GCF_009865365.1 - 34 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_WWJS01000011.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	NRPS,terpene-precursor	11,064	68,731	Low	mirubactin	NRPS:Type I

NZ_WWJS01000017.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	butyrolactone	26,310	37,260

NZ_WWJS01000018.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	thioamitides	73,999	96,259
Region 10.2	terpene-precursor	327,539	348,708

NZ_WWJS01000019.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	lassopeptide	1	14,824	High	albusnodin	ribosomal:RiPP
Region 11.2	lanthipeptide-class-ii,lanthipeptide-class-iii	17,021	48,458

NZ_WWJS01000002.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	hydrogen-cyanide	1	9,283
Region 12.2	hglE-KS,T1PKS	36,927	90,321
Region 12.3	RiPP-like	482,670	494,838
Region 12.4	ectoine	1,001,543	1,011,941	High	ectoine	other:other

NZ_WWJS01000020.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	lanthipeptide-class-i	1	18,972

NZ_WWJS01000022.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	NRPS,T1PKS	12	88,943	Medium	microtermolide A	NRPS:Type I+PKS

NZ_WWJS01000023.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	terpene	24,092	45,069

NZ_WWJS01000026.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	melanin	143,121	153,621	High	melanin	other:other
Region 19.2	T2PKS,terpene	172,810	245,325	High	spore pigment	PKS
Region 19.3	terpene	254,183	266,392

NZ_WWJS01000028.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	T1PKS	1	20,675	High	tetrafibricin	PKS+other:other

NZ_WWJS01000030.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	NRP-metallophore,NRPS	44,269	107,663	High	coelibactin	NRPS:Type I

NZ_WWJS01000031.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 25.1	lanthipeptide-class-i	237,648	264,096
Region 25.2	terpene	395,861	416,919	Low	steffimycin D	PKS:Type II+saccharide:hybrid/tailoring

NZ_WWJS01000032.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	terpene,azole-containing-RiPP	85,421	139,947	High	isorenieratene	terpene
Region 26.2	NRP-metallophore,benzoxazole,NRPS,PKS-like,NRPS-like	206,602	327,044	High	caboxamycin	other:shikimate-derived
Region 26.3	NI-siderophore	470,715	492,712

NZ_WWJS01000033.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 27.1	T1PKS	1	40,831	High	bafilomycin B1	PKS:Type I

NZ_WWJS01000004.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 31.1	RiPP-like	26,110	38,053
Region 31.2	t3nrps-iterative,NRPS-like,T1PKS	73,795	125,875	Low	arginomycin	other:other
Region 31.3	terpene-precursor	177,311	198,354

NZ_WWJS01000005.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 32.1	hydrogen-cyanide	3,664	16,792	Low	aborycin	ribosomal:RiPP
Region 32.2	RiPP-like	122,251	133,648	Low	14-hydroxyisochainin	PKS:Modular type I

NZ_WWJS01000008.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 35.1	T1PKS	1	35,492	Low	ECO-02301	PKS
Region 35.2	NRP-metallophore,NRPS,T1PKS,lanthipeptide-class-iii	127,230	270,984	High	coelichelin	NRPS:Type I
Region 35.3	terpene	409,271	435,841	Medium	hopene	terpene

NZ_WWJS01000009.1 (Streptomyces sp. SID4912)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 36.1	t3nrps-iterative,T1PKS	1	59,779
Region 36.2	NRPS	105,473	168,320

No secondary metabolite regions were found in these records:: NZ_WWJS01000001.1 (Streptomyces sp. SID4912); NZ_WWJS01000010.1 (Streptomyces sp. SID4912); NZ_WWJS01000012.1 (Streptomyces sp. SID4912); NZ_WWJS01000013.1 (Streptomyces sp. SID4912); NZ_WWJS01000014.1 (Streptomyces sp. SID4912); NZ_WWJS01000015.1 (Streptomyces sp. SID4912); NZ_WWJS01000016.1 (Streptomyces sp. SID4912); NZ_WWJS01000021.1 (Streptomyces sp. SID4912); NZ_WWJS01000024.1 (Streptomyces sp. SID4912); NZ_WWJS01000025.1 (Streptomyces sp. SID4912); NZ_WWJS01000027.1 (Streptomyces sp. SID4912); NZ_WWJS01000029.1 (Streptomyces sp. SID4912); NZ_WWJS01000003.1 (Streptomyces sp. SID4912); NZ_WWJS01000034.1 (Streptomyces sp. SID4912); NZ_WWJS01000035.1 (Streptomyces sp. SID4912); NZ_WWJS01000036.1 (Streptomyces sp. SID4912); NZ_WWJS01000006.1 (Streptomyces sp. SID4912); NZ_WWJS01000007.1 (Streptomyces sp. SID4912)

Compact view

NZ_WWJS01000011.1 - Region 1 - NRPS,terpene-precursor

Download region GenBank file

Download region SVG

Location: 11,064 - 68,731 nt. (total: 57,668 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GT018_RS14640: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Hydrolases: esterase

GT018_RS14600: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

GT018_RS14625: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase synthase synthetase

GT018_RS14510: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

GT018_RS14590: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS14665: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: transporter

GT018_RS14610: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000392.5	0.38	NRPS	mirubactin	Actinosynnema mirum DSM 43827
BGC0000357.5	0.34	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.33	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002073.3	0.33	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002286.3	0.31	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.31	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.31	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.30	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.30	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.30	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.67	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000392.5	0.63	NRPS	mirubactin	Actinosynnema mirum DSM 43827

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

GT018_RS14665: PT_FPPS_like

Domain 1 (54 - 342): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.64 out of 27.55

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.03 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.90 out of 36.53

Confidence: medium

Additional weak hits (15):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.96 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.72 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.39 out of 30.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.44 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.10 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.73 out of 36.53

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.90 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.74 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.51 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.09 out of 36.54

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.25 out of 20.01

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.22 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.52 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 11063 - 68731:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - D-Arg)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 11063 - 61029:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - D-Arg)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GT018_RS14590: X - Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (466..859): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHQYFD-SAFDVDTVLGGERNMYGPTEATVDSTT
Nearest Stachelhaus code(s):: Arg DSDDVGAVDK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1929..2321): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LLQAFDVAFWQVNLVVGAEFNAYGPTEVTINSTT
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWNVGAVNK (94% 8Å match); Arg DVENVGAINK (50% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor
GnfM	Regulator of nitrogen-fixation genes

NZ_WWJS01000017.1 - Region 1 - butyrolactone

Download region GenBank file

Download region SVG

Location: 26,310 - 37,260 nt. (total: 10,951 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GT018_RS17625: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GT018_RS17635: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.78	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.76	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.69	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002578.2	0.46	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002404.2	0.42	other (other)	falcarindiol	Solanum lycopersicum
BGC0001633.3	0.42	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002228.3	0.39	NRPS	CIML B, CIML A, CIML D, CIML C	Colletotrichum incanum
BGC0000667.3	0.37	terpene	PR-toxin	Penicillium roqueforti FM164

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.78	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.76	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.69	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002578.2	0.46	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002404.2	0.42	other (other)	falcarindiol	Solanum lycopersicum
BGC0001633.3	0.42	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002228.3	0.39	NRPS	CIML B, CIML A, CIML D, CIML C	Colletotrichum incanum
BGC0000667.3	0.37	terpene	PR-toxin	Penicillium roqueforti FM164

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.64 out of 23.43

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.36 out of 20.97

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.89 out of 26.85

Confidence: medium

Additional weak hits (7):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.59 out of 26.06

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.70 out of 19.26

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.80 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.93 out of 20.97

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.53 out of 27.18

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.95 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.69 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
CcpA	Catabolite control protein A
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_WWJS01000018.1 - Region 1 - thioamitides

Download region GenBank file

Download region SVG

Location: 73,999 - 96,259 nt. (total: 22,261 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase methyltransferase

GT018_RS19450: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

GT018_RS19500: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.48	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002560.3	0.45	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001802.5	0.43	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0001696.5	0.42	ribosomal	neothioviridamide	Streptomyces sp.
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0000625.5	0.40	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0000484.5	0.39	ribosomal	glycocin F	Lactobacillus plantarum
BGC0000500.5	0.39	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000483.5	0.38	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.48	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002560.3	0.45	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001802.5	0.43	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0001696.5	0.42	ribosomal	neothioviridamide	Streptomyces sp.
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0000625.5	0.40	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0000484.5	0.39	ribosomal	glycocin F	Lactobacillus plantarum
BGC0000500.5	0.39	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000483.5	0.38	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 25.18 out of 29.51

