010000005.1 - Region 1 - T1PKS,terpene

Download region GenBank file

Download region SVG

Location: 71,913 - 121,063 nt. (total: 49,151 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

HT134_RS22000: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

HT134_RS22020: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

HT134_RS22080: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: halogenase

HT134_RS21980: halogenase

smcogs: SMCOG1119: halogenase

Ligases: synthase synthetase

HT134_RS21975: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

HT134_RS22005: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

HT134_RS22030: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: transporter

HT134_RS21910: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000656.5	0.60	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000664.5	0.52	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.48	terpene	isorenieratene	Streptomyces argillaceus
BGC0000647.3	0.47	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000649.3	0.46	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.46	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.45	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000645.3	0.41	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000640.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000638.3	0.35	terpene	carotenoid	Pantoea ananatis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000656.5	0.63	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000664.5	0.60	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.58	terpene	isorenieratene	Streptomyces argillaceus
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000649.3	0.57	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000633.3	0.57	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.57	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001276.3	0.56	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		PSPP	C30	acyclic	PP
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

HT134_RS22015: PT_phytoene_like

Domain 1 (27 - 317): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

HT134_RS22030: PT_FPPS_like

Domain 1 (45 - 336): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.10 out of 23.79

Confidence: medium

Additional weak hits (12):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.10 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.04 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.34 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.07 out of 21.84

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.69 out of 19.26

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.76 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.35 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.31 out of 36.53

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.65 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Terpene

TFBS Finder

NRPS/PKS substrate predictions

HT134_RS21975: mal

PKS_AT (612..846): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 106.0
Methoxymalonyl-CoA: 57.0
inactive: 53.2
Methylmalonyl-CoA: 46.7
Propionyl-CoA: 36.8
trans-1,2-CPDA: 28.3
Ethylmalonyl-CoA: 24.6
Isobutyryl-CoA: 19.9
fatty_acid: 18.5
2-Methylbutyryl-CoA: 16.3
Acetyl-CoA: 10.7
CHC-CoA: 6.9
Benzoyl-CoA: 5.7
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JABWGO010000005.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 202,878 - 223,798 nt. (total: 20,921 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

HT134_RS22495: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Lyases: cyclase

HT134_RS22485: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001642.3	0.74	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000878.5	0.38	other (other)	puromycin	Streptomyces alboniger
BGC0002387.2	0.32	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000821.5	0.30	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001514.5	0.29	other (other)	aristeromycin	Streptomyces citricolor
BGC0002545.3	0.28	PKS	sungeidine C, sungeidine B, sungeidine D, sungeidine H, sungeidine A, sungeidine E, sungeidine F, sungeidine G	Micromonospora sp.
BGC0001060.5	0.27	PKS	dynemicin A	Micromonospora chersina
BGC0000937.5	0.27	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001642.3	0.74	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000878.5	0.38	other (other)	puromycin	Streptomyces alboniger
BGC0002387.2	0.32	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000821.5	0.30	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001514.5	0.29	other (other)	aristeromycin	Streptomyces citricolor
BGC0002545.3	0.28	PKS	sungeidine C, sungeidine B, sungeidine D, sungeidine H, sungeidine A, sungeidine E, sungeidine F, sungeidine G	Micromonospora sp.
BGC0001060.5	0.27	PKS	dynemicin A	Micromonospora chersina
BGC0000937.5	0.27	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

HT134_RS22485: T1TS

Domain 1 (2 - 292): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.65 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.52 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.48 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.48 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.08 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.64 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.64 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

NZ_JABWGO010000005.1 - Region 3 - T3PKS

Download region GenBank file

Download region SVG

Location: 452,377 - 493,396 nt. (total: 41,020 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: kinase

HT134_RS23650: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: hydrolase

HT134_RS23610: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: synthase

HT134_RS23620: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Translocases: transporter

HT134_RS23685: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.57	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001962.3	0.50	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0002332.2	0.45	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001831.3	0.44	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001364.3	0.42	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002285.2	0.42	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.40	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.57	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001962.3	0.50	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0002332.2	0.45	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001831.3	0.44	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001364.3	0.42	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002285.2	0.42	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.40	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.36 out of 20.97

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.48 out of 23.79

Confidence: medium

Additional weak hits (9):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.19 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.15 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.31 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.39 out of 20.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.44 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.17 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.74 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism

NZ_JABWGO010000007.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 185,588 - 211,781 nt. (total: 26,194 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

HT134_RS27120: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Lyases: cyclase dehydratase

