GCF_009935145.1 - 14 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_NKAX01000001.1 (Bacillus cereus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NI-siderophore	347,271	378,978	High	petrobactin	other:other

NZ_NKAX01000011.1 (Bacillus cereus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	terpene-precursor	467,055	487,945

NZ_NKAX01000015.1 (Bacillus cereus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	NRP-metallophore,NRPS	123,900	175,648	High	bacillibactin	NRPS:Type I

NZ_NKAX01000017.1 (Bacillus cereus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	terpene	19,935	41,788	Low	molybdenum cofactor	other:other

NZ_NKAX01000018.1 (Bacillus cereus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	lanthipeptide-class-iii	4,954	27,557

NZ_NKAX01000002.1 (Bacillus cereus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	NRPS	426,708	473,718
Region 12.2	RiPP-like	493,378	503,644

NZ_NKAX01000022.1 (Bacillus cereus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	NRPS-like	76,357	119,938

NZ_NKAX01000023.1 (Bacillus cereus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	RiPP-like	3,684	14,031
Region 16.2	betalactone	68,023	93,261	Low	fengycin	NRPS:Type I
Region 16.3	NRPS	147,948	213,856

NZ_NKAX01000026.1 (Bacillus cereus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	lanthipeptide-class-i	3,380	29,823

NZ_NKAX01000007.1 (Bacillus cereus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 39.1	NRPS-like	1	39,556	Low	thusin	ribosomal:RiPP

NZ_NKAX01000009.1 (Bacillus cereus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 41.1	azole-containing-RiPP	51,804	75,310

No secondary metabolite regions were found in these records:: NZ_NKAX01000010.1 (Bacillus cereus); NZ_NKAX01000012.1 (Bacillus cereus); NZ_NKAX01000013.1 (Bacillus cereus); NZ_NKAX01000014.1 (Bacillus cereus); NZ_NKAX01000016.1 (Bacillus cereus); NZ_NKAX01000019.1 (Bacillus cereus); NZ_NKAX01000020.1 (Bacillus cereus); NZ_NKAX01000021.1 (Bacillus cereus); NZ_NKAX01000024.1 (Bacillus cereus); NZ_NKAX01000025.1 (Bacillus cereus); NZ_NKAX01000027.1 (Bacillus cereus); NZ_NKAX01000028.1 (Bacillus cereus); NZ_NKAX01000029.1 (Bacillus cereus); NZ_NKAX01000003.1 (Bacillus cereus); NZ_NKAX01000030.1 (Bacillus cereus); NZ_NKAX01000031.1 (Bacillus cereus); NZ_NKAX01000032.1 (Bacillus cereus); NZ_NKAX01000033.1 (Bacillus cereus); NZ_NKAX01000034.1 (Bacillus cereus); NZ_NKAX01000035.1 (Bacillus cereus); NZ_NKAX01000036.1 (Bacillus cereus); NZ_NKAX01000037.1 (Bacillus cereus); NZ_NKAX01000038.1 (Bacillus cereus); NZ_NKAX01000039.1 (Bacillus cereus); NZ_NKAX01000004.1 (Bacillus cereus); NZ_NKAX01000040.1 (Bacillus cereus); NZ_NKAX01000041.1 (Bacillus cereus); NZ_NKAX01000005.1 (Bacillus cereus); NZ_NKAX01000006.1 (Bacillus cereus); NZ_NKAX01000008.1 (Bacillus cereus)

Compact view

NZ_NKAX01000001.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 347,271 - 378,978 nt. (total: 31,708 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

CE086_RS01825: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: deacetylase

CE086_RS01760: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Ligases: ligase synthase

CE086_RS01720: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

CE086_RS01790: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.4	0.89	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001572.3	0.51	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002620.2	0.50	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002305.2	0.50	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001713.5	0.48	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002464.3	0.48	other (other)	alcaligin	Bordetella pertussis Tohama I

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.4	0.89	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001572.3	0.51	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002620.2	0.50	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002305.2	0.50	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001713.5	0.48	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002464.3	0.48	other (other)	alcaligin	Bordetella pertussis Tohama I

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.14 out of 29.38

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.03 out of 20.97

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.38 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.93 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 15.13 out of 18.16

Confidence: strong

Additional weak hits (5):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.58 out of 19.52

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.50 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.66 out of 32.74

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.60 out of 36.54

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
FuR variant 1	Ferric Uptake Regulator
ZuR variant 1	Zinc-responsive repressor

NZ_NKAX01000011.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 467,055 - 487,945 nt. (total: 20,891 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase

CE086_RS12990: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

CE086_RS13020: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

CE086_RS13025: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

CE086_RS13020: PT_FPPS_like

Domain 1 (32 - 295): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.32 out of 25.88

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.66 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.49 out of 27.78

Confidence: medium

Additional weak hits (2):

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 25.40 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.73 out of 30.98

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes
PsrA	Oleic acid responsive regulator

NZ_NKAX01000015.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 123,900 - 175,648 nt. (total: 51,749 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

CE086_RS18900: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CE086_RS18905: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

CE086_RS18910: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

CE086_RS18960: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CE086_RS19040: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

CE086_RS19070: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: PPTase

CE086_RS18995: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: hydrolase protease

CE086_RS18975: isochorismatase

smcogs: SMCOG1027: isochorismatase

CE086_RS19020: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: hydratase

CE086_RS18920: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Isomerases: isomerase

CE086_RS18965: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

CE086_RS18970: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CE086_RS18980: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CE086_RS19045: Pseudouridine synthase

smcogs: SMCOG1154: Pseudouridine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001185.5	1.05	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	0.88	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0000401.5	0.86	NRPS	paenibactin	Paenibacillus elgii B69
BGC0002075.3	0.86	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.86	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001132.4	0.77	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.74	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001185.5	0.80	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	0.75	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0000401.5	0.74	NRPS	paenibactin	Paenibacillus elgii B69
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.74	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.13 out of 27.78

Confidence: strong

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.21 out of 30.25

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.83 out of 27.78

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.53 out of 26.06

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.40 out of 29.38

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.20 out of 32.93

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.53 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.41 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.90 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.62 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.57 out of 27.78

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.56 out of 29.38

Confidence: medium

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 26.57 out of 32.74

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 25.99 out of 30.25

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.21 out of 30.25

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.53 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

Additional weak hits (6):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 25.83 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.49 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.05 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.54 out of 30.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.85 out of 36.53

Confidence: weak

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 15.72 out of 18.46

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 123899 - 175648:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CE086_RS18970: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SVSLYPMSSPGGALQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PMPAQGVVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

CE086_RS18980: Gly - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (464..864): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDISALELQALVGGETNLYGPTETTIWSTF
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1524..1937): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEINMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
FuR variant 1	Ferric Uptake Regulator
FuR variant 2	Ferric Uptake Regulator
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor

NZ_NKAX01000017.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 19,935 - 41,788 nt. (total: 21,854 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CE086_RS20590: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CE086_RS20595: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Lyases: lyase

CE086_RS20620: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000917.3	0.52	other (other)	molybdenum cofactor	Rhodobacter capsulatus
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000916.5	0.46	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000812.3	0.45	other (other)	huperzine A	Shiraia sp. slf14
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002138.2	0.40	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000917.3	0.52	other (other)	molybdenum cofactor	Rhodobacter capsulatus
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000916.5	0.46	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000812.3	0.45	other (other)	huperzine A	Shiraia sp. slf14
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002138.2	0.40	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

CE086_RS20580: T2TS

Domain 1 (4 - 614): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 26.42 out of 30.22

Confidence: medium

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator

NZ_NKAX01000018.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 4,954 - 27,557 nt. (total: 22,604 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	0.49	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000551.5	0.48	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.48	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002111.3	0.46	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000496.5	0.46	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.45	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000553.3	0.44	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.44	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	0.49	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000551.5	0.48	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.48	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002111.3	0.46	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000496.5	0.46	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.45	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000553.3	0.44	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.44	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 25.47 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 25.47 out of 26.06

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.24 out of 28.19

Confidence: medium

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 26.66 out of 35.63

Confidence: medium

Additional weak hits (1):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.52 out of 33.73

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes
NrtR	NAD synthesis repressor
ZuR variant 1	Zinc-responsive repressor

NZ_NKAX01000002.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 426,708 - 473,718 nt. (total: 47,011 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

CE086_RS04415: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CE086_RS04565: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: aminotransferase

CE086_RS04420: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase glucanase hydrolase

CE086_RS04410: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

CE086_RS04455: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

smcogs: SMCOG1283: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

CE086_RS04465: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

CE086_RS04485: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: decarboxylase

CE086_RS04480: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: ligase

CE086_RS04475: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.81 out of 20.97

Confidence: medium

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 28.23 out of 31.73

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 24.13 out of 29.25

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.71 out of 26.33

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.75 out of 28.19

Confidence: medium

Additional weak hits (8):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.36 out of 33.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.46 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 25.76 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.69 out of 31.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.07 out of 32.74

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.77 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.63 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 426707 - 473718:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CE086_RS04475: X - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (266..656): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FVMAFDISLLELESLLAGELNIYGPTETTICATV
Nearest Stachelhaus code(s):: Ala DILICALICK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1303..1683): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNTLHSGDISLGGATEASIWSIY
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CcpA	Catabolite control protein A
HexR	Glucose-responsive regulator
SypG	Regulator of biofilm formation and host colonization
ZuR variant 1	Zinc-responsive repressor

NZ_NKAX01000002.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 493,378 - 503,644 nt. (total: 10,267 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

CE086_RS04730: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	RiPP-like	Similarity score	Type	Compound(s)	Organism
BGC0001994.4		0.35	other (other)	β-ethynylserine	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002373.3		0.19	NRPS	bonnevillamide D, bonnevillamide E	Streptomyces sp.

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0001994.4		0.35	other (other)	β-ethynylserine	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002373.3		0.19	NRPS	bonnevillamide D, bonnevillamide E	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.28 out of 26.06

Confidence: medium

Additional weak hits (1):

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes

NZ_NKAX01000022.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 76,357 - 119,938 nt. (total: 43,582 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase

CE086_RS24575: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: phosphorylase phosphotransferase

CE086_RS24540: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

CE086_RS24565: Glucose-specific phosphotransferase enzyme IIA

smcogs: SMCOG1145: Glucose-specific phosphotransferase enzyme IIA

Hydrolases: glucosidase

CE086_RS24570: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Ligases: ligase

CE086_RS24525: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.69 out of 27.55

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.83 out of 27.78

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 22.91 out of 25.88

Confidence: medium

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 25.04 out of 26.12

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.18 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.81 out of 20.97

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.69 out of 21.55

Confidence: strong

Additional weak hits (9):

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.06 out of 29.72

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.13 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.70 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.89 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.17 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.95 out of 29.38

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.11 out of 20.47

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.78 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.98 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 76356 - 119938:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CE086_RS24525: X

AMP-binding (225..621): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWMPFDASVWEAALAIGGEHNVYGPTECTVVTTT
Nearest Stachelhaus code(s):: Leu DAWYLGNVVK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
LuxO	Repressor of luminescence
PsrA	Oleic acid responsive regulator

NZ_NKAX01000023.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 3,684 - 14,031 nt. (total: 10,348 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

CE086_RS25100: aminotransferase

smcogs: SMCOG1019: aminotransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000896.5	0.29	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0000721.4	0.26	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000172.5	0.23	PKS	Basiliskamide A, Basiliskamide B	Brevibacillus laterosporus PE36
BGC0000381.5	0.23	NRPS	lichenysin	Bacillus licheniformis DSM 13 = ATCC 14580
BGC0000433.5	0.22	NRPS	surfactin	Bacillus velezensis FZB42
BGC0000455.6	0.22	NRPS, saccharide	vancomycin	Amycolatopsis orientalis HCCB10007 (ATCC43491)
BGC0002588.2	0.22	other (other)	enduracididine	uncultured bacterium
BGC0001233.5	0.22	NRPS	feglymycin	Streptomyces sp. DSM 11171
BGC0001461.5	0.21	NRPS	Actinoidin B	Amycolatopsis keratiniphila subsp. nogabecina
BGC0001459.5	0.21	NRPS	decaplanin	Amycolatopsis regifaucium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000896.5	0.29	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0000721.4	0.26	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000172.5	0.23	PKS	Basiliskamide A, Basiliskamide B	Brevibacillus laterosporus PE36
BGC0000381.5	0.23	NRPS	lichenysin	Bacillus licheniformis DSM 13 = ATCC 14580
BGC0000433.5	0.22	NRPS	surfactin	Bacillus velezensis FZB42
BGC0000455.6	0.22	NRPS, saccharide	vancomycin	Amycolatopsis orientalis HCCB10007 (ATCC43491)
BGC0002588.2	0.22	other (other)	enduracididine	uncultured bacterium
BGC0001233.5	0.22	NRPS	feglymycin	Streptomyces sp. DSM 11171
BGC0001461.5	0.21	NRPS	Actinoidin B	Amycolatopsis keratiniphila subsp. nogabecina
BGC0001459.5	0.21	NRPS	decaplanin	Amycolatopsis regifaucium

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.24 out of 23.79

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.30 out of 26.06

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.87 out of 32.93

Confidence: medium

Additional weak hits (2):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 17.35 out of 30.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes

NZ_NKAX01000023.1 - Region 2 - betalactone

Download region GenBank file

Download region SVG

Location: 68,023 - 93,261 nt. (total: 25,239 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CE086_RS25450: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acetyltransferase carboxylase transferase

CE086_RS25410: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

CE086_RS25425: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

CE086_RS25445: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Lyases: hydratase

CE086_RS25430: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

CE086_RS25420: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CE086_RS25435: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002284.3	0.55	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000131.5	0.46	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000234.5	0.43	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000623.3	0.42	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0001103.5	0.42	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0002700.2	0.41	ribosomal	bacinapeptin	Bacillus nakamurai

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002284.3	0.55	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000131.5	0.46	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000234.5	0.43	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000623.3	0.42	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0001103.5	0.42	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0002700.2	0.41	ribosomal	bacinapeptin	Bacillus nakamurai

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.51 out of 27.55

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

Additional weak hits (1):

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.65 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
GnfM	Regulator of nitrogen-fixation genes
ToxT	Regulator of MSHA biosynthesis

NZ_NKAX01000023.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 147,948 - 213,856 nt. (total: 65,909 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase acetyltransferase acyltransferase

CE086_RS25770: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

CE086_RS25800: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

CE086_RS25810: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

Hydrolases: deacetylase esterase

CE086_RS25765: thioesterase

smcogs: SMCOG1004: thioesterase

CE086_RS25855: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Ligases: ligase

CE086_RS25775: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CE086_RS25780: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CE086_RS25785: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

CE086_RS25715: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

CE086_RS25730: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.72	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002071.2	0.70	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.72	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002071.2	0.70	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.21 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.03 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.23 out of 26.06

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.01 out of 30.25

Confidence: medium

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 30.96 out of 36.54

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.34 out of 20.97

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.30 out of 26.06

Confidence: medium

Additional weak hits (6):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.08 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 25.64 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.09 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.74 out of 31.73

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 17.58 out of 30.12

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.21 out of 30.11

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 147947 - 213856:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Thr) + (X - Ala) + (Ser - Leu - D-X - Glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CE086_RS25775: Ser - Leu - X - Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (496..901): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFTSGEINLYGPTEATVDVTY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1558..1945): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: MWHAFDSAVQEPFAITGGDINQYGPSENTVVTTD
Nearest Stachelhaus code(s):: Pro DVQFIAQVVK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2600..3000): X

nrpys: Gln, Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDASIQQMDILVGGEYNVYGPTECTVDATC
Nearest Stachelhaus code(s):: Gln or Glu DAQDLGVVDK (88% 8Å match); Ile DAQDLGVVDK (85% 8Å match); Gln DAQDLGVVDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4115..4515): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDVSIQQMDMLVGGEYNVYGPTECTVDATC
Nearest Stachelhaus code(s):: Gln or Glu DAQDLGVVDK (85% 8Å match); Ile DAQDLGVVDK (82% 8Å match); Gln DAQDLGVVDK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

CE086_RS25780: X - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (466..870): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWMTFDVSVWEWQFFSGGETNFYGPTEATIYVNA
Nearest Stachelhaus code(s):: Glu DVWHFGRINK (71% 8Å match); Gln DAWQFGLIDK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1527..1919): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: MWATFDLSVFEVNTNLAGEYNLYGPSEDTTYSTY
Nearest Stachelhaus code(s):: Ala DLFNNALTYK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

CE086_RS25785: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (457..866): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
ColR	Phenol-responsive regulator
HgtR	Hydrogen-dependent regulator
MogR	Repressor of flagellar motility genes

NZ_NKAX01000026.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 3,380 - 29,823 nt. (total: 26,444 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

CE086_RS26225: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase dehydratase

CE086_RS26170: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

CE086_RS26180: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000541.5	0.61	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.61	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001289.5	0.60	ribosomal	penisin	Paenibacillus ehimensis
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0002635.2	0.56	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001618.3	0.56	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0000560.5	0.55	ribosomal	subtilomycin	Bacillus subtilis
BGC0000506.4	0.55	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000508.3	0.53	ribosomal	epidermin	Staphylococcus epidermidis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000541.5	0.61	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.61	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001289.5	0.60	ribosomal	penisin	Paenibacillus ehimensis
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0002635.2	0.56	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001618.3	0.56	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0000560.5	0.55	ribosomal	subtilomycin	Bacillus subtilis
BGC0000506.4	0.55	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000508.3	0.53	ribosomal	epidermin	Staphylococcus epidermidis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for CE086_RS26170

CE086_RS26160

Leader:

MINEKNLFDLDVQVTTATGDVDPQ

CE086_RS26165

Leader:

MINEKNLFDLDVQVTTATGDVDPQ

Shared core:

ITSISACTPGCGNTGSFNSFCC

Core with dehydrations:

IDhbDhaIDhaACysDhbPGCysGNDhbGDhaFNDhaFCysCys

antiSMASH-DB 4.0 matches for CE086_RS26160

100.0%

NC_022873.1and 92 others:

NZ_CM000742.1 Lanthipeptides: BMYCO0001_RS26515_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18180_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18175_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18170_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18165_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19775_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19770_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19765_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18710_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18705_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18700_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21370_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21365_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21360_lanthipeptideNZ_CP035965.1 Lanthipeptides: EXW35_RS16385_lanthipeptideNZ_CP035965.1 Lanthipeptides: EXW35_RS16380_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16155_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16150_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16145_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16140_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26195_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26190_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26185_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26180_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16265_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16260_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16255_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16250_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16620_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16615_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16610_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16605_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16110_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16105_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16100_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16095_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14125_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14120_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14115_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18355_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18350_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18345_lanthipeptideNZ_CP047366.1 Lanthipeptides: GSN03_RS15835_lanthipeptideNZ_CP047366.1 Lanthipeptides: GSN03_RS15830_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16415_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16410_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16405_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15130_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15125_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15120_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15990_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15985_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15980_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15975_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25975_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25970_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25965_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25960_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15810_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15805_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15800_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15795_lanthipeptideNZ_JAIPUK010000008.1 Lanthipeptides: K9P71_RS24265_lanthipeptideNZ_JAIPUK010000008.1 Lanthipeptides: K9P71_RS24260_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06155_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06150_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06145_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06140_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21535_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21530_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21525_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11095_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11090_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11085_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11080_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11075_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18900_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18895_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18890_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18885_lanthipeptideNZ_LDHL01000037.1 Lanthipeptides: ABD98_RS26430_lanthipeptideNZ_LDHL01000037.1 Lanthipeptides: ABD98_RS26425_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27280_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27275_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27270_lanthipeptideNZ_MSTN01000016.1 Lanthipeptides: BVF97_RS28620_lanthipeptideNZ_NIUP01000011.1 Lanthipeptides: CEU84_RS08145_lanthipeptideNZ_NIUP01000011.1 Lanthipeptides: CEU84_RS08140_lanthipeptideNZ_NKAX01000026.1 Lanthipeptides: CE086_RS26165_lanthipeptideNZ_NKAX01000026.1 Lanthipeptides: CE086_RS26160_lanthipeptideNZ_NVGU01000011.1 Lanthipeptides: COL71_RS14760_lanthipeptideNZ_NVGU01000011.1 Lanthipeptides: COL71_RS14755_lanthipeptide

Lanthipeptides: YBT1518_RS19670_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITSISACTPGCGNTGSFNSFCC

1

ITSISACTPGCGNTGSFNSFCC

22

95.5%

NC_022873.1:

Lanthipeptides: YBT1518_RS19675_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

IT ISACTPGCGNTGSFNSFCC

1

ITRISACTPGCGNTGSFNSFCC

22

82.6%

NZ_CP047792.1and 1 other:

NZ_JAGSAY010000004.1 Lanthipeptides: KC186_RS06745_lanthipeptide

Lanthipeptides: E3S88_RS07345_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGC NTGSFNSFCC

2

ITSHSLCTPGCANTGSFNSFCC

23

with 111 more sequence matches

Only the first 10 are displayed here.