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (6):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.50 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.63 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.82 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.23 out of 30.25

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.42 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.04 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
DosR	Hypoxia stress response regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_WWJS01000018.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 327,539 - 348,708 nt. (total: 21,170 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

GT018_RS20645: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001222.3	0.39	ribosomal	acidocin B	Lactobacillus acidophilus
BGC0000491.5	0.39	ribosomal	gassericin A	Lactobacillus gasseri
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000518.3	0.36	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000640.3	0.32	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000643.3	0.32	terpene	carotenoid	Brevundimonas vesicularis
BGC0000528.5	0.31	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001210.5	0.31	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000626.3	0.31	ribosomal	thuricin	Bacillus thuringiensis
BGC0000630.3	0.31	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001222.3	0.39	ribosomal	acidocin B	Lactobacillus acidophilus
BGC0000491.5	0.39	ribosomal	gassericin A	Lactobacillus gasseri
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000518.3	0.36	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000640.3	0.32	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000643.3	0.32	terpene	carotenoid	Brevundimonas vesicularis
BGC0000528.5	0.31	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001210.5	0.31	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000626.3	0.31	ribosomal	thuricin	Bacillus thuringiensis
BGC0000630.3	0.31	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

GT018_RS20645: PT_FPPS_like

Domain 1 (98 - 387): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.91 out of 26.33

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.75 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (10):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.45 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.91 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.16 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.52 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 32.93

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.07 out of 24.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.85 out of 26.12

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 27.04

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.65 out of 23.43

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_WWJS01000019.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1 - 14,824 nt. (total: 14,824 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

GT018_RS20850: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

GT018_RS20840: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.73	ribosomal	albusnodin	Streptomyces albus
BGC0001552.3	0.44	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000927.3	0.44	other (flavin)	roseoflavin	Streptomyces davaonensis JCM 4913
BGC0002298.2	0.44	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0001548.4	0.44	ribosomal	citrulassin A	Streptomyces albulus
BGC0001550.3	0.44	ribosomal	citrulassin D	Streptomyces katrae
BGC0001549.3	0.43	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001634.3	0.43	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001551.4	0.43	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001493.5	0.42	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002006.2	0.73	ribosomal	albusnodin	Streptomyces albus
BGC0001552.3	0.44	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000927.3	0.44	other (flavin)	roseoflavin	Streptomyces davaonensis JCM 4913
BGC0002298.2	0.44	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0001548.4	0.44	ribosomal	citrulassin A	Streptomyces albulus
BGC0001550.3	0.44	ribosomal	citrulassin D	Streptomyces katrae
BGC0001549.3	0.43	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001634.3	0.43	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001551.4	0.43	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001493.5	0.42	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.52 out of 23.79

Confidence: medium

Additional weak hits (4):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.35 out of 27.55

Confidence: weak

Lasso peptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_WWJS01000019.1 - Region 2 - lanthipeptide-class-ii,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 17,021 - 48,458 nt. (total: 31,438 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)
lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

GT018_RS20905: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Hydrolases: protease

GT018_RS21010: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

GT018_RS20960: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.37	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000551.5	0.36	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.36	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.35	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000501.3	0.35	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002111.3	0.34	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000553.3	0.34	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000513.3	0.32	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000517.4	0.29	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000551.5	0.50	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.50	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.49	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002111.3	0.48	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000553.3	0.48	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000513.3	0.46	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001407.5	0.45	ribosomal	bicereucin	Bacillus cereus SJ1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for GT018_RS20960

GT018_RS20925

Leader:

AIKAHAALGG

Core:

QLVHGCQSVPDQSGGVVAPYGASMANFLEDLADFKAGRIEQVYAHRVTAAE

Core with dehydrations:

QLVHGCysQDhaVPDQDhaGGVVAPYGADhaMANFLEDLADFKAGRIEQVYAHRVDhbAAE

antiSMASH-DB 4.0 matches for GT018_RS20925

100.0%

NZ_WWJS01000019.1:

Lanthipeptides: GT018_RS20925_lanthipeptide

1

QLVHGCQSVPDQSGGVVAPYGASMANFLEDLADFKAGRIEQVYAHRVTAAE

51

QLVHGCQSVPDQSGGVVAPYGASMANFLEDLADFKAGRIEQVYAHRVTAAE

1

QLVHGCQSVPDQSGGVVAPYGASMANFLEDLADFKAGRIEQVYAHRVTAAE

51

86.3%

NZ_CP029342.1:

Lanthipeptides: B9S64_RS10680_lanthipeptide

1

QLVHGCQSVPDQSGGVVAPYGASMANFLEDLADFKAGRIEQVYAHRVTAAE

51

+LVHGC SVPDQSGGVVAP GASMANF DLA+FKAG IEQVYAHRVTAAE

1

RLVHGCHSVPDQSGGVVAPSGASMANFRGDLAEFKAGWIEQVYAHRVTAAE

51

15.7%

NZ_CP068102.1and 5 others:

NZ_CP068102.1 Lanthipeptides: allorf_1181060_1181164_lanthipeptideNZ_CP079819.1 Lanthipeptides: allorf_0009138_0009242_lanthipeptideNZ_CP079819.1 Lanthipeptides: allorf_0009138_0009242_lanthipeptideNZ_LR134479.1 Lanthipeptides: allorf_0265791_0265895_lanthipeptideNZ_LR134479.1 Lanthipeptides: allorf_0265791_0265895_lanthipeptide

Lanthipeptides: allorf_1181060_1181164_lanthipeptide

5

GCQSVPDQSGGVVAPY

20

G VP +GG APY

1

GLLGVPSCAGGAFAPY

16

with 1 more sequence matches

13.7%

NZ_CP022163.1:

Lanthipeptides: MEBOL_RS24465_lanthipeptide

9

VPDQSGGVVAPYGASMANFL

28

VP SGG + Y F

7

VPGNSGGWICTYSTECKPFC

26

MIBiG 4.0 matches for GT018_RS20925

7.8%

BGC0002120.3 (NQE92413.1):

Lanthipeptide: nocathioamide A

11

DQSGGVVAP

19

D+S AP

30

DESSRPAAP

38

GT018_RS20945

Leader:

MQCQLSVHGDDEHYG

Core:

LLGDSEYGTALWLRWRGRADVELTVLPDCPLVGPEPDGEGCCLFADHAEQHTWQDSREESPCTS

Core with dehydrations:

LLGDDhaEYGDhbALWLRWRGRADVELDhbVLPDCysPLVGPEPDGEGCysCysLFADHAEQHDhbWQDDhaREEDhaPCysDhbDha

antiSMASH-DB 4.0 matches for GT018_RS20945

31.2%

NZ_JABBWY010000002.1:

Lanthipeptides: HHX37_RS08020_lanthipeptide

15

WRGRADVELTVLPDCPLVGPEPDGEGCCLFADHAEQHTWQDSREESPCT

63

WR ADVE DCP GP GE +A+ T D+R S CT

1

WRSGADVEGW---DCP-AGPLFIGE----YAESEITLTALDTRRPSSCT

41

10.9%

NZ_CM000758.1:

Lanthipeptides: allorf_3265670_3265795_lanthipeptide

42

CLFADHAEQHTWQDSREES

60

C+F D ++ T+Q+ E S

3

CIFYDFNQEDTYQNKDESS

21

allorf_020340_020489

Leader:

MDRGGIAGG

Core:

ALVTDASDGGGGGDLPRRVRCARRAGLRPRPGRGAFWITK

Core with dehydrations:

ALVDhbDADhaDGGGGGDLPRRVRCysARRAGLRPRPGRGAFWIDhbK

antiSMASH-DB 4.0 matches for allorf_020340_020489

100.0%

NZ_WWJS01000019.1:

Lanthipeptides: allorf_020340_020489_lanthipeptide

1

ALVTDASDGGGGGDLPRRVRCARRAGLRPRPGRGAFWITK

40

ALVTDASDGGGGGDLPRRVRCARRAGLRPRPGRGAFWITK

1

ALVTDASDGGGGGDLPRRVRCARRAGLRPRPGRGAFWITK

40

22.5%

NZ_CP006872.1:

Lanthipeptides: allorf_5538288_5538485_lanthipeptide

9

GGGGGDLPRRVRCARRAGLRPRPGRGAFW

37

GG G D +C G GAF

9

GGCGDDKTDNTKCVATCGKNCYTNIGAFC

37

allorf_020362_020535

Leader:

MVLSSRTLRTAAEAVTCPGG

Core:

CGAPGELVFGRGRGVGPSGSPSNGPGRRPSGIFPAGR

Core with dehydrations:

CysGAPGELVFGRGRGVGPDhaGDhaPDhaNGPGRRPDhaGIFPAGR

antiSMASH-DB 4.0 matches for allorf_020362_020535

100.0%

NZ_WWJS01000019.1:

Lanthipeptides: allorf_020362_020535_lanthipeptide

1

CGAPGELVFGRGRGVGPSGSPSNGPGRRPSGIFPAGR

37

CGAPGELVFGRGRGVGPSGSPSNGPGRRPSGIFPAGR

1

CGAPGELVFGRGRGVGPSGSPSNGPGRRPSGIFPAGR

37

19.1%

NZ_CP041613.2:

Lanthipeptides: allorf_01202582_01202800_lanthipeptide

11

RGRGVGPSGSPSNGPGRRP

29

R RG+ +G + GP RRP

1

RARGLLVTGRDTLGPARRP

19

18.9%

NZ_CP029541.1and 3 others:

NZ_CP102609.1 Lassopeptides: allorf_2471016_2471141_lassopeptideNZ_CP114202.1 Lassopeptides: allorf_6845527_6845652_lassopeptideNZ_CP114203.1 Lassopeptides: allorf_7314915_7315040_lassopeptide

Lassopeptides: allorf_2511772_2511897_lassopeptide

22

SNGPGRRPSGIF

33

G RRP GIF

8

DKGHRRRPKGIF

19

with 1 more sequence matches

18.9%

NZ_CP102665.1and 2 others:

NZ_FNYZ01000030.1 Lassopeptides: BMY84_RS29505_lassopeptideNZ_LXVX01000002.1 Lassopeptides: A7Q26_RS24985_lassopeptide

Lassopeptides: NUH86_RS19075_lassopeptide

18

SGSPSNGPGRRPSGI

32

+G PS+G G R +G+

4

AGEPSDGVGYRLNGM

18

MIBiG 4.0 matches for allorf_020362_020535

10.8%

BGC0002150.2 (MBO0654592.1):

Lasso peptide: triculamin

4

PGELVFGRG

12

PG+ + G+G

6

PGDGIRGKG

14

allorf_025167_025319

Leader:

MRRTDGTRMAGS

Core:

RRGCPGPPDSLPRAPPPKGPTSDRSHATPAVSSARQAA

Core with dehydrations:

RRGCysPGPPDDhaLPRAPPPKGPDhbDhaDRDhaHADhbPAVDhaDhaARQAA

antiSMASH-DB 4.0 matches for allorf_025167_025319

100.0%

NZ_WWJS01000019.1:

Lanthipeptides: allorf_025167_025319_lanthipeptide

1

RRGCPGPPDSLPRAPPPKGPTSDRSHATPAVSSARQAA

38

RRGCPGPPDSLPRAPPPKGPTSDRSHATPAVSSARQAA

1

RRGCPGPPDSLPRAPPPKGPTSDRSHATPAVSSARQAA

38

97.4%

NZ_CP029342.1:

Lanthipeptides: allorf_2407994_2408146_lanthipeptide

1

RRGCPGPPDSLPRAPPPKGPTSDRSHATPAVSSARQAA

38

RRGCPGPP SLPRAPPPKGPTSDRSHATPAVSSARQAA

1

RRGCPGPPGSLPRAPPPKGPTSDRSHATPAVSSARQAA

38

28.9%

NZ_CP087137.1:

Lanthipeptides: allorf_0100835_0100972_lanthipeptide

5

PGPPDSLPRAPPPKGPTSDRSHATPAVSS

33

PG D L R P G T AV+S

5

PGCIDLLTRRPYRAGRQCQVGSLTGAVAS

33

with 1 more sequence matches

23.7%

NZ_CP048405.1and 3 others:

NZ_CP048405.1 Lanthipeptides: GXW83_RS22630_lanthipeptideNZ_CP048405.1 Lanthipeptides: GXW83_RS22630_lanthipeptideNZ_CP048405.1 Lanthipeptides: GXW83_RS22630_lanthipeptide

Lanthipeptides: GXW83_RS22630_lanthipeptide

11

LPRAPPPKGPTSDRSHATPAVSSA

34

LP P+SDR+ + +VS A

5

LPLQELTDNPSSDRAVMSSSVSLA

28

allorf_025277_025432

Leader:

MAHSVVQDRCFDRLSWHGSQVARPLAGA

Core:

PDHAERMLGRYAACRADDTAGVA

Core with dehydrations:

PDHAERMLGRYAACysRADDDhbAGVA

antiSMASH-DB 4.0 matches for allorf_025277_025432

100.0%

NZ_CP029342.1and 1 other:

NZ_WWJS01000019.1 Lanthipeptides: allorf_025277_025432_lanthipeptide

Lanthipeptides: allorf_2408104_2408259_lanthipeptide

1

PDHAERMLGRYAACRADDTAGVA

23

PDHAERMLGRYAACRADDTAGVA

1

PDHAERMLGRYAACRADDTAGVA

23

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (15):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.10 out of 28.14

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.40 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.35 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.96 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.20 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.56 out of 30.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.65 out of 24.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.91 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.06 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

GT018_RS20925 - Class II

Cleavage pHMM score: -3.80

RODEO score: 0

Monoisotopic mass: 5329.6 Da

Molecular weight: 5332.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 5350.9 Da N = 1; 5368.9 Da N = 2; 5386.9 Da N = 3

GT018_RS20945 - Class II

Cleavage pHMM score: -4.10

RODEO score: 0

Monoisotopic mass: 6968.3 Da

Molecular weight: 6972.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 6990.6 Da N = 1; 7008.6 Da N = 2; 7026.6 Da N = 3; 7044.7 Da N = 4

allorf_020340_020489 - Class II

Cleavage pHMM score: -2.70

RODEO score: 0

Monoisotopic mass: 4164.3 Da

Molecular weight: 4166.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4184.7 Da N = 1; 4202.8 Da N = 2

allorf_020362_020535 - Class II

Cleavage pHMM score: -0.70

RODEO score: 0

Monoisotopic mass: 3490.8 Da

Molecular weight: 3492.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3510.9 Da N = 1; 3528.9 Da N = 2; 3546.9 Da N = 3

allorf_025167_025319 - Class II

Cleavage pHMM score: -6.70

RODEO score: 0

Monoisotopic mass: 3719.0 Da

Molecular weight: 3721.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3739.1 Da N = 1; 3757.1 Da N = 2; 3775.2 Da N = 3; 3793.2 Da N = 4; 3811.2 Da N = 5; 3829.2 Da N = 6

allorf_025277_025432 - Class II

Cleavage pHMM score: -5.20

RODEO score: 0

Monoisotopic mass: 2427.1 Da

Molecular weight: 2428.7 Da

Number of bridges: 1

TFBS definitions

Regulator	Description

NZ_WWJS01000002.1 - Region 1 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 1 - 9,283 nt. (total: 9,283 nt) Show pHMM detection rules used

Region on contig edge.

