GCF_012726295.1 - 18 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JABAOB010000011.1 (Chitinophaga sp. Ak27)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	terpene-precursor	105,686	126,657

NZ_JABAOB010000012.1 (Chitinophaga sp. Ak27)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	terpene	25,903	47,036

NZ_JABAOB010000001.1 (Chitinophaga sp. Ak27)

Region	Type	From	To
Region 11.1	RiPP-like	450,886	462,007
Region 11.2	terpene	514,775	535,770
Region 11.3	T3PKS	794,604	835,656
Region 11.4	RiPP-like	1,643,222	1,654,049

NZ_JABAOB010000002.1 (Chitinophaga sp. Ak27)

Region	Type	From	To
Region 13.1	NRPS	1	38,715
Region 13.2	terpene	94,829	115,827
Region 13.3	terpene	498,250	519,224
Region 13.4	NRPS-like,terpene	670,110	723,627
Region 13.5	lanthipeptide-class-i	807,607	832,828

NZ_JABAOB010000003.1 (Chitinophaga sp. Ak27)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	terpene	102,772	123,752
Region 14.2	resorcinol,arylpolyene,NAPAA	520,067	598,851

NZ_JABAOB010000004.1 (Chitinophaga sp. Ak27)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	NRPS,T1PKS,NRPS-like	6,744	145,136	Low	zwittermicin A	NRPS:Type I+PKS

NZ_JABAOB010000006.1 (Chitinophaga sp. Ak27)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	RiPP-like	98,972	109,898

NZ_JABAOB010000007.1 (Chitinophaga sp. Ak27)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	terpene	301,595	322,566

NZ_JABAOB010000008.1 (Chitinophaga sp. Ak27)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	arylpolyene	1	39,532	Low	flexirubin	PKS

NZ_JABAOB010000009.1 (Chitinophaga sp. Ak27)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	NRPS,T1PKS	165,492	247,459

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	terpene-precursor	105,686	126,657
Region 3.1	terpene	25,903	47,036
Region 11.1	RiPP-like	450,886	462,007
Region 11.2	terpene	514,775	535,770
Region 11.3	T3PKS	794,604	835,656
Region 11.4	RiPP-like	1,643,222	1,654,049
Region 13.1	NRPS	1	38,715
Region 13.2	terpene	94,829	115,827
Region 13.3	terpene	498,250	519,224
Region 13.4	NRPS-like,terpene	670,110	723,627
Region 13.5	lanthipeptide-class-i	807,607	832,828
Region 14.1	terpene	102,772	123,752
Region 14.2	resorcinol,arylpolyene,NAPAA	520,067	598,851
Region 15.1	NRPS,T1PKS,NRPS-like	6,744	145,136	Low	zwittermicin A	NRPS:Type I+PKS
Region 17.1	RiPP-like	98,972	109,898
Region 18.1	terpene	301,595	322,566
Region 19.1	arylpolyene	1	39,532	Low	flexirubin	PKS
Region 20.1	NRPS,T1PKS	165,492	247,459

No secondary metabolite regions were found in these records:: NZ_JABAOB010000010.1 (Chitinophaga sp. Ak27); NZ_JABAOB010000013.1 (Chitinophaga sp. Ak27); NZ_JABAOB010000014.1 (Chitinophaga sp. Ak27); NZ_JABAOB010000015.1 (Chitinophaga sp. Ak27); NZ_JABAOB010000016.1 (Chitinophaga sp. Ak27); NZ_JABAOB010000017.1 (Chitinophaga sp. Ak27); NZ_JABAOB010000018.1 (Chitinophaga sp. Ak27); NZ_JABAOB010000019.1 (Chitinophaga sp. Ak27); NZ_JABAOB010000020.1 (Chitinophaga sp. Ak27); NZ_JABAOB010000005.1 (Chitinophaga sp. Ak27)

Compact view

NZ_JABAOB010000011.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 105,686 - 126,657 nt. (total: 20,972 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

HGH90_RS28325: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Hydrolases: dehalogenase protease

HGH90_RS28335: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

HGH90_RS28410: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: synthase synthetase

HGH90_RS28365: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

HGH90_RS28395: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Translocases: permease

HGH90_RS28360: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000597.4	0.40	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0002213.3	0.39	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001880.3	0.39	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0001529.5	0.39	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001604.3	0.39	terpene	gibberellin	Fusarium fujikuroi
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.38	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000595.3	0.37	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000638.3	0.37	terpene	carotenoid	Pantoea ananatis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000597.4	0.40	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0002213.3	0.39	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001880.3	0.39	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0001529.5	0.39	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001604.3	0.39	terpene	gibberellin	Fusarium fujikuroi
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.38	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000595.3	0.37	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000638.3	0.37	terpene	carotenoid	Pantoea ananatis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

HGH90_RS28365: PT_FPPS_like

Domain 1 (28 - 322): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Terpene

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

NZ_JABAOB010000012.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 25,903 - 47,036 nt. (total: 21,134 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

HGH90_RS29240: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase

HGH90_RS29290: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Isomerases: mutase

HGH90_RS29295: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002707.2	0.47	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0001184.4	0.41	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002496.3	0.41	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000671.3	0.40	terpene	momilactone B	Oryza sativa Japonica Group
BGC0001197.5	0.40	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001605.3	0.37	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000188.5	0.37	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002707.2	0.47	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0001184.4	0.41	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002496.3	0.41	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000671.3	0.40	terpene	momilactone B	Oryza sativa Japonica Group
BGC0001197.5	0.40	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001605.3	0.37	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000188.5	0.37	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

HGH90_RS29290: T1TS

Domain 1 (8 - 357): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.02 out of 28.19

Confidence: medium

Additional weak hits (5):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.05 out of 28.14

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.70 out of 33.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.35 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 26.54 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.98 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
ZuR variant 1	Zinc-responsive repressor

NZ_JABAOB010000001.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 450,886 - 462,007 nt. (total: 11,122 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: dehalogenase

HGH90_RS01815: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002007.2	0.32	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001410.3	0.27	saccharide	polysaccharide A	Bacteroides fragilis
BGC0000187.5	0.23	PKS	asukamycin	Streptomyces nodosus subsp. asukaensis
BGC0000289.5	0.20	NRPS, saccharide	A40926	Nonomuraea gerenzanensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002007.2	0.32	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001410.3	0.27	saccharide	polysaccharide A	Bacteroides fragilis
BGC0000187.5	0.23	PKS	asukamycin	Streptomyces nodosus subsp. asukaensis
BGC0000289.5	0.20	NRPS, saccharide	A40926	Nonomuraea gerenzanensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.96 out of 26.06

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.76 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_JABAOB010000001.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 514,775 - 535,770 nt. (total: 20,996 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

HGH90_RS02160: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Hydrolases: dehalogenase

HGH90_RS02125: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: cyclase

HGH90_RS02135: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000878.5	0.42	other (other)	puromycin	Streptomyces alboniger
BGC0000278.3	0.39	PKS	urdamycin	Streptomyces fradiae
BGC0000043.5	0.38	PKS	curacin A	Moorea producens 19L
BGC0000719.5	0.35	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0002007.2	0.34	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000559.4	0.34	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000535.4	0.34	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0000536.3	0.34	ribosomal	nisin Q	Lactococcus lactis
BGC0000537.3	0.33	ribosomal	nisin U	Streptococcus uberis
BGC0001789.3	0.33	ribosomal	suicin 90-1330	Streptococcus suis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000878.5	0.42	other (other)	puromycin	Streptomyces alboniger
BGC0000278.3	0.39	PKS	urdamycin	Streptomyces fradiae
BGC0000043.5	0.38	PKS	curacin A	Moorea producens 19L
BGC0000719.5	0.35	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0002007.2	0.34	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000559.4	0.34	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000535.4	0.34	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0000536.3	0.34	ribosomal	nisin Q	Lactococcus lactis
BGC0000537.3	0.33	ribosomal	nisin U	Streptococcus uberis
BGC0001789.3	0.33	ribosomal	suicin 90-1330	Streptococcus suis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

HGH90_RS02135: T1TS

Domain 1 (8 - 283): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.54 out of 26.33

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.98 out of 28.19

Confidence: medium

Additional weak hits (6):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.85 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.53 out of 39.62

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.15 out of 32.74

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.62 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.39 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.45 out of 29.38

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JABAOB010000001.1 - Region 3 - T3PKS

Download region GenBank file

Download region SVG

Location: 794,604 - 835,656 nt. (total: 41,053 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

HGH90_RS03195: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HGH90_RS03210: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

Transferases: acetyltransferase glycosyltransferase

HGH90_RS03220: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

HGH90_RS03245: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Ligases: synthase

HGH90_RS03185: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

HGH90_RS03200: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.51	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001962.3	0.50	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0002403.2	0.48	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0001831.3	0.47	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000281.3	0.46	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000902.4	0.45	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002332.2	0.44	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001987.2	0.44	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0001077.4	0.44	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.51	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001962.3	0.50	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0002403.2	0.48	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0001831.3	0.47	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000281.3	0.46	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000902.4	0.45	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002332.2	0.44	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001987.2	0.44	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0001077.4	0.44	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.56 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.21 out of 27.78

Confidence: medium

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 26.52 out of 33.14

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.32 out of 29.65

Confidence: medium

Additional weak hits (11):

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.44 out of 20.47

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.61 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.28 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.63 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 28.02 out of 39.62

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.28 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.45 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.50 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.47 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.31 out of 20.47

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 1	Repressor of DNA damage response
ZuR variant 2	Zinc-responsive repressor

NZ_JABAOB010000001.1 - Region 4 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1,643,222 - 1,654,049 nt. (total: 10,828 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

No matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.15 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.35 out of 26.06

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.66 out of 20.97

Confidence: medium

Additional weak hits (7):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.55 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.79 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.18 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.81 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.04 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 28.19 out of 39.62

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.79 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
MogR	Repressor of flagellar motility genes

NZ_JABAOB010000002.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 38,715 nt. (total: 38,715 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

HGH90_RS07895: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase aminotransferase

HGH90_RS07995: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

HGH90_RS08010: aminotransferase

smcogs: SMCOG1019: aminotransferase

HGH90_RS08060: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: ligase

HGH90_RS07985: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.99 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.35 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.12 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 28.19

Confidence: medium

Additional weak hits (8):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.58 out of 31.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.08 out of 39.62

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.65 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.52 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.80 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.19 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.75 out of 33.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.39 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 38715:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

HGH90_RS07985: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (225..629): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: LWVTFDLSVYDGDSFLSGDVSLGGATEATIWSNY
Nearest Stachelhaus code(s):: Cys DLFDFSLVWK (91% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor

NZ_JABAOB010000002.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 94,829 - 115,827 nt. (total: 20,999 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

HGH90_RS08330: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Lyases: cyclase

HGH90_RS08345: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000757.3	0.44	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000754.3	0.42	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000755.3	0.42	saccharide	capsular polysaccharide	Avibacterium paragallinarum 221
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0001868.4	0.39	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0000789.3	0.35	saccharide	O-antigen	Escherichia coli
BGC0000739.3	0.34	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0001221.5	0.32	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0000765.3	0.31	saccharide	exopolysaccharide	Lactobacillus johnsonii
BGC0000734.3	0.31	saccharide	capsular polysaccharide	Pasteurella multocida

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000757.3	0.44	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000754.3	0.42	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000755.3	0.42	saccharide	capsular polysaccharide	Avibacterium paragallinarum 221
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0001868.4	0.39	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0000789.3	0.35	saccharide	O-antigen	Escherichia coli
BGC0000739.3	0.34	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0001221.5	0.32	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0000765.3	0.31	saccharide	exopolysaccharide	Lactobacillus johnsonii
BGC0000734.3	0.31	saccharide	capsular polysaccharide	Pasteurella multocida

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

HGH90_RS08345: T1TS

Domain 1 (4 - 316): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.40 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.83 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.65 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.73 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 26.26 out of 36.54

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

NZ_JABAOB010000002.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 498,250 - 519,224 nt. (total: 20,975 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase aminotransferase glycosyltransferase

HGH90_RS09835: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

HGH90_RS09840: sugar transferase

smcogs: SMCOG1146: sugar transferase

HGH90_RS09845: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

HGH90_RS09850: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Lyases: cyclase

HGH90_RS09875: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002708.2	0.75	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000683.3	0.75	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002707.2	0.51	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002283.2	0.50	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.50	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000742.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000743.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000772.5	0.46	saccharide	lipopolysaccharide	Brucella melitensis
BGC0000800.5	0.45	saccharide	xanthan	Xanthomonas campestris
BGC0000674.5	0.45	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002708.2	0.75	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000683.3	0.75	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002707.2	0.51	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002283.2	0.50	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.50	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000742.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000743.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000772.5	0.46	saccharide	lipopolysaccharide	Brucella melitensis
BGC0000800.5	0.45	saccharide	xanthan	Xanthomonas campestris
BGC0000674.5	0.45	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene			C10	C1-C10	none
sesquiterpene			C15	C1-C10	none

Genes with terpene domains:

HGH90_RS09875: T1TS

Domain 1 (1 - 314): Type 1 terpene synthase

Subtype: Germacrene A synthase type

Reactions:: GPP → monoterpene_C1-C10; FPP → sesquiterpene_C1-C10

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.22 out of 18.57

Confidence: strong

Additional weak hits (1):

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.12 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GPP	Geranyl diphoshate

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_JABAOB010000002.1 - Region 4 - NRPS-like,terpene

Download region GenBank file

Download region SVG

Location: 670,110 - 723,627 nt. (total: 53,518 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: halogenase methyltransferase

HGH90_RS10620: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

HGH90_RS10640: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: dehalogenase esterase

HGH90_RS10630: thioesterase

smcogs: SMCOG1004: thioesterase

HGH90_RS10645: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

HGH90_RS10670: putative esterase

smcogs: SMCOG1104: putative esterase

Lyases: cyclase

HGH90_RS31635: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

HGH90_RS10590: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HGH90_RS10625: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.96	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.94	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.93	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.90	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.88	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.85	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.85	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.84	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	0.84	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000307.4	0.83	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.94 out of 21.55

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.78 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.21 out of 28.19

Confidence: medium

Additional weak hits (6):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.21 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.78 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.28 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.49 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 25.75

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 670109 - 723627:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 670109 - 713214:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 681116 - 723627:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

HGH90_RS10590: X

AMP-binding (46..440): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDISIWESFTFSAGEIDYYGPTEYTVYATH
Nearest Stachelhaus code(s):: Aol DIWFVAGIYK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

HGH90_RS10625: X

AMP-binding (264..657): X

nrpys: Tyr, Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: MDQAFDASISEMTLITAGEYNAYGPTENSVCTTI
Nearest Stachelhaus code(s):: Tyr or Pro DASTIAAVCK (82% 8Å match); Tyr DASTIAAVCK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JABAOB010000002.1 - Region 5 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 807,607 - 832,828 nt. (total: 25,222 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

HGH90_RS11045: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

HGH90_RS11060: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.70	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.67	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0001727.3	0.37	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0002307.3	0.27	ribosomal	humidimycin	Streptomyces humidus
BGC0002015.4	0.27	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001928.2	0.25	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000874.5	0.23	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000903.3	0.23	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000796.3	0.22	saccharide	S-layer glycan	Paenibacillus alvei

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.70	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.67	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0001727.3	0.37	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0002307.3	0.27	ribosomal	humidimycin	Streptomyces humidus
BGC0002015.4	0.27	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001928.2	0.25	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000874.5	0.23	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000903.3	0.23	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000796.3	0.22	saccharide	S-layer glycan	Paenibacillus alvei

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for HGH90_RS11045

HGH90_RS11055

Leader:

MKKVTAKKLNLGKIKVAALSSQSNAQSN

Core:

APQMAATGVLCVISFRVCTDNMSQGAPICSVDSCRF

Core with dehydrations:

APQMAADhbGVLCysVIDhaFRVCysDhbDNMDhaQGAPICysDhaVDDhaCysRF

antiSMASH-DB 4.0 matches for HGH90_RS11055

100.0%

NZ_JABAOB010000002.1:

Lanthipeptides: HGH90_RS11055_lanthipeptide

1

APQMAATGVLCVISFRVCTDNMSQGAPICSVDSCRF

36

APQMAATGVLCVISFRVCTDNMSQGAPICSVDSCRF

1

APQMAATGVLCVISFRVCTDNMSQGAPICSVDSCRF

36

91.7%

NZ_JABAHZ010000001.1and 1 other:

NZ_JABAIB010000012.1 Lanthipeptides: HGH93_RS29940_lanthipeptide

Lanthipeptides: HGH91_RS06760_lanthipeptide

4

MAATGVLCVISFRVCTDNMSQGAPICSVDSCRF

36

MAATGVLCVISFRVCTDNMSQGAPICSVDSCRF

1

MAATGVLCVISFRVCTDNMSQGAPICSVDSCRF

33

66.7%

NZ_FUZZ01000005.1:

Lanthipeptides: B5Z18_RS28600_lanthipeptide

3

QMAATGVLCVI--SFRVCTDNMSQGAPICSVDSCRF

36

QMAAT C + S R+CTDN+SQGAPICS+DSCR+

1

QMAATVGTCSVLCSLRICTDNISQGAPICSLDSCRY

36

with 6 more sequence matches

41.7%

NZ_FPIZ01000007.1:

Lanthipeptides: BT118_RS34215_lanthipeptide

13

ISFRVCTDNMSQGAPICSVDSCRF

36

+SF VCT+N SQ ICS+DSCR+

7

VSFAVCTNNASQVLSICSIDSCRY

30

36.1%

NZ_QLMA01000005.1:

Lanthipeptides: CLV59_RS17395_lanthipeptide

21

NMSQGAPICSVDSCRF

36

N S GAPICS+DSCRF

16

NTSMGAPICSIDSCRF

31

30.6%

NZ_FUZZ01000005.1:

Lanthipeptides: B5Z18_RS28595_lanthipeptide

22

MSQGAPICSVDSCRF

36

+SQGAP+CS DSC F

16

LSQGAPVCSEDSCIF

30

19.4%

NZ_SHKR01000011.1:

Lanthipeptides: allorf_1651888_1652001_lanthipeptide

15

FRVCTDNMSQGAPICSVDSCR

35

F+ CT + A + + SCR

4

FQACTGGLWPVAEVYVLSSCR

24

18.9%

NZ_CP069396.1and 1 other:

NZ_CP069396.1 Lanthipeptides: allorf_03493802_03493966_lanthipeptide

Lanthipeptides: allorf_03493802_03493966_lanthipeptide

22

MSQGAPICSVDSCRF

36

+S AP+C S RF

6

LSASAPVCGPSSSRF

20

15.2%

NZ_CP096021.1:

Lanthipeptides: allorf_392974_393144_lanthipeptide

3

QMAATGVLCVISF

15

Q AAT LC F

26

QRAATAFLCATDF

38

MIBiG 4.0 matches for HGH90_RS11055

13.9%

BGC0000582.4 (ADR72962.1):

Linaridin: cypemycin

24

QGAPICSV

31

QG+ IC V

14

QGSTICLV

21

11.1%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

21

NMSQGAPICSVD

32

NM CS+

20

NMKTATCHCSIH

31

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 27.83 out of 32.93

Confidence: medium

Additional weak hits (6):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.72 out of 32.93

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.86 out of 26.85

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.79 out of 30.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.54 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.52 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.80 out of 26.12

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

HGH90_RS11055 - Class I

Cleavage pHMM score: -8.50

RODEO score: 16

Monoisotopic mass: 3668.7 Da

Molecular weight: 3671.3 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3689.3 Da N = 1; 3707.3 Da N = 2

TFBS definitions

Regulator	Description
LexA variant 3	Repressor of DNA damage response
ToxT	Regulator of MSHA biosynthesis

NZ_JABAOB010000003.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 102,772 - 123,752 nt. (total: 20,981 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

HGH90_RS11875: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase

HGH90_RS11915: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002049.3	0.40	ribosomal	microviridin N9, microviridin N8, microviridin N7, microviridin N6, microviridin N5, microviridin N4, microviridin N3	Nostoc punctiforme PCC 73102
BGC0000892.4	0.31	other (other)	caryoynencin	Burkholderia gladioli BSR3
BGC0002804.2	0.31	other (other)	protegencin	Pseudomonas protegens CHA0
BGC0001480.3	0.29	other (other)	tundrenone	Methylobacter tundripaludum 21/22
BGC0001392.5	0.29	ribosomal	pinensins	Chitinophaga pinensis DSM 2588
BGC0000443.5	0.29	NRPS	thanamycin	Pseudomonas sp. SHC52
BGC0002123.3	0.28	NRPS, PKS	pseudovibriamide A1, pseudovibriamide B1, pseudovibriamide A2, pseudovibriamide A3, pseudovibriamide A4, pseudovibriamide B2, pseudovibriamide A5, pseudovibriamide A6, pseudovibriamide B3, pseudovibriamide B4, pseudovibriamide B6, pseudovibriamide B5	Pseudovibrio brasiliensis Ab134
BGC0002007.2	0.28	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001950.4	0.24	NRPS	puwainaphycin F, minutissamide A	Cylindrospermum moravicum CCALA 993
BGC0001951.4	0.24	NRPS	puwainaphycin F, minutissamide A	Cylindrospermum alatosporum CCALA 994

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002049.3	0.40	ribosomal	microviridin N9, microviridin N8, microviridin N7, microviridin N6, microviridin N5, microviridin N4, microviridin N3	Nostoc punctiforme PCC 73102
BGC0000892.4	0.31	other (other)	caryoynencin	Burkholderia gladioli BSR3
BGC0002804.2	0.31	other (other)	protegencin	Pseudomonas protegens CHA0
BGC0001480.3	0.29	other (other)	tundrenone	Methylobacter tundripaludum 21/22
BGC0001392.5	0.29	ribosomal	pinensins	Chitinophaga pinensis DSM 2588
BGC0000443.5	0.29	NRPS	thanamycin	Pseudomonas sp. SHC52
BGC0002123.3	0.28	NRPS, PKS	pseudovibriamide A1, pseudovibriamide B1, pseudovibriamide A2, pseudovibriamide A3, pseudovibriamide A4, pseudovibriamide B2, pseudovibriamide A5, pseudovibriamide A6, pseudovibriamide B3, pseudovibriamide B4, pseudovibriamide B6, pseudovibriamide B5	Pseudovibrio brasiliensis Ab134
BGC0002007.2	0.28	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001950.4	0.24	NRPS	puwainaphycin F, minutissamide A	Cylindrospermum moravicum CCALA 993
BGC0001951.4	0.24	NRPS	puwainaphycin F, minutissamide A	Cylindrospermum alatosporum CCALA 994

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

HGH90_RS11915: T1TS

Domain 1 (9 - 307): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.31 out of 26.06

Confidence: medium

Additional weak hits (3):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.49 out of 26.06

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.07 out of 32.38

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.65 out of 32.38

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes

NZ_JABAOB010000003.1 - Region 2 - NAPAA,arylpolyene,resorcinol

Download region GenBank file

Download region SVG

Location: 520,067 - 598,851 nt. (total: 78,785 nt) Show pHMM detection rules used

resorcinol: DarB
arylpolyene: (APE_KS1 or APE_KS2)
NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

HGH90_RS13590: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HGH90_RS13810: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase

HGH90_RS13760: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Ligases: ligase synthase

HGH90_RS13665: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

HGH90_RS13680: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

HGH90_RS13710: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

HGH90_RS13830: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001526.4	0.37	other (other)	bartoloside E, bartoloside F, bartoloside G, bartoloside H, bartoloside I, bartoloside J, bartoloside K	Synechocystis salina LEGE 06099
BGC0001525.3	0.35	other (other)	bartoloside B, bartoloside C, bartoloside D	Synechocystis salina LEGE 06155
BGC0000235.5	0.33	PKS	kiamycin	Streptomyces sp. W007
BGC0002477.3	0.30	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0000838.3	0.29	PKS	flexirubin	Flavobacterium johnsoniae UW101
BGC0001928.2	0.28	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001135.5	0.27	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001427.4	0.27	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001425.4	0.27	NRPS, PKS	myxochromide A	Myxococcus xanthus DK 1622
BGC0001426.4	0.27	NRPS, PKS	myxochromide A	Myxococcus xanthus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.10 out of 26.06

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.39 out of 25.88

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.16 out of 20.97

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.83 out of 27.78

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.74 out of 25.88

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.56 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.34 out of 27.78

Confidence: medium

Additional weak hits (19):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.20 out of 32.74

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.23 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.40 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.00 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.04 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.59 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.09 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.27 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.49 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.83 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.90 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.29 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.42 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.91 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.82 out of 28.14

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.34 out of 29.51

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.43 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 24.16 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 520066 - 598851:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 564951 - 598851:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

HGH90_RS13830: X

AMP-binding (16..398): X

nrpys: Orn, Lys, Arg

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAEFFDMWCEELHANAGGEFNSYGPTETTVSATF
Nearest Stachelhaus code(s):: Orn DMETDGSVNK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes
PsrA	Oleic acid responsive regulator
ToxT	Regulator of MSHA biosynthesis

NZ_JABAOB010000004.1 - Region 1 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 6,744 - 145,136 nt. (total: 138,393 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

HGH90_RS15065: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

HGH90_RS15080: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

HGH90_RS15155: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Transferases: PPTase carbamoyltransferase glycosyltransferase

HGH90_RS15015: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

HGH90_RS15050: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

HGH90_RS15055: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

HGH90_RS15060: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

Hydrolases: deaminase esterase hydrolase phosphatase

HGH90_RS15045: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

HGH90_RS15070: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

HGH90_RS15095: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

HGH90_RS15190: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

HGH90_RS15210: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

HGH90_RS15225: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

HGH90_RS15035: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HGH90_RS15040: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

HGH90_RS15090: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

HGH90_RS15110: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HGH90_RS15115: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HGH90_RS15125: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HGH90_RS15130: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HGH90_RS15135: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

HGH90_RS15145: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

HGH90_RS15150: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

HGH90_RS15160: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

HGH90_RS15165: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

HGH90_RS15170: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

HGH90_RS15175: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HGH90_RS15245: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	1.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	1.58	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.56	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	1.55	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	1.53	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	1.52	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	1.48	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	1.43	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000342.4	1.41	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001641.4	0.72	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.69 out of 21.55

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 24.50 out of 27.55

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.60 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.50 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.94 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.67 out of 28.19

Confidence: medium

Additional weak hits (8):

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.36 out of 30.11

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.06 out of 29.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.45 out of 29.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.59 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.53 out of 30.25

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.95 out of 32.93

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.96 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 6743 - 145136:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - D-Asn) + (Gly - ohmal - D-X - Ala) + (X - X - D-Asn) + (D-Thr - Cys - Asn) + (ohmal) + (D-X - Gln) + (ohmal) + (X) + (Ser) + (ccmal - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 6743 - 143304:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - D-Asn) + (Gly - ohmal - D-X - Ala) + (X - X - D-Asn) + (D-Thr - Cys - Asn) + (ohmal) + (D-X - Gln) + (ohmal) + (X) + (Ser) + (ccmal - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 6743 - 136586:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - D-Asn) + (Gly - ohmal - D-X - Ala) + (X - X - D-Asn) + (D-Thr - Cys - Asn) + (ohmal) + (D-X - Gln) + (ohmal) + (X) + (Ser) + (ccmal - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 103339 - 145136:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - Gln) + (ohmal) + (X) + (Ser) + (ccmal - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

HGH90_RS15035: fatty_acid - Asn

Search NORINE for peptide: strict or relaxed

CAL_domain (34..476): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 198.0
NH2: 45.6
Acetyl-CoA: 13.6
shikimic_acid: 0.0
AHBA: 0.0

AMP-binding (1118..1518): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWGTFDLTITSVKLIVGGEYNEYGPTEATVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

HGH90_RS15090: Gly - mal - X - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (467..856): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDIFVLELQFLLGGEYNVYGPTETTVWTSV
Nearest Stachelhaus code(s):: Gly DILQLGVVWK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

PKS_AT (1564..1846): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 83.0
inactive: 58.5
Methoxymalonyl-CoA: 56.5
Methylmalonyl-CoA: 36.9
fatty_acid: 32.2
Isobutyryl-CoA: 21.3
Propionyl-CoA: 14.8
3-Methylbutyryl-CoA: 10.7
Acetyl-CoA: 10.6
Ethylmalonyl-CoA: 10.3
2-Methylbutyryl-CoA: 9.8
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0

AMP-binding (2987..3378): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: M-LGFDAAVFEYFFLLGGDFNGYGPTENTVFTTF
Nearest Stachelhaus code(s):: Phe DCFFLGGVFK (50% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4499..4894): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TCLTFDVCIQEECLFVAGEINAYGPTEASIYASL
Nearest Stachelhaus code(s):: Ala DVWCIAAIYK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

HGH90_RS15110: X - X

AMP-binding (11..411): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWESFDAVLRDLHCIMAGEVNLYGATEVTMAKTW
Nearest Stachelhaus code(s):: Asp DVRHFALMAK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1051..1446): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWETFDAILRDVHCLLSGEVNLYGPTETTMIKTC
Nearest Stachelhaus code(s):: Ala DAWHISLMDK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

HGH90_RS15115: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (268..660): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATFDLTITSLKLIVGGEYNEYGPTEATVGCAI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

HGH90_RS15125: Thr - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (468..862): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNDHFDFSVWEGNQIFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1972..2389): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: LWVSFDLSVYDGDSFLSGDIALGGATEATVWSNS
Nearest Stachelhaus code(s):: Cys DLFDFSLVWK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

HGH90_RS15130: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (16..408): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATFDLTLTSTKLIVGGEFNEYGPTETTVGAMV
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

HGH90_RS15135: mal

PKS_AT (527..823): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 113.3
inactive: 87.1
Methoxymalonyl-CoA: 53.6
Methylmalonyl-CoA: 42.7
Propionyl-CoA: 21.8
2-Methylbutyryl-CoA: 16.4
Ethylmalonyl-CoA: 10.5
Isobutyryl-CoA: 7.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

HGH90_RS15145: X - Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (269..670): X

nrpys: Glu, Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HGKTFDISIWQAQVISTGEANGYGPTEAADNVLH
Nearest Stachelhaus code(s):: Asp DIWQSTADDK (62% 8Å match); dnmeProp or Dab DIWQSTADDK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1778..2179): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLSFDASVQHGDGLIAGETNLYGPTETCVDSTF
Nearest Stachelhaus code(s):: Gln DAQDLGVVDK (76% 8Å match); Ile DAQDLGVVDK (68% 8Å match); Dpr DAQDLAVVNK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

HGH90_RS15150: mal

PKS_AT (526..819): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 147.6
inactive: 104.4
Methoxymalonyl-CoA: 51.5
Methylmalonyl-CoA: 38.4
Propionyl-CoA: 28.8
fatty_acid: 18.1
Isobutyryl-CoA: 11.9
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

HGH90_RS15160: X

AMP-binding (274..679): X

nrpys: Glu, Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGMSFDACMQLGDGIYGGDTNVYGPTECTVNATS
Nearest Stachelhaus code(s):: Glu DAKDIGVVDK (65% 8Å match); Gln DAQDLGVVDK (62% 8Å match); Ile DAQDLGVVDK (59% 8Å match); Dpr DAQDLAVVNK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

HGH90_RS15165: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (480..880): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSMWEWHFFSSGEVNLYGPTEATVDVTY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

HGH90_RS15170: mal

PKS_AT (537..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 109.1
inactive: 82.1
Methoxymalonyl-CoA: 46.0
Methylmalonyl-CoA: 38.6
Propionyl-CoA: 30.1
fatty_acid: 12.0
2-Methylbutyryl-CoA: 10.9
Ethylmalonyl-CoA: 8.5
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

HGH90_RS15175: X

AMP-binding (16..414): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAFTHTVSVLDGHSILGGEVNLYGSSEILMAFSQ
Nearest Stachelhaus code(s):: Asp DVRHFALMAK (47% 8Å match); nDodec DVLFIGGVAK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
ZuR variant 1	Zinc-responsive repressor

NZ_JABAOB010000006.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 98,972 - 109,898 nt. (total: 10,927 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase

HGH90_RS20130: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000895.5	0.39	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0000684.4	0.37	PKS	asperthecin	Aspergillus nidulans FGSC A4
BGC0000723.5	0.22	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus
BGC0000982.5	0.22	NRPS, PKS	cystothiazole A	Cystobacter fuscus
BGC0000722.5	0.22	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. jinggangensis
BGC0000203.3	0.21	PKS	BE-7585A	Amycolatopsis orientalis subsp. vinearia

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000895.5	0.39	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0000684.4	0.37	PKS	asperthecin	Aspergillus nidulans FGSC A4
BGC0000723.5	0.22	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus
BGC0000982.5	0.22	NRPS, PKS	cystothiazole A	Cystobacter fuscus
BGC0000722.5	0.22	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. jinggangensis
BGC0000203.3	0.21	PKS	BE-7585A	Amycolatopsis orientalis subsp. vinearia

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 23.52 out of 26.33

Confidence: strong

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.77 out of 29.25

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.55 out of 21.55

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.93 out of 26.33

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.79 out of 32.93

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.52 out of 29.72

Confidence: medium

Additional weak hits (5):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.47 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.11 out of 26.06

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.07 out of 20.01

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.59 out of 27.04

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
ArcA	Repressor of carbon oxidation
LexA variant 3	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C
SypG	Regulator of biofilm formation and host colonization

NZ_JABAOB010000007.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 301,595 - 322,566 nt. (total: 20,972 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

HGH90_RS23460: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Lyases: cyclase

HGH90_RS23445: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001642.3	0.74	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0002631.2	0.48	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000902.4	0.45	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002103.2	0.41	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000285.5	0.38	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0002031.3	0.36	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0001483.4	0.32	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001529.5	0.30	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000143.5	0.29	PKS	salinomycin	Streptomyces albus
BGC0001374.5	0.28	other (other)	thienodolin	Streptomyces albogriseolus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001642.3	0.74	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0002631.2	0.48	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000902.4	0.45	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002103.2	0.41	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000285.5	0.38	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0002031.3	0.36	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0001483.4	0.32	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001529.5	0.30	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000143.5	0.29	PKS	salinomycin	Streptomyces albus
BGC0001374.5	0.28	other (other)	thienodolin	Streptomyces albogriseolus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene			C10	C1-C10	none
sesquiterpene			C15	C1-C10	none

Genes with terpene domains:

HGH90_RS23445: T1TS

Domain 1 (1 - 315): Type 1 terpene synthase

Subtype: Germacrene A synthase type

Reactions:: GPP → monoterpene_C1-C10; FPP → sesquiterpene_C1-C10

Transcription Factor Binding Sites

Binding sites found:

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.55 out of 21.55

Confidence: strong

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.18 out of 21.55

Confidence: medium

Additional weak hits (2):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.70 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.47 out of 26.06

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GPP	Geranyl diphoshate

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation

NZ_JABAOB010000008.1 - Region 1 - arylpolyene

Download region GenBank file

Download region SVG

Location: 1 - 39,532 nt. (total: 39,532 nt) Show pHMM detection rules used

Region on contig edge.

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

HGH90_RS23980: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HGH90_RS24080: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: halogenase methyltransferase

HGH90_RS23955: methyltransferase

smcogs: SMCOG1248: methyltransferase

HGH90_RS24020: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

HGH90_RS24025: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

Hydrolases: deacetylase esterase

HGH90_RS24050: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

HGH90_RS24115: putative esterase

smcogs: SMCOG1104: putative esterase

Ligases: synthase

HGH90_RS23985: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

HGH90_RS24015: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

HGH90_RS24040: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

HGH90_RS24070: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Translocases: transport

HGH90_RS24075: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000107.3	0.57	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000866.5	0.50	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000231.5	0.49	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.48	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000107.3	0.57	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000866.5	0.50	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000231.5	0.49	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.48	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

Additional weak hits (6):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.68 out of 26.85

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.04 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.27 out of 31.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.70 out of 32.93

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.72 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

HGH90_RS24095: X

AMP-binding (69..334): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTLY---GIRKGVGVCIGEYSTYASTEMQTAFTE
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_JABAOB010000009.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 165,492 - 247,459 nt. (total: 81,968 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deaminase dehalogenase esterase

HGH90_RS26075: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

HGH90_RS26105: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

HGH90_RS26135: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

HGH90_RS26100: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

HGH90_RS26115: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

HGH90_RS26120: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

HGH90_RS26125: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.91	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.88	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.84	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.82	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.81	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.80	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.80	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.80	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.79	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.78	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.77	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.76	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.76	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.74	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.98 out of 27.55

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.75 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.90 out of 28.19

Confidence: medium

Additional weak hits (11):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.82 out of 27.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.17 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.99 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.32 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.85 out of 31.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.73 out of 32.93

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 22.40

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.98 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.78 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.16 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.75 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 165491 - 247459:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - mal - NMe-Val - X) + (Val - X) + (NMe-X - Thr - D-Asp - D-Leu - Phe)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

HGH90_RS26115: fatty_acid - mal - Val - X

Search NORINE for peptide: strict or relaxed

CAL_domain (162..479): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 119.0
NH2: 48.7
Acetyl-CoA: 17.3
shikimic_acid: 0.0
AHBA: 0.0

PKS_AT (1216..1512): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 169.9
inactive: 120.3
Methoxymalonyl-CoA: 61.1
Methylmalonyl-CoA: 56.9
Isobutyryl-CoA: 33.0
Propionyl-CoA: 31.9
2-Methylbutyryl-CoA: 31.8
Benzoyl-CoA: 28.0
CHC-CoA: 24.8
Ethylmalonyl-CoA: 23.9
Acetyl-CoA: 17.4
fatty_acid: 16.9
3-Methylbutyryl-CoA: 14.2
trans-1,2-CPDA: 13.2

AMP-binding (2745..3146): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGGGFDATTIEGWFMAGGEINGYGPTENTTFSLT
Nearest Stachelhaus code(s):: Val DALWMGGTFK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4211..4612): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISVWQAELLVTGEVNAYGPTEASDDITH
Nearest Stachelhaus code(s):: Dpr DIWELTADDK (88% 8Å match); Dab DIWELTADDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

HGH90_RS26120: Val - X

Search NORINE for peptide: strict or relaxed

AMP-binding (546..946): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LGGGFDATTIEGWFMVGGEINGYGPTENTTFSLT
Nearest Stachelhaus code(s):: Val DALWMGGTFK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1603..2004): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISVWQAEVLVTGEVNAYGPTEASDDITH
Nearest Stachelhaus code(s):: Dpr DIWELTADDK (91% 8Å match); Dab DIWELTADDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

HGH90_RS26125: X - Thr - Asp - Leu - Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (546..940): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDGTTFDSLFLFGGEVNMYGPTEITVAATC
Nearest Stachelhaus code(s):: Leu DGFLLGMVYK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2005..2410): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LTDHFDFSVWEGNQIFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3064..3461): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGLSTDLGNTVGKIIFGGEVNHYGPTETTIGKLL
Nearest Stachelhaus code(s):: Asp DLTKIGHIGK (71% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4589..4982): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNMSFDASCFESLLISGGEFNAYGPTENSVITTM
Nearest Stachelhaus code(s):: Leu DAFLIGAVMK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (6106..6499): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LSQAFDASCYENVLVSAGEINAYGPTENTVCTSL
Nearest Stachelhaus code(s):: Tyr DASTVAAVCK (79% 8Å match); Phe DAWTVAAVCK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
ZuR variant 1	Zinc-responsive repressor