GCF_010119195.1 - 9 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

NZ_WRXL01000001.1 (Haloarcula salina)

Region	Type	From	To
Region 1.1	terpene-precursor	48,344	69,384
Region 1.2	lanthipeptide-class-ii	77,479	100,607
Region 1.3	RRE-containing	341,202	361,498
Region 1.4	terpene-precursor	782,795	803,637

NZ_WRXL01000002.1 (Haloarcula salina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	terpene	196,424	217,470
Region 7.2	terpene	368,291	388,623	Low	kitasetaline	other:other

NZ_WRXL01000004.1 (Haloarcula salina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	RiPP-like	223,298	235,007

NZ_WRXL01000005.1 (Haloarcula salina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	NI-siderophore	334,101	375,969	Low	schizokinen	NRPS:Type IV

NZ_WRXL01000006.1 (Haloarcula salina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	terpene	167,955	189,695

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	terpene-precursor	48,344	69,384
Region 1.2	lanthipeptide-class-ii	77,479	100,607
Region 1.3	RRE-containing	341,202	361,498
Region 1.4	terpene-precursor	782,795	803,637
Region 7.1	terpene	196,424	217,470
Region 7.2	terpene	368,291	388,623	Low	kitasetaline	other:other
Region 9.1	RiPP-like	223,298	235,007
Region 10.1	NI-siderophore	334,101	375,969	Low	schizokinen	NRPS:Type IV
Region 11.1	terpene	167,955	189,695

No secondary metabolite regions were found in these records:: NZ_WRXL01000010.1 (Haloarcula salina); NZ_WRXL01000011.1 (Haloarcula salina); NZ_WRXL01000012.1 (Haloarcula salina); NZ_WRXL01000013.1 (Haloarcula salina); NZ_WRXL01000014.1 (Haloarcula salina); NZ_WRXL01000003.1 (Haloarcula salina); NZ_WRXL01000007.1 (Haloarcula salina); NZ_WRXL01000008.1 (Haloarcula salina); NZ_WRXL01000009.1 (Haloarcula salina)

Compact view

NZ_WRXL01000001.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 48,344 - 69,384 nt. (total: 21,041 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

GM656_RS00360: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: halogenase

GM656_RS00285: halogenase

smcogs: SMCOG1119: halogenase

Hydrolases: hydrolase

GM656_RS00305: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Ligases: synthetase

GM656_RS00330: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.55	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0001528.4	0.46	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000674.5	0.44	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001911.3	0.43	terpene	raimonol	Streptomyces anulatus
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001910.4	0.41	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000286.3	0.40	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000930.4	0.39	terpene	nivalenol, 4-acetylnivalenol	Fusarium graminearum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.55	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0001528.4	0.46	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000674.5	0.44	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001911.3	0.43	terpene	raimonol	Streptomyces anulatus
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001910.4	0.41	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000286.3	0.40	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000930.4	0.39	terpene	nivalenol, 4-acetylnivalenol	Fusarium graminearum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

GM656_RS00330: PT_FPPS_like

Domain 1 (35 - 345): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Terpene

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

NZ_WRXL01000001.1 - Region 2 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 77,479 - 100,607 nt. (total: 23,129 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase transferase

GM656_RS00520: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

GM656_RS00530: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Lyases: cyclase

GM656_RS00515: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002703.2	0.51	ribosomal	archalan α	Halorussus salinus
BGC0001579.4	0.50	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000563.4	0.48	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.48	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0001660.3	0.45	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000503.5	0.44	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002699.2	0.43	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002346.3	0.42	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001364.3	0.42	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001391.3	0.41	ribosomal	thusin	Bacillus thuringiensis serovar rongseni

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002703.2	0.51	ribosomal	archalan α	Halorussus salinus
BGC0001579.4	0.50	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000563.4	0.48	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.48	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0001660.3	0.45	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000503.5	0.44	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002699.2	0.43	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002346.3	0.42	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001364.3	0.42	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001391.3	0.41	ribosomal	thusin	Bacillus thuringiensis serovar rongseni

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for GM656_RS00515

allorf_086856_087011

Leader:

MEGFCGHTMARERSAETIPGL

Core:

CAGVVTSRNVTGWIFQSVSYHYLVTCMWLV

Core with dehydrations:

CysAGVVDhbDhaRNVDhbGWIFQDhaVDhaYHYLVDhbCysMWLV

antiSMASH-DB 4.0 matches for allorf_086856_087011

100.0%

NZ_WRXL01000001.1:

Lanthipeptides: allorf_086856_087011_lanthipeptide

1

CAGVVTSRNVTGWIFQSVSYHYLVTCMWLV

30

CAGVVTSRNVTGWIFQSVSYHYLVTCMWLV

1

CAGVVTSRNVTGWIFQSVSYHYLVTCMWLV

30

13.2%

NZ_BDFA01000012.1and 2 others:

NZ_CP065050.1 Lanthipeptides: allorf_00905184_00905363_lanthipeptideNZ_LJIW01000001.1 Lanthipeptides: allorf_0961135_0961344_lanthipeptide