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

GT018_RS00450: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

GT018_RS00460: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Similar gene clusters

Analysis type:

Reference	hydrogen-cyanide	Similarity score	Type	Compound(s)	Organism
BGC0002345.2		0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002789.2		0.25	PKS	pentamycin, filipin	Streptomyces lavendulae strain YAKB-15

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0002345.2		0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002789.2		0.25	PKS	pentamycin, filipin	Streptomyces lavendulae strain YAKB-15

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.00 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.58 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.86 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.34 out of 29.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_WWJS01000002.1 - Region 2 - T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 36,927 - 90,321 nt. (total: 53,395 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

GT018_RS00670: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

GT018_RS00680: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

GT018_RS00615: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

GT018_RS00685: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

GT018_RS00655: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

GT018_RS00675: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.52	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002164.2	0.51	NRPS	peramine	Epichloe festucae
BGC0002192.3	0.50	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.50	PKS	ACT-Toxin II	Alternaria alternata
BGC0001268.4	0.49	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001872.3	0.43	PKS	fabclavine-polyamine	Xenorhabdus bovienii SS-2004
BGC0002648.2	0.42	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000861.5	0.42	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000862.3	0.42	other (other)	eicosapentaenoic acid	Shewanella pneumatophori

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002164.2	0.59	NRPS	peramine	Epichloe festucae
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001872.3	0.54	PKS	fabclavine-polyamine	Xenorhabdus bovienii SS-2004
BGC0002648.2	0.54	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000861.5	0.54	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000862.3	0.54	other (other)	eicosapentaenoic acid	Shewanella pneumatophori

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.90 out of 30.12

Confidence: medium

Additional weak hits (9):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.90 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.02 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.02 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.97 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.68 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.04 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 24.65 out of 35.63

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.55 out of 27.18

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 36926 - 90321:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GT018_RS00670: mmal

PKS_AT (977..1202): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 27.8
Methoxymalonyl-CoA: 27.5
Malonyl-CoA: 14.7
Ethylmalonyl-CoA: 14.2
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
Propionyl-CoA: -3.6
2-Methylbutyryl-CoA: -4.5

GT018_RS00675: mal

PKS_AT (573..870): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 101.3
Methoxymalonyl-CoA: 34.9
inactive: 31.1
Methylmalonyl-CoA: 30.6
Propionyl-CoA: 20.5
CHC-CoA: 18.9
Ethylmalonyl-CoA: 15.8
2-Methylbutyryl-CoA: 14.6
fatty_acid: 13.7
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_WWJS01000002.1 - Region 3 - RiPP-like

Download region GenBank file

Download region SVG

Location: 482,670 - 494,838 nt. (total: 12,169 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.43	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000711.5	0.26	saccharide	neomycin	Streptomyces fradiae
BGC0000709.5	0.25	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0000713.5	0.25	saccharide	ribostamycin	Streptomyces ribosidificus
BGC0000689.3	0.22	saccharide	2-deoxystreptamine	Micromonospora echinospora
BGC0000395.5	0.21	NRPS	nocardicin A	Nocardia uniformis subsp. tsuyamanensis
BGC0000283.4	0.20	other (cyclitol)	cetoniacytone A	Actinomyces sp. Lu 9419
BGC0000700.5	0.20	saccharide	istamycin	Streptomyces tenjimariensis
BGC0000712.5	0.20	saccharide	paromomycin	Streptomyces rimosus subsp. paromomycinus
BGC0000714.5	0.19	saccharide	sisomicin	Micromonospora inyonensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.43	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000711.5	0.26	saccharide	neomycin	Streptomyces fradiae
BGC0000709.5	0.25	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0000713.5	0.25	saccharide	ribostamycin	Streptomyces ribosidificus
BGC0000689.3	0.22	saccharide	2-deoxystreptamine	Micromonospora echinospora
BGC0000395.5	0.21	NRPS	nocardicin A	Nocardia uniformis subsp. tsuyamanensis
BGC0000283.4	0.20	other (cyclitol)	cetoniacytone A	Actinomyces sp. Lu 9419
BGC0000700.5	0.20	saccharide	istamycin	Streptomyces tenjimariensis
BGC0000712.5	0.20	saccharide	paromomycin	Streptomyces rimosus subsp. paromomycinus
BGC0000714.5	0.19	saccharide	sisomicin	Micromonospora inyonensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.84 out of 30.12

Confidence: medium

Additional weak hits (2):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.99 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.76 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_WWJS01000002.1 - Region 4 - ectoine

Download region GenBank file

Download region SVG

Location: 1,001,543 - 1,011,941 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