HT134_RS27095: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

HT134_RS27125: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

HT134_RS27110: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.83	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000657.5	0.57	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.49	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.48	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.42	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002496.3	0.42	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000643.3	0.39	terpene	carotenoid	Brevundimonas vesicularis
BGC0000286.3	0.39	PKS	viguiepinol	Streptomyces sp. KO-3988

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.83	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000657.5	0.57	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.49	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.48	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.42	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002496.3	0.42	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000643.3	0.39	terpene	carotenoid	Brevundimonas vesicularis
BGC0000286.3	0.39	PKS	viguiepinol	Streptomyces sp. KO-3988

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

HT134_RS27095: T1TS + T1TS

Domain 1 (2 - 327): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (343 - 692): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

HT134_RS27110: PT_FPPS_like

Domain 1 (29 - 331): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.91 out of 23.79

Confidence: medium

Additional weak hits (15):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.09 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.15 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.06 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.69 out of 30.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.72 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.53 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.04 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.66 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.71 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.90 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.81 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.52 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.52 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.21 out of 20.01

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JABWGO010000007.1 - Region 2 - T3PKS

Download region GenBank file

Download region SVG

Location: 255,933 - 296,985 nt. (total: 41,053 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

HT134_RS27435: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

HT134_RS27455: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

Transferases: methyltransferase

HT134_RS27450: Methylation

MITE: MITE0000155Methylation (identity: 71.70%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Hydrolases: hydrolase

HT134_RS27460: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: dehydratase

HT134_RS27475: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

HT134_RS27445: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.83	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001077.4	0.47	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002362.3	0.45	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0002007.2	0.44	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002285.2	0.44	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001647.3	0.43	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001964.2	0.43	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000820.5	0.40	other (other)	physostigmine	Streptomyces griseofuscus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.83	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001077.4	0.47	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002362.3	0.45	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0002007.2	0.44	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002285.2	0.44	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001647.3	0.43	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001964.2	0.43	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000820.5	0.40	other (other)	physostigmine	Streptomyces griseofuscus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

Additional weak hits (37):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.09 out of 31.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.89 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.16 out of 30.97

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.93 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.65 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.92 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.21 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.08 out of 20.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.68 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.59 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.73 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.44 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.49 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.56 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.05 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.53 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.92 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.29 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.83 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.02 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.81 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.17 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.50 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.25 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.35 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.76 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.18 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.00 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.40 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.91 out of 29.65

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.01 out of 30.11

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.60 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.54 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.80 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_JABWGO010000009.1 - Region 1 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 120,362 - 142,995 nt. (total: 22,634 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: kinase

HT134_RS30675: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.58	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000519.4	0.47	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000528.5	0.45	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002698.2	0.43	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000626.3	0.42	ribosomal	thuricin	Bacillus thuringiensis
BGC0001210.5	0.42	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000527.5	0.42	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001787.3	0.42	ribosomal	suicin 3908	Streptococcus suis
BGC0000498.5	0.41	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000521.3	0.41	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.58	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000519.4	0.47	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000528.5	0.45	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002698.2	0.43	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000626.3	0.42	ribosomal	thuricin	Bacillus thuringiensis
BGC0001210.5	0.42	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000527.5	0.42	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001787.3	0.42	ribosomal	suicin 3908	Streptococcus suis
BGC0000498.5	0.41	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000521.3	0.41	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.90 out of 23.79

Confidence: medium

Additional weak hits (6):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.27 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.35 out of 39.62

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.28 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.64 out of 21.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.82 out of 27.55

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JABWGO010000009.1 - Region 2 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 378,881 - 401,499 nt. (total: 22,619 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

HT134_RS31830: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Transferases: sulfotransferase

HT134_RS31875: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

Lyases: cyclase

HT134_RS31880: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.59	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000551.5	0.50	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.48	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.46	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.45	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002698.2	0.44	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000504.5	0.44	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001210.5	0.44	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000500.5	0.43	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001576.3	0.43	ribosomal	divamide A	Prochloron didemni

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.59	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000551.5	0.50	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.48	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.46	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.45	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002698.2	0.44	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000504.5	0.44	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001210.5	0.44	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000500.5	0.43	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001576.3	0.43	ribosomal	divamide A	Prochloron didemni

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.25 out of 20.01

Confidence: medium

Additional weak hits (15):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.59 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.70 out of 27.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.01 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.82 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.50 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.31 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.95 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.38 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.40 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.58 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.19 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.89 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.51 out of 28.14

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes