GCF_012395365.1 - 14 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JAAVIO010000001.1 (Bacillus toyonensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRP-metallophore,NRPS	110,103	161,849	High	bacillibactin	NRPS:Type I
Region 1.2	NI-siderophore	490,147	521,860	High	petrobactin	other:other
Region 1.3	azole-containing-RiPP	1,166,317	1,189,823

NZ_JAAVIO010000012.1 (Bacillus toyonensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	thioamide-NRP	38,742	114,593

NZ_JAAVIO010000013.1 (Bacillus toyonensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	betalactone	30,531	55,769	Low	fengycin	NRPS:Type I
Region 5.2	RiPP-like	115,759	126,082

NZ_JAAVIO010000002.1 (Bacillus toyonensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	terpene-precursor	639,419	660,309

NZ_JAAVIO010000005.1 (Bacillus toyonensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	RiPP-like	187,714	198,001

NZ_JAAVIO010000006.1 (Bacillus toyonensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 27.1	NRPS	141,673	188,683
Region 27.2	RiPP-like	206,320	216,586

NZ_JAAVIO010000007.1 (Bacillus toyonensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 28.1	lassopeptide	28,023	51,930	Medium	paeninodin	ribosomal:unmodified
Region 28.2	terpene	159,559	181,412	Low	molybdenum cofactor	other:other

NZ_JAAVIO010000008.1 (Bacillus toyonensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 29.1	NRPS	39,145	83,236	Low	puwainaphycin A/puwainaphycin B/puwainaphycin C/puwainaphycin D	NRPS:Type I+PKS

NZ_JAAVIO010000009.1 (Bacillus toyonensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 30.1	NRPS-like	80,721	124,302

No secondary metabolite regions were found in these records:: NZ_JAAVIO010000010.1 (Bacillus toyonensis); NZ_JAAVIO010000011.1 (Bacillus toyonensis); NZ_JAAVIO010000014.1 (Bacillus toyonensis); NZ_JAAVIO010000015.1 (Bacillus toyonensis); NZ_JAAVIO010000016.1 (Bacillus toyonensis); NZ_JAAVIO010000017.1 (Bacillus toyonensis); NZ_JAAVIO010000018.1 (Bacillus toyonensis); NZ_JAAVIO010000019.1 (Bacillus toyonensis); NZ_JAAVIO010000020.1 (Bacillus toyonensis); NZ_JAAVIO010000021.1 (Bacillus toyonensis); NZ_JAAVIO010000022.1 (Bacillus toyonensis); NZ_JAAVIO010000023.1 (Bacillus toyonensis); NZ_JAAVIO010000024.1 (Bacillus toyonensis); NZ_JAAVIO010000025.1 (Bacillus toyonensis); NZ_JAAVIO010000026.1 (Bacillus toyonensis); NZ_JAAVIO010000027.1 (Bacillus toyonensis); NZ_JAAVIO010000028.1 (Bacillus toyonensis); NZ_JAAVIO010000029.1 (Bacillus toyonensis); NZ_JAAVIO010000003.1 (Bacillus toyonensis); NZ_JAAVIO010000030.1 (Bacillus toyonensis); NZ_JAAVIO010000004.1 (Bacillus toyonensis)

Compact view

NZ_JAAVIO010000001.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 110,103 - 161,849 nt. (total: 51,747 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

HB668_RS00580: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

HB668_RS00670: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HB668_RS00730: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

HB668_RS00735: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

HB668_RS00740: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase

HB668_RS00635: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: hydrolase protease

HB668_RS00610: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

HB668_RS00655: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: hydratase

HB668_RS00720: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Isomerases: isomerase

HB668_RS00665: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

HB668_RS00575: Pseudouridine synthase

smcogs: SMCOG1154: Pseudouridine synthase

HB668_RS00650: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

HB668_RS00660: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001185.5	1.05	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	0.88	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0000401.5	0.86	NRPS	paenibactin	Paenibacillus elgii B69
BGC0002075.3	0.86	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.85	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001132.4	0.77	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.74	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001185.5	0.80	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	0.75	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0000401.5	0.74	NRPS	paenibactin	Paenibacillus elgii B69
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.74	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.53 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.45 out of 26.06

Confidence: strong

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.21 out of 30.25

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.52 out of 30.25

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.12 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 22.22 out of 23.05

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.80 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.28 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.40 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.53 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.83 out of 27.78

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.05 out of 20.97

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.67 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.65 out of 28.19

Confidence: medium

Additional weak hits (5):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 29.77 out of 39.62

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.49 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 25.83 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.73 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.42 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 110102 - 161849:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

HB668_RS00650: Gly - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (464..864): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDISALELQALVGGETNLYGPTETTIWSTF
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1524..1937): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEINMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

HB668_RS00660: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SVSLYPMSSPGGALQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PMPAQGVVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
FuR variant 1	Ferric Uptake Regulator
IolR	Regulator of the inositol catabolism
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor

NZ_JAAVIO010000001.1 - Region 2 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 490,147 - 521,860 nt. (total: 31,714 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

HB668_RS02535: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: deacetylase

HB668_RS02600: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Ligases: ligase synthase

HB668_RS02570: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HB668_RS02640: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.4	0.88	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000295.5	0.53	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002620.2	0.50	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002464.3	0.49	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002458.3	0.48	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0001498.5	0.48	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0002470.2	0.47	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.4	0.88	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000295.5	0.53	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002620.2	0.50	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002464.3	0.49	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002458.3	0.48	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0001498.5	0.48	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0002470.2	0.47	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 15.13 out of 18.16

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.71 out of 25.88

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.38 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.93 out of 28.19

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.60 out of 32.93

Confidence: medium

Additional weak hits (5):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.60 out of 36.54

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.50 out of 32.74

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.58 out of 19.52

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.54 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
FuR variant 1	Ferric Uptake Regulator
LexA variant 3	Repressor of DNA damage response
PsrA	Oleic acid responsive regulator
ZuR variant 1	Zinc-responsive repressor

NZ_JAAVIO010000001.1 - Region 3 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 1,166,317 - 1,189,823 nt. (total: 23,507 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

HB668_RS05980: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: methyltransferase

HB668_RS05965: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002013.4	0.44	ribosomal	curacozole	Streptomyces curacoi
BGC0000607.5	0.43	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001535.3	0.43	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001146.5	0.41	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001173.5	0.41	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000606.5	0.39	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001860.4	0.39	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000613.5	0.38	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0001145.5	0.38	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000628.4	0.38	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002013.4	0.44	ribosomal	curacozole	Streptomyces curacoi
BGC0000607.5	0.43	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001535.3	0.43	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001146.5	0.41	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001173.5	0.41	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000606.5	0.39	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001860.4	0.39	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000613.5	0.38	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0001145.5	0.38	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000628.4	0.38	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.71 out of 31.73

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 18.17 out of 30.12

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Heterocycloanthracin_C_RRE; Location: 0 - 100; Score: 181.1; RRE type: Thiopeptide_F_RRE; Location: 10 - 89; Score: 39.4

TFBS definitions

Regulator	Description

Core peptide predictions

No core peptides found.

NZ_JAAVIO010000012.1 - Region 1 - thioamide-NRP

Download region GenBank file

Download region SVG

Location: 38,742 - 114,593 nt. (total: 75,852 nt) Show pHMM detection rules used

thioamide-NRP: (ATP-grasp and AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase reductase

HB668_RS26550: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

HB668_RS26640: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

HB668_RS26670: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

HB668_RS26680: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

HB668_RS26685: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

HB668_RS26715: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

HB668_RS26745: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

Transferases: aminotransferase glycosyltransferase transferase

HB668_RS26600: aminotransferase

smcogs: SMCOG1019: aminotransferase

HB668_RS26725: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

HB668_RS26730: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

HB668_RS26735: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: deaminase

HB668_RS26495: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: decarboxylase dehydratase

HB668_RS26560: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

HB668_RS26740: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

HB668_RS26510: argininosuccinate synthase

smcogs: SMCOG1291: argininosuccinate synthase

HB668_RS26525: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HB668_RS26585: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HB668_RS26605: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

HB668_RS26610: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

HB668_RS26665: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

HB668_RS26750: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HB668_RS26760: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

HB668_RS26765: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.58	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000898.5	0.52	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000772.5	0.49	saccharide	lipopolysaccharide	Brucella melitensis
BGC0002499.2	0.48	NRPS, PKS	enteromycin	Streptomyces achromogenes subsp. streptozoticus
BGC0001891.3	0.48	other (other)	closthioamide	Ruminiclostridium cellulolyticum H10
BGC0000899.4	0.47	saccharide	desosamine	Streptomyces narbonensis
BGC0000690.5	0.47	saccharide	hydroxystreptomycin	Streptomyces glaucescens
BGC0000245.5	0.47	PKS	medermycin	Streptomyces sp. AM-7161
BGC0000760.5	0.46	saccharide	emulsan	Acinetobacter venetianus RAG-1 = CIP 110063

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.58	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000898.5	0.52	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000772.5	0.49	saccharide	lipopolysaccharide	Brucella melitensis
BGC0002499.2	0.48	NRPS, PKS	enteromycin	Streptomyces achromogenes subsp. streptozoticus
BGC0001891.3	0.48	other (other)	closthioamide	Ruminiclostridium cellulolyticum H10
BGC0000899.4	0.47	saccharide	desosamine	Streptomyces narbonensis
BGC0000690.5	0.47	saccharide	hydroxystreptomycin	Streptomyces glaucescens
BGC0000245.5	0.47	PKS	medermycin	Streptomyces sp. AM-7161
BGC0000760.5	0.46	saccharide	emulsan	Acinetobacter venetianus RAG-1 = CIP 110063

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 22.67 out of 26.33

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.33 out of 18.16

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.81 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.49 out of 27.78

Confidence: strong

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.47 out of 21.55

Confidence: strong

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.47 out of 21.55

Confidence: strong

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.76 out of 21.55

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.13 out of 20.97

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.08 out of 21.55

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.19 out of 24.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.21 out of 28.19

Confidence: medium

Additional weak hits (4):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 24.05 out of 30.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.04 out of 29.65

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 28.48 out of 39.62

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.27 out of 29.65

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

HB668_RS26525: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (13..412): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: FWGAFDMSIFSIHLGLAGEVNFYGNTEVNEALSY
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

HB668_RS26585: X

AMP-binding (8..391): X

nrpys: Phe, Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ANWLFNTSIL-AVAVSSGTSDLYGVAETGLSILN
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

HB668_RS26750: X

AMP-binding (44..374): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GSYVYGLIGACTFGISSGGQQVYGSTETAIAATH
Nearest Stachelhaus code(s):: Aze DVQFISQIAK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
ArcA	Repressor of carbon oxidation
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JAAVIO010000013.1 - Region 1 - betalactone

Download region GenBank file

Download region SVG

Location: 30,531 - 55,769 nt. (total: 25,239 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

HB668_RS27095: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acetyltransferase carboxylase transferase

HB668_RS27100: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

HB668_RS27120: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

HB668_RS27165: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Lyases: hydratase

HB668_RS27115: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

HB668_RS27110: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

HB668_RS27125: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002284.3	0.55	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000131.5	0.46	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000234.5	0.43	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002034.3	0.43	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0001464.3	0.42	other (other)	tetrabromopyrrole	Pseudoalteromonas sp. PS5
BGC0001463.4	0.42	other (other)	2,3,4,5-tetrabromopyrrole	Pseudoalteromonas piscicida
BGC0000623.3	0.42	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0001103.5	0.42	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002284.3	0.55	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000131.5	0.46	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000234.5	0.43	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002034.3	0.43	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0001464.3	0.42	other (other)	tetrabromopyrrole	Pseudoalteromonas sp. PS5
BGC0001463.4	0.42	other (other)	2,3,4,5-tetrabromopyrrole	Pseudoalteromonas piscicida
BGC0000623.3	0.42	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0001103.5	0.42	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.21 out of 26.06

Confidence: strong

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 26.74 out of 28.14

Confidence: strong

Additional weak hits (2):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.62 out of 29.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.37 out of 25.88

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes
PerR	Peroxide regulator

NZ_JAAVIO010000013.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 115,759 - 126,082 nt. (total: 10,324 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

HB668_RS27475: aminotransferase

smcogs: SMCOG1019: aminotransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000896.5	0.29	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0000721.4	0.26	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0001964.2	0.25	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0000172.5	0.23	PKS	Basiliskamide A, Basiliskamide B	Brevibacillus laterosporus PE36
BGC0000381.5	0.23	NRPS	lichenysin	Bacillus licheniformis DSM 13 = ATCC 14580
BGC0000433.5	0.22	NRPS	surfactin	Bacillus velezensis FZB42
BGC0000455.6	0.22	NRPS, saccharide	vancomycin	Amycolatopsis orientalis HCCB10007 (ATCC43491)
BGC0002588.2	0.22	other (other)	enduracididine	uncultured bacterium
BGC0001233.5	0.22	NRPS	feglymycin	Streptomyces sp. DSM 11171
BGC0001461.5	0.21	NRPS	Actinoidin B	Amycolatopsis keratiniphila subsp. nogabecina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000896.5	0.29	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0000721.4	0.26	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0001964.2	0.25	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0000172.5	0.23	PKS	Basiliskamide A, Basiliskamide B	Brevibacillus laterosporus PE36
BGC0000381.5	0.23	NRPS	lichenysin	Bacillus licheniformis DSM 13 = ATCC 14580
BGC0000433.5	0.22	NRPS	surfactin	Bacillus velezensis FZB42
BGC0000455.6	0.22	NRPS, saccharide	vancomycin	Amycolatopsis orientalis HCCB10007 (ATCC43491)
BGC0002588.2	0.22	other (other)	enduracididine	uncultured bacterium
BGC0001233.5	0.22	NRPS	feglymycin	Streptomyces sp. DSM 11171
BGC0001461.5	0.21	NRPS	Actinoidin B	Amycolatopsis keratiniphila subsp. nogabecina

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.16 out of 26.06

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.69 out of 27.55

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.44 out of 32.93

Confidence: medium

Additional weak hits (2):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.92 out of 25.88

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.06 out of 29.72

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes

NZ_JAAVIO010000002.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 639,419 - 660,309 nt. (total: 20,891 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase

HB668_RS10970: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

HB668_RS11000: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

HB668_RS11005: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

HB668_RS11000: PT_FPPS_like

Domain 1 (32 - 295): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: IPP, DMAPP → FPP

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.53 out of 25.88

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.49 out of 27.78

Confidence: medium

Additional weak hits (4):

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 20.93 out of 29.72

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.54 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 25.40 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 25.04 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
PsrA	Oleic acid responsive regulator

NZ_JAAVIO010000005.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 187,714 - 198,001 nt. (total: 10,288 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000516.4	0.37	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0000043.5	0.37	PKS	curacin A	Moorea producens 19L
BGC0002322.3	0.36	ribosomal	citrocin	Citrobacter pasteurii
BGC0000513.3	0.36	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.36	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000504.5	0.35	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001289.5	0.35	ribosomal	penisin	Paenibacillus ehimensis
BGC0000501.3	0.35	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000516.4	0.37	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0000043.5	0.37	PKS	curacin A	Moorea producens 19L
BGC0002322.3	0.36	ribosomal	citrocin	Citrobacter pasteurii
BGC0000513.3	0.36	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.36	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000504.5	0.35	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001289.5	0.35	ribosomal	penisin	Paenibacillus ehimensis
BGC0000501.3	0.35	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.97 out of 26.06

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.07 out of 24.78

Confidence: medium

Additional weak hits (1):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.98 out of 39.62

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
LexA variant 2	Repressor of DNA damage response
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes

NZ_JAAVIO010000006.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 141,673 - 188,683 nt. (total: 47,011 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

HB668_RS20405: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase

HB668_RS20410: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase glucanase hydrolase

HB668_RS20400: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

HB668_RS20430: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

smcogs: SMCOG1283: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

HB668_RS20440: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

HB668_RS20460: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

HB668_RS20525: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: decarboxylase

HB668_RS20455: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: ligase

HB668_RS20450: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.61	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.61	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.58 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.58 out of 20.97

Confidence: medium

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 28.23 out of 31.73

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.91 out of 32.93

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.28 out of 32.93

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 24.13 out of 29.25

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.85 out of 29.25

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.50 out of 28.19

Confidence: medium

Additional weak hits (4):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.88 out of 26.12

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.67 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 141672 - 188683:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

HB668_RS20450: X - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (266..656): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FVMAFDISLLELESLLAGELNIYGPTETTICATV
Nearest Stachelhaus code(s):: Ala DILICALICK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1303..1683): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNTLHSGDISLGGATEASIWSIY
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
HexR	Glucose-responsive regulator
LexA variant 3	Repressor of DNA damage response
SypG	Regulator of biofilm formation and host colonization
ZuR variant 1	Zinc-responsive repressor

NZ_JAAVIO010000006.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 206,320 - 216,586 nt. (total: 10,267 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

HB668_RS20690: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	RiPP-like	Similarity score	Type	Compound(s)	Organism
BGC0001994.4		0.35	other (other)	β-ethynylserine	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002373.3		0.19	NRPS	bonnevillamide D, bonnevillamide E	Streptomyces sp.

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0001994.4		0.35	other (other)	β-ethynylserine	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002373.3		0.19	NRPS	bonnevillamide D, bonnevillamide E	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 25.47 out of 26.06

Confidence: strong

Additional weak hits (1):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.20 out of 19.52

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes

NZ_JAAVIO010000007.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 28,023 - 51,930 nt. (total: 23,908 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase glycosyltransferase

HB668_RS21215: sugar transferase

smcogs: SMCOG1146: sugar transferase

HB668_RS21230: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Hydrolases: esterase hydrolase

HB668_RS21235: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

HB668_RS21300: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

smcogs: SMCOG1283: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001356.4	0.69	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0001634.3	0.52	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000571.3	0.50	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0000742.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000743.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000800.5	0.45	saccharide	xanthan	Xanthomonas campestris
BGC0001410.3	0.45	saccharide	polysaccharide A	Bacteroides fragilis
BGC0000729.3	0.44	saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0000728.5	0.44	saccharide	capsular polysaccharide	Klebsiella pneumoniae subsp. ozaenae
BGC0000741.3	0.44	saccharide	capsular polysaccharide	Streptococcus agalactiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001356.4	0.69	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0001634.3	0.52	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000571.3	0.50	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0000742.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000743.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000800.5	0.45	saccharide	xanthan	Xanthomonas campestris
BGC0001410.3	0.45	saccharide	polysaccharide A	Bacteroides fragilis
BGC0000729.3	0.44	saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0000728.5	0.44	saccharide	capsular polysaccharide	Klebsiella pneumoniae subsp. ozaenae
BGC0000741.3	0.44	saccharide	capsular polysaccharide	Streptococcus agalactiae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for HB668_RS21240

HB668_RS21240

Leader:

MKKEWKQPVLEVLNINMTMA

Full core:

GPGHKYPDAVQPDPDDPVKYS

Putative macrolactam:

GPGHKYPD

antiSMASH-DB 4.0 matches for HB668_RS21240

100.0%

NC_018693.1and 59 others:

NC_022781.1 Lassopeptides: BTOYO_RS27255_lassopeptideNZ_CM000728.1 Lassopeptides: BCERE0017_RS31690_lassopeptideNZ_CM000730.1 Lassopeptides: BCERE0019_RS36035_lassopeptideNZ_CM000731.1 Lassopeptides: BCERE0020_RS32115_lassopeptideNZ_CM000735.1 Lassopeptides: BCERE0024_RS32175_lassopeptideNZ_CM000737.1 Lassopeptides: BCERE0026_RS31860_lassopeptideNZ_CP020743.1 Lassopeptides: B7492_RS34605_lassopeptideNZ_CP035994.1 Lassopeptides: EXW32_RS18065_lassopeptideNZ_CP035999.1 Lassopeptides: EXW27_RS24230_lassopeptideNZ_CP036014.1 Lassopeptides: EXW33_RS03280_lassopeptideNZ_CP036043.1 Lassopeptides: EXW51_RS18015_lassopeptideNZ_CP036052.1 Lassopeptides: EXW64_RS17810_lassopeptideNZ_CP036094.1 Lassopeptides: EXW54_RS18030_lassopeptideNZ_CP036099.1 Lassopeptides: EXW47_RS18145_lassopeptideNZ_CP036145.1 Lassopeptides: EXW57_RS18045_lassopeptideNZ_CP043830.1 Lassopeptides: F0362_RS17980_lassopeptideNZ_CP052061.1 Lassopeptides: G9298_RS06635_lassopeptideNZ_CP064875.1 Lassopeptides: I0K03_RS17615_lassopeptideNZ_CP072061.1 Lassopeptides: J5V93_RS17010_lassopeptideNZ_CP081872.1 Lassopeptides: K6T24_RS17660_lassopeptideNZ_CP084035.1 Lassopeptides: LCF45_RS17830_lassopeptideNZ_CP087103.1 Lassopeptides: HQN46_RS17525_lassopeptideNZ_CP092833.1 Lassopeptides: MLD62_RS18880_lassopeptideNZ_CP093844.1 Lassopeptides: MN033_RS16555_lassopeptideNZ_CP103777.1 Lassopeptides: NYR47_RS18680_lassopeptideNZ_FVZK01000001.1 Lassopeptides: B5493_RS29120_lassopeptideNZ_JAAVIO010000007.1 Lassopeptides: HB668_RS21240_lassopeptideNZ_JAKJPX010000001.1 Lassopeptides: L4B26_RS06135_lassopeptideNZ_JAOPRA010000003.1 Lassopeptides: OCE16_RS10320_lassopeptideNZ_JH791945.1 Lassopeptides: IEC_RS31690_lassopeptideNZ_JH791991.1 Lassopeptides: IEY_RS30355_lassopeptideNZ_JH792120.1 Lassopeptides: IGO_RS31120_lassopeptideNZ_JH792156.1 Lassopeptides: IK3_RS30825_lassopeptideNZ_JH792251.1 Lassopeptides: III_RS32860_lassopeptideNZ_KB976660.1 Lassopeptides: IIS_RS33070_lassopeptideNZ_KB976671.1 Lassopeptides: IG5_RS30930_lassopeptideNZ_KB976677.1 Lassopeptides: IK1_RS32500_lassopeptideNZ_LDHL01000037.1 Lassopeptides: ABD98_RS28390_lassopeptideNZ_LDKD02000001.1 Lassopeptides: ABH17_RS30845_lassopeptideNZ_LR733376.1 Lassopeptides: BOSE29B_RS17275_lassopeptideNZ_MSAB01000002.1 Lassopeptides: BTH38_RS31490_lassopeptideNZ_NFCO01000063.1 Lassopeptides: BK712_RS32350_lassopeptideNZ_NIUP01000001.1 Lassopeptides: CEU84_RS28955_lassopeptideNZ_NIZC01000006.1 Lassopeptides: CEU98_RS29995_lassopeptideNZ_NUAO01000004.1 Lassopeptides: CN544_RS31140_lassopeptideNZ_NUCE01000047.1 Lassopeptides: CN588_RS29240_lassopeptideNZ_NVAU01000015.1 Lassopeptides: COK21_RS29840_lassopeptideNZ_NVFD01000067.1 Lassopeptides: COL35_RS30615_lassopeptideNZ_NVFH01000014.1 Lassopeptides: COL40_RS31160_lassopeptideNZ_NVGS01000015.1 Lassopeptides: COL67_RS30295_lassopeptideNZ_NVGU01000014.1 Lassopeptides: COL71_RS30385_lassopeptideNZ_NVHY01000003.1 Lassopeptides: COM05_RS29590_lassopeptideNZ_NVIC01000011.1 Lassopeptides: COL99_RS31725_lassopeptideNZ_NVIH01000020.1 Lassopeptides: COM10_RS31670_lassopeptideNZ_NVIT01000003.1 Lassopeptides: COM31_RS29110_lassopeptideNZ_NVJC01000012.1 Lassopeptides: COM38_RS29390_lassopeptideNZ_NVOB01000021.1 Lassopeptides: CON62_RS31715_lassopeptideNZ_NVOD01000011.1 Lassopeptides: CON85_RS30265_lassopeptideNZ_NVOV01000023.1 Lassopeptides: CON78_RS31120_lassopeptide

Lassopeptides: MC28_RS36260_lassopeptide

1

GPGHKYPDAVQPDPDDPVKYS

21

GPGHKYPDAVQPDPDDPVKYS

1

GPGHKYPDAVQPDPDDPVKYS

21

95.2%

NZ_CAKJTI010000013.1:

Lassopeptides: LRP84_RS13300_lassopeptide

1

GPGHKYPDAVQPDPDDPVKYS

21

GPGHK PDAVQPDPDDPVKYS

1

GPGHKTPDAVQPDPDDPVKYS

21

95.2%

NZ_CP033906.1:

Lassopeptides: CEF21_RS15100_lassopeptide

1

GPGHKYPDAVQPDPDDPVKYS

21

GPGH+YPDAVQPDPDDPVKYS

1

GPGHRYPDAVQPDPDDPVKYS

21

with 55 more sequence matches

Only the first 10 are displayed here.

95.2%

NZ_CP035962.1and 2 others:

NZ_JAHWJB010000002.1 Lassopeptides: I6L50_RS24160_lassopeptideNZ_JH792148.1 Lassopeptides: IGC_RS31555_lassopeptide

Lassopeptides: EXW30_RS17395_lassopeptide

1

GPGHKYPDAVQPDPDDPVKYS

21

GPGHKYPDA QPDPDDPVKYS

1

GPGHKYPDAAQPDPDDPVKYS

21

95.2%

NZ_CP036073.1and 15 others:

NZ_CP051013.1 Lassopeptides: HCM98_RS19370_lassopeptideNZ_CP089518.1 Lassopeptides: LUS72_RS17965_lassopeptideNZ_FMSK01000028.1 Lassopeptides: CCY74_RS32440_lassopeptideNZ_KB976530.1 Lassopeptides: ICS_RS31505_lassopeptideNZ_KB976980.1 Lassopeptides: KQ1_RS31885_lassopeptideNZ_LCYN01000004.1 Lassopeptides: B4147_RS31680_lassopeptideNZ_LDKE01000024.1 Lassopeptides: ABB04_RS11095_lassopeptideNZ_NTVN01000014.1 Lassopeptides: CN415_RS28390_lassopeptideNZ_NUAK01000012.1 Lassopeptides: CN576_RS29145_lassopeptideNZ_NUCU01000027.1 Lassopeptides: CN607_RS28820_lassopeptideNZ_NUEG01000051.1 Lassopeptides: CN905_RS29150_lassopeptideNZ_NUKY01000024.1 Lassopeptides: COC45_RS31355_lassopeptideNZ_NURM01000056.1 Lassopeptides: COE96_RS29110_lassopeptideNZ_NVFC01000047.1 Lassopeptides: COL36_RS30960_lassopeptideNZ_NVHZ01000037.1 Lassopeptides: COM04_RS29175_lassopeptide

Lassopeptides: EXW45_RS19285_lassopeptide

1

GPGHKYPDAVQPDPDDPVKYS

21

GPGHK PDAVQPDPDDPVKYS

1

GPGHKIPDAVQPDPDDPVKYS

21

90.5%

NZ_CM000719.1and 8 others:

NZ_CP036084.1 Lassopeptides: EXW59_RS23060_lassopeptideNZ_CP036121.1 Lassopeptides: EXW55_RS16555_lassopeptideNZ_JH791923.1 Lassopeptides: IE3_RS30910_lassopeptideNZ_JH792310.1 Lassopeptides: IIG_RS32465_lassopeptideNZ_JH804672.1 Lassopeptides: IG3_RS34520_lassopeptideNZ_KB976152.1 Lassopeptides: IG9_RS30805_lassopeptideNZ_NULE01000003.1 Lassopeptides: COC58_RS30270_lassopeptideNZ_NVFI01000023.1 Lassopeptides: COL41_RS29780_lassopeptide

Lassopeptides: BCERE0007_RS31210_lassopeptide

1

GPGHKYPDAVQPDPDDPVKYS

21

GPGHK PDAVQPDPDD VKYS

1

GPGHKLPDAVQPDPDDAVKYS

21

90.5%

NZ_CP031443.1and 4 others:

NZ_FWZD01000067.1 Lassopeptides: BACERE00177_RS21400_lassopeptideNZ_NTYE01000016.1 Lassopeptides: CN490_RS29030_lassopeptideNZ_NUEY01000038.1 Lassopeptides: CN888_RS28205_lassopeptideNZ_QOSD01000019.1 Lassopeptides: DN410_RS14275_lassopeptide

Lassopeptides: MLA2C4_RS19250_lassopeptide

1

GPGHKYPDAVQPDPDDPVKYS

21

GPGHK PDA+QPDPDDPVKYS

1

GPGHKTPDAIQPDPDDPVKYS

21

90.5%

NZ_CP035978.1and 5 others:

NZ_CP035997.1 Lassopeptides: EXW63_RS23105_lassopeptideNZ_CP036064.1 Lassopeptides: EXW39_RS18255_lassopeptideNZ_KE150045.1 Lassopeptides: IC3_RS30965_lassopeptideNZ_NUPA01000044.1 Lassopeptides: COE20_RS30510_lassopeptideNZ_NVCB01000017.1 Lassopeptides: COK41_RS30460_lassopeptide

Lassopeptides: EXW37_RS17545_lassopeptide

1

GPGHKYPDAVQPDPDDPVKYS

21

GPGHKYPD++QPDPDDPVKYS

1

GPGHKYPDSIQPDPDDPVKYS

21

90.5%

NZ_JACYOF010000019.1:

Lassopeptides: IGI01_RS27610_lassopeptide

1

GPGHKYPDAVQPDPDDPVKYS

21

GPGHK PDAVQPDPDDPVK+S

1

GPGHKTPDAVQPDPDDPVKFS

21

90.5%

NZ_JH792232.1:

Lassopeptides: IIM_RS29450_lassopeptide

1

GPGHKYPDAVQPDPDDPVKYS

21

GPGH+ PDAVQPDPDDPVKYS

1

GPGHRIPDAVQPDPDDPVKYS

21

85.7%

NZ_CP035953.1and 2 others:

NZ_FMJF01000032.1 Lassopeptides: CCY59_RS30575_lassopeptideNZ_JH804628.1 Lassopeptides: IEM_RS31505_lassopeptide

Lassopeptides: EXW58_RS16745_lassopeptide

1

GPGHKYPDAVQPDPDDPVKYS

21

GPG + PDAVQPDPDDPVKYS

1

GPGRRIPDAVQPDPDDPVKYS

21

85.7%

NZ_NUMB01000009.1:

Lassopeptides: COD15_RS30595_lassopeptide

1

GPGHKYPDAVQPDPDDPVKYS

21

GPGH+ PDAVQPDPDD VKYS

1

GPGHRLPDAVQPDPDDAVKYS

21

81.0%

NZ_JAFDQP010000012.1:

Lassopeptides: JRF95_RS21440_lassopeptide

1

GPGHKYPDAVQPDPDDPVKYS

21

GPG K PD+VQPDPDDPVK+S

1

GPGRKTPDSVQPDPDDPVKFS

21

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.42 out of 24.78

Confidence: strong

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 28.44 out of 33.14

Confidence: medium

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

HB668_RS21240 - Class II: Cleavage pHMM score: -15.80; RODEO score: 15; Monoisotopic mass: 2263.0 Da; Molecular weight: 2264.4 Da; Number of bridges: 0

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 13 - 96; Score: 89.7

TFBS definitions

Regulator	Description
LexA variant 2	Repressor of DNA damage response
ZuR variant 2	Zinc-responsive repressor

NZ_JAAVIO010000007.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 159,559 - 181,412 nt. (total: 21,854 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

HB668_RS21925: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

HB668_RS21930: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Lyases: lyase

HB668_RS21955: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000917.3	0.52	other (other)	molybdenum cofactor	Rhodobacter capsulatus
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0000916.5	0.46	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000812.3	0.45	other (other)	huperzine A	Shiraia sp. slf14
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002138.2	0.40	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0001882.3	0.40	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000917.3	0.52	other (other)	molybdenum cofactor	Rhodobacter capsulatus
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0000916.5	0.46	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000812.3	0.45	other (other)	huperzine A	Shiraia sp. slf14
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002138.2	0.40	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0001882.3	0.40	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

HB668_RS21915: T2TS

Domain 1 (6 - 615): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

Additional weak hits (2):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.88 out of 33.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.97 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_JAAVIO010000008.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 39,145 - 83,236 nt. (total: 44,092 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase aminotransferase

HB668_RS22500: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

HB668_RS22605: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Lyases: dehydratase

HB668_RS22505: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

HB668_RS22510: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

HB668_RS22595: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.21 out of 23.79

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.15 out of 29.72

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.83 out of 21.55

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.51 out of 32.93

Confidence: medium

Additional weak hits (3):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.04 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 22.40

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 27.09 out of 39.62

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 39144 - 83236:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

HB668_RS22595: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (502..909): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQIFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
IolR	Regulator of the inositol catabolism
LexA variant 3	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C

NZ_JAAVIO010000009.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 80,721 - 124,302 nt. (total: 43,582 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase

HB668_RS23850: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: phosphorylase phosphotransferase

HB668_RS23815: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

HB668_RS23840: Glucose-specific phosphotransferase enzyme IIA

smcogs: SMCOG1145: Glucose-specific phosphotransferase enzyme IIA

Hydrolases: glucosidase

HB668_RS23845: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Ligases: ligase synthase

HB668_RS23795: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

HB668_RS23810: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.83 out of 27.78

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.08 out of 26.85

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.55 out of 25.88

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 22.91 out of 25.88

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.96 out of 20.97

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.91 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.81 out of 20.97

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.29 out of 27.04

Confidence: medium

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 27.21 out of 33.14

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.52 out of 32.93

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 27.58 out of 32.93

Confidence: medium

Additional weak hits (4):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.13 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.70 out of 25.75

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.78 out of 31.73

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 80720 - 124302:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

HB668_RS23795: X

AMP-binding (225..621): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWMPFDASVWEAALAIGGEHNVYGPTECTVVTTT
Nearest Stachelhaus code(s):: Leu DAWYLGNVVK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
LexA variant 3	Repressor of DNA damage response
PsrA	Oleic acid responsive regulator
RutR	Regulator of the pyrimidine and purine metabolism
ZuR variant 2	Zinc-responsive repressor