81.8%

NC_006582.1and 6 others:

NZ_BOQQ01000001.1 Lanthipeptides: KI354_RS00530_lanthipeptideNZ_BOQS01000001.1 Lanthipeptides: KI364_RS00675_lanthipeptideNZ_CP019985.1 Lanthipeptides: BC8716_RS09795_lanthipeptideNZ_CP104963.1 Lanthipeptides: N7M99_RS07725_lanthipeptideNZ_FRBS01000002.1 Lanthipeptides: BUC05_RS08990_lanthipeptideNZ_JAODPB010000001.1 Lanthipeptides: N6H06_RS03040_lanthipeptide

Lanthipeptides: ABC_RS22115_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

TS+S CTPGCG TGSFNSFCC

1

FTSVSFCTPGCGETGSFNSFCC

22

81.8%

NC_014023.1and 36 others:

NC_014023.1 Lanthipeptides: BMQ_RS27575_lanthipeptideNZ_CP018875.1 Lanthipeptides: BUW91_RS26425_lanthipeptideNZ_CP018875.1 Lanthipeptides: BUW91_RS26420_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28075_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28070_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28065_lanthipeptideNZ_CP031776.1 Lanthipeptides: D0441_RS30140_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01185_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01180_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01175_lanthipeptideNZ_CP048884.1 Lanthipeptides: BMG_RS27510_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26980_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26975_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26970_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26985_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26980_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26975_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27820_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27815_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27810_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25635_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25630_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25625_lanthipeptideNZ_JAHHYI010000015.1 Lanthipeptides: KM925_RS26245_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28075_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28070_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28065_lanthipeptideNZ_NKAQ01000005.1 Lanthipeptides: CE057_RS19640_lanthipeptideNZ_NKAQ01000005.1 Lanthipeptides: CE057_RS19635_lanthipeptideNZ_NTZG01000054.1 Lanthipeptides: CN510_RS18265_lanthipeptideNZ_NUIN01000020.1 Lanthipeptides: CN973_RS26930_lanthipeptideNZ_NUOI01000090.1 Lanthipeptides: COE08_RS30285_lanthipeptideNZ_NUOI01000090.1 Lanthipeptides: COE08_RS30280_lanthipeptideNZ_NUOQ01000009.1 Lanthipeptides: COE31_RS05925_lanthipeptideNZ_NUXL01000007.1 Lanthipeptides: COJ36_RS20885_lanthipeptideNZ_NUZS01000089.1 Lanthipeptides: COJ90_RS28785_lanthipeptide

Lanthipeptides: BMQ_RS27580_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS+S CTPGCG+TGS+NSFCC

1

ITSVSLCTPGCGDTGSWNSFCC

22

81.8%

NZ_FNNQ01000006.1and 2 others:

NZ_FNNQ01000006.1 Lanthipeptides: BLV90_RS07685_lanthipeptideNZ_FNNQ01000006.1 Lanthipeptides: BLV90_RS07680_lanthipeptide

Lanthipeptides: BLV90_RS07690_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS+S CTPGCG TGSFNS+CC

1

ITSVSLCTPGCGETGSFNSYCC

22

81.8%

NZ_FPAA01000016.1and 3 others:

NZ_FPAA01000016.1 Lanthipeptides: CHX35_RS15995_lanthipeptideNZ_FPAA01000016.1 Lanthipeptides: CHX35_RS15990_lanthipeptideNZ_FPAA01000016.1 Lanthipeptides: CHX35_RS15985_lanthipeptide

Lanthipeptides: CHX35_RS16000_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS+S CTPGCG+TGSFNS+CC

1

ITSVSLCTPGCGDTGSFNSYCC

22

81.8%

NZ_LELK01000004.1:

Lanthipeptides: AB986_RS12540_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGCG TGSFNS+CC

1

ITSYSFCTPGCGETGSFNSYCC

22

78.3%

NC_003923.1and 9 others:

NC_009641.1 Lanthipeptides: NWMN_RS09635_lanthipeptideNZ_CP023076.1 Lanthipeptides: CJ017_RS08945_lanthipeptideNZ_CP054876.1 Lanthipeptides: HUW54_RS09150_lanthipeptideNZ_CP077098.1 Lanthipeptides: KSF82_RS09475_lanthipeptideNZ_CP092781.1 Lanthipeptides: ML436_RS08940_lanthipeptideNZ_CP102959.1 Lanthipeptides: NW979_RS08780_lanthipeptideNZ_CP102962.1 Lanthipeptides: NW971_RS09555_lanthipeptideNZ_LR133917.1 Lanthipeptides: ELZ45_RS09155_lanthipeptideNZ_LS483317.1 Lanthipeptides: DQL75_RS09700_lanthipeptide

Lanthipeptides: MW_RS09420_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGC TGSFNSFCC

2

ITSHSLCTPGCAKTGSFNSFCC

23

78.3%

NZ_LR134304.1:

Lanthipeptides: EL116_RS09245_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS+ CTPGCG TGSFNSFCC

2

ITSVIGCTPGCGKTGSFNSFCC

23

77.3%

NZ_AP019791.1:

Lanthipeptides: RxyAA322_RS06460_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGC TGSFNS+CC

1

ITSYSLCTPGCAKTGSFNSYCC

22

72.7%

NZ_QGTF01000010.1:

Lanthipeptides: BDW27_RS18560_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

+TS+S CTPGC N G+FNSFCC

1

VTSVSVCTPGCEN-GTFNSFCC

21

70.8%

NZ_VKCY01000012.1:

Lanthipeptides: FNK43_RS09020_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGC TGSFNS+CC

3

ITSFSLCTPGCAKTGSFNSYCC

24

MIBiG 4.0 matches for CE086_RS26160

35.3%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

1

ITSISACTPGCGNTGSF

17

ITSIS CTPGC TG+

1

ITSISLCTPGC-KTGAL

16

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.12 out of 20.97

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.05 out of 20.97

Confidence: strong

Additional weak hits (2):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.40 out of 30.98

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

CE086_RS26160 - Class I

Cleavage pHMM score: 11.60

RODEO score: 33

Monoisotopic mass: 1996.9 Da

Molecular weight: 1998.3 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2016.3 Da N = 1; 2034.3 Da N = 2; 2052.3 Da N = 3

CE086_RS26165 - Class I

Cleavage pHMM score: 11.60

RODEO score: 33

Monoisotopic mass: 1996.9 Da

Molecular weight: 1998.3 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2016.3 Da N = 1; 2034.3 Da N = 2; 2052.3 Da N = 3

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 162 - 259; Score: 83.1

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_NKAX01000007.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 39,556 nt. (total: 39,556 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CE086_RS06885: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CE086_RS06890: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase glycosyltransferase

CE086_RS06900: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

CE086_RS07005: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: esterase

CE086_RS06905: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

CE086_RS06850: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CE086_RS06860: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CE086_RS06865: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CE086_RS06895: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.45 out of 25.88

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.27 out of 26.06

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.25 out of 27.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.74 out of 24.78

Confidence: medium

Additional weak hits (6):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.70 out of 33.73

Confidence: weak

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 15.78 out of 18.46

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 20.77 out of 32.93

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.68 out of 32.74

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 16.52 out of 30.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 39556:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CE086_RS06895: X

AMP-binding (82..476): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FSIFFDVSIFDVELSVGGEFNGYGPTETTVVVTL
Nearest Stachelhaus code(s):: meSer DVFESGGVAK (76% 8Å match); Lys DVFESGGVAK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
PsrA	Oleic acid responsive regulator
ToxT	Regulator of MSHA biosynthesis

NZ_NKAX01000009.1 - Region 1 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 51,804 - 75,310 nt. (total: 23,507 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

CE086_RS08260: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: methyltransferase

CE086_RS08275: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002013.4	0.46	ribosomal	curacozole	Streptomyces curacoi
BGC0001174.4	0.44	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0000607.5	0.43	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001146.5	0.43	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001535.3	0.43	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001534.3	0.41	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001173.5	0.41	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0001145.5	0.40	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000603.5	0.39	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000606.5	0.39	ribosomal	lactazole	Streptomyces lactacystinaeus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002013.4	0.46	ribosomal	curacozole	Streptomyces curacoi
BGC0001174.4	0.44	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0000607.5	0.43	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001146.5	0.43	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001535.3	0.43	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001534.3	0.41	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001173.5	0.41	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0001145.5	0.40	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000603.5	0.39	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000606.5	0.39	ribosomal	lactazole	Streptomyces lactacystinaeus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.62 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Heterocycloanthracin_C_RRE; Location: 0 - 100; Score: 181.5; RRE type: Thiopeptide_F_RRE; Location: 10 - 89; Score: 41.0

TFBS definitions

Regulator	Description

Core peptide predictions

No core peptides found.