Lanthipeptides: allorf_132034_132222_lanthipeptide

1

CAGVVTSRNVTGWIFQSV

18

C+G+++ RN+ ++V

2

CSGIISKRNLAPVKIRNV

19

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

allorf_086856_087011 - Class II

Cleavage pHMM score: -6.50

RODEO score: 0

Monoisotopic mass: 3310.7 Da

Molecular weight: 3312.9 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3330.9 Da N = 1; 3348.9 Da N = 2; 3366.9 Da N = 3; 3384.9 Da N = 4

NZ_WRXL01000001.1 - Region 3 - RRE-containing

Download region GenBank file

Download region SVG

Location: 341,202 - 361,498 nt. (total: 20,297 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: transferase

GM656_RS01855: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001549.3	0.45	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0000575.5	0.44	ribosomal	lariatin	Rhodococcus jostii
BGC0002825.2	0.44	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406
BGC0001551.4	0.43	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001889.2	0.43	ribosomal	fusilassin	Thermobifida fusca YX
BGC0000504.5	0.41	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001356.4	0.41	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0002049.3	0.40	ribosomal	microviridin N9, microviridin N8, microviridin N7, microviridin N6, microviridin N5, microviridin N4, microviridin N3	Nostoc punctiforme PCC 73102
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0002064.2	0.40	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001549.3	0.45	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0000575.5	0.44	ribosomal	lariatin	Rhodococcus jostii
BGC0002825.2	0.44	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406
BGC0001551.4	0.43	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001889.2	0.43	ribosomal	fusilassin	Thermobifida fusca YX
BGC0000504.5	0.41	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001356.4	0.41	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0002049.3	0.40	ribosomal	microviridin N9, microviridin N8, microviridin N7, microviridin N6, microviridin N5, microviridin N4, microviridin N3	Nostoc punctiforme PCC 73102
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0002064.2	0.40	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

RREFinder

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 8 - 92; Score: 98.8

NZ_WRXL01000001.1 - Region 4 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 782,795 - 803,637 nt. (total: 20,843 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

GM656_RS04075: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

GM656_RS04115: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: synthetase

GM656_RS04100: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002736.2	0.50	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0002704.2	0.48	ribosomal	archalan β	Halorussus salinus
BGC0001969.3	0.46	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0002245.2	0.44	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5
BGC0001528.4	0.44	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000244.4	0.41	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0001659.3	0.40	terpene	mangicol A	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002736.2	0.50	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0002704.2	0.48	ribosomal	archalan β	Halorussus salinus
BGC0001969.3	0.46	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0002245.2	0.44	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5
BGC0001528.4	0.44	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000244.4	0.41	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0001659.3	0.40	terpene	mangicol A	Fusarium equiseti

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

GM656_RS04100: PT_FPPS_like

Domain 1 (27 - 269): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Terpene

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

NZ_WRXL01000002.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 196,424 - 217,470 nt. (total: 21,047 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GM656_RS05930: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001705.4	0.23	NRPS, PKS	nodularin	Nostoc sp. CENA543
BGC0001667.4	0.22	NRPS, PKS	microcystin-LR, microcystin-FR, microcystin-LA, microcystin-LAba, microcystin-LM, microcystin-LV, microcystin-LL	Fischerella sp. CENA161
BGC0001017.5	0.22	NRPS, PKS	microcystin LR	Microcystis aeruginosa PCC 7806
BGC0001016.5	0.22	NRPS, PKS	microcystin	Anabaena sp. 90
BGC0002282.2	0.21	other (other)	formycin A	Streptomyces kaniharaensis
BGC0002040.3	0.21	other (other)	coformycin, formycin A	Streptomyces kaniharaensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001705.4	0.23	NRPS, PKS	nodularin	Nostoc sp. CENA543
BGC0001667.4	0.22	NRPS, PKS	microcystin-LR, microcystin-FR, microcystin-LA, microcystin-LAba, microcystin-LM, microcystin-LV, microcystin-LL	Fischerella sp. CENA161
BGC0001017.5	0.22	NRPS, PKS	microcystin LR	Microcystis aeruginosa PCC 7806
BGC0001016.5	0.22	NRPS, PKS	microcystin	Anabaena sp. 90
BGC0002282.2	0.21	other (other)	formycin A	Streptomyces kaniharaensis
BGC0002040.3	0.21	other (other)	coformycin, formycin A	Streptomyces kaniharaensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

GM656_RS05970: PT_phytoene_like

Domain 1 (23 - 317): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Terpene

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

NZ_WRXL01000002.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 368,291 - 388,623 nt. (total: 20,333 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GM656_RS06875: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Isomerases: isomerase

GM656_RS06920: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: synthase

GM656_RS06925: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002031.3	0.45	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0000343.5	0.41	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001043.4	0.35	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	0.35	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0000996.5	0.34	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0000999.4	0.34	NRPS, PKS	heat-stable antifungal factor	Lysobacter enzymogenes
BGC0000922.5	0.34	PKS	2-heptyl-3-hydroxy-4-quinolone, 2,4-Quinolinediol, 2-heptylquinolin-4(1H)-one	Pseudomonas aeruginosa PAO1
BGC0002509.3	0.34	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0001903.3	0.33	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0002434.2	0.32	NRPS, PKS	clifednamide D, clifednamide E, clifednamide F, clifednamide G, clifednamide H, clifednamide I, clifednamide J	Kitasatospora sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002031.3	0.45	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0000343.5	0.41	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001043.4	0.35	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	0.35	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0000996.5	0.34	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0000999.4	0.34	NRPS, PKS	heat-stable antifungal factor	Lysobacter enzymogenes
BGC0000922.5	0.34	PKS	2-heptyl-3-hydroxy-4-quinolone, 2,4-Quinolinediol, 2-heptylquinolin-4(1H)-one	Pseudomonas aeruginosa PAO1
BGC0002509.3	0.34	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0001903.3	0.33	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0002434.2	0.32	NRPS, PKS	clifednamide D, clifednamide E, clifednamide F, clifednamide G, clifednamide H, clifednamide I, clifednamide J	Kitasatospora sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

GM656_RS06885: Lycopene_cycl

Domain 1 (11 - 91): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Terpene

Glossary

No acronyms to display

NZ_WRXL01000004.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 223,298 - 235,007 nt. (total: 11,710 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: phosphatase

GM656_RS12560: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000878.5	0.36	other (other)	puromycin	Streptomyces alboniger
BGC0000249.5	0.29	PKS	nogalamycin	Streptomyces nogalater
BGC0001753.3	0.28	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000716.5	0.26	saccharide	spectinomycin	Streptomyces netropsis
BGC0000715.5	0.25	saccharide	actinospectacin	Streptomyces spectabilis
BGC0001797.3	0.25	ribosomal	telomestatin	Streptomyces anulatus
BGC0000243.4	0.24	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0002652.2	0.23	other (other), saccharide	cytosaminomycin F, cytosaminomycin G, streptcytosine P, plicacetin, 40551-F, 12F-plicacetin, streptcytosine D, streptcytosine E	Streptomyces sp. SHP22-7
BGC0002288.2	0.22	NRPS	ashimide A, ashimide B	Streptomyces sp. NA03103
BGC0002012.4	0.22	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000878.5	0.36	other (other)	puromycin	Streptomyces alboniger
BGC0000249.5	0.29	PKS	nogalamycin	Streptomyces nogalater
BGC0001753.3	0.28	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000716.5	0.26	saccharide	spectinomycin	Streptomyces netropsis
BGC0000715.5	0.25	saccharide	actinospectacin	Streptomyces spectabilis
BGC0001797.3	0.25	ribosomal	telomestatin	Streptomyces anulatus
BGC0000243.4	0.24	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0002652.2	0.23	other (other), saccharide	cytosaminomycin F, cytosaminomycin G, streptcytosine P, plicacetin, 40551-F, 12F-plicacetin, streptcytosine D, streptcytosine E	Streptomyces sp. SHP22-7
BGC0002288.2	0.22	NRPS	ashimide A, ashimide B	Streptomyces sp. NA03103
BGC0002012.4	0.22	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

NZ_WRXL01000005.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 334,101 - 375,969 nt. (total: 41,869 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

GM656_RS14955: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

GM656_RS14960: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

GM656_RS14980: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

GM656_RS15065: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

GM656_RS15080: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: aminotransferase

GM656_RS15040: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: decarboxylase

GM656_RS15045: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002683.2	0.58	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0001572.3	0.56	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002633.2	0.55	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002692.2	0.54	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002305.2	0.53	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000295.5	0.53	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001478.5	0.53	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.52	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000942.4	0.52	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001531.5	0.52	other (other)	bisucaberin B	Tenacibaculum mesophilum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002683.2	0.58	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0001572.3	0.56	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002633.2	0.55	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002692.2	0.54	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002305.2	0.53	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000295.5	0.53	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001478.5	0.53	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.52	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000942.4	0.52	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001531.5	0.52	other (other)	bisucaberin B	Tenacibaculum mesophilum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

NZ_WRXL01000006.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 167,955 - 189,695 nt. (total: 21,741 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GM656_RS15965: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Hydrolases: hydrolase

GM656_RS16035: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Translocases: transporter

GM656_RS15960: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000650.3	0.47	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0001456.3	0.43	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.42	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.42	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.41	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.41	terpene	carotenoid	Myxococcus xanthus
BGC0000616.4	0.41	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0002826.2	0.40	other (other)	closoxazole A, closoxazole B	Clostridium cavendishii DSM 21758
BGC0000541.5	0.40	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000650.3	0.47	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0001456.3	0.43	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.42	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.42	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.41	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.41	terpene	carotenoid	Myxococcus xanthus
BGC0000616.4	0.41	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0002826.2	0.40	other (other)	closoxazole A, closoxazole B	Clostridium cavendishii DSM 21758
BGC0000541.5	0.40	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

GM656_RS15995: Lycopene_cycl + Lycopene_cycl

Domain 1 (6 - 96): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Domain 2 (139 - 229): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

GM656_RS16000: PT_phytoene_like

Domain 1 (9 - 287): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Terpene

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PSPP	Presqualene diphosphate