GT018_RS04840: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

GT018_RS04850: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.89	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.86	other (ectoine)	ectoine	Streptomyces sp.
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.72	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.72	other (other)	ectoine	Methylophaga thalassica
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000857.3	0.64	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.63	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.89	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.86	other (ectoine)	ectoine	Streptomyces sp.
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.72	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.72	other (other)	ectoine	Methylophaga thalassica
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000857.3	0.64	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.63	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.28 out of 23.43

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (5):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.75 out of 23.43

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.08 out of 18.57

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.59 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator

NZ_WWJS01000020.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1 - 18,972 nt. (total: 18,972 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

GT018_RS21565: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

GT018_RS21570: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0002120.3	0.36	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000444.5	0.36	NRPS	thaxtomin A	Streptomyces turgidiscabies Car8
BGC0000796.3	0.26	saccharide	S-layer glycan	Paenibacillus alvei
BGC0000197.5	0.26	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000333.5	0.25	NRPS	cyclomarin D	Salinispora arenicola CNS-205
BGC0002587.2	0.20	PKS	ossamycin	Streptomyces ossamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0002120.3	0.36	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000444.5	0.36	NRPS	thaxtomin A	Streptomyces turgidiscabies Car8
BGC0000796.3	0.26	saccharide	S-layer glycan	Paenibacillus alvei
BGC0000197.5	0.26	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000333.5	0.25	NRPS	cyclomarin D	Salinispora arenicola CNS-205
BGC0002587.2	0.20	PKS	ossamycin	Streptomyces ossamyceticus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 22.60 out of 23.79

Confidence: strong

Additional weak hits (1):

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.56 out of 35.63

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 156 - 248; Score: 57.8

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_WWJS01000022.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 12 - 88,943 nt. (total: 88,932 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

GT018_RS22425: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GT018_RS22440: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

GT018_RS22470: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase acylase aminotransferase kinase

GT018_RS22335: aminotransferase

smcogs: SMCOG1019: aminotransferase

GT018_RS22365: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

GT018_RS22455: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

GT018_RS22515: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: esterase

GT018_RS22480: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

GT018_RS22395: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

GT018_RS22370: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS22430: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GT018_RS22450: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GT018_RS22460: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GT018_RS22465: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

GT018_RS22485: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Translocases: transporter

GT018_RS22535: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.87	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.87	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.86	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.84	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.83	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001050.5	0.82	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001164.3	0.81	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001135.5	0.81	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.80	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.80	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001050.5	0.73	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.72	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (26):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.01 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.20 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.21 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.09 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.03 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.09 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.85 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.25 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.94 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.69 out of 27.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.17 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.62 out of 26.12

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.23 out of 20.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.47 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.15 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.09 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.63 out of 20.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.53 out of 27.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.51 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.46 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.03 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.04 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.78 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 11 - 88943:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (Ser) + (mal) + (NH2 - Me-redmal) + (Ala - D-Val) + (Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GT018_RS22370: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (463..878): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LACHFDFSVWEGSQVFGGEVNMYGITETTVHASH
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

GT018_RS22430: Ala - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (500..893): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAMTFDIATLELQALICGEWNMYGPSETTIYSLG
Nearest Stachelhaus code(s):: Ala DILQLCMIYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1560..1959): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDHSFDASTYEVFFLAGGETNGYGPTETTTFAVL
Nearest Stachelhaus code(s):: Val DAYFLGGTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

GT018_RS22450: NH2 - mmal

CAL_domain (41..487): NH2

minowa: NH2

Prediction, score:

NH2: 161.1
Acetyl-CoA: 63.4
fatty_acid: 19.8
AHBA: 8.4
shikimic_acid: 0.0

PKS_AT (1251..1552): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Methylmalonyl-CoA: 75.0%; Propionyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 111.9
Methoxymalonyl-CoA: 102.0
Malonyl-CoA: 84.3
Isobutyryl-CoA: 83.9
Ethylmalonyl-CoA: 71.9
Propionyl-CoA: 64.0
3-Methylbutyryl-CoA: 58.0
Acetyl-CoA: 51.0
trans-1,2-CPDA: 46.8
Benzoyl-CoA: 46.2
2-Methylbutyryl-CoA: 44.4
CHC-CoA: 38.6
fatty_acid: 25.3
inactive: 21.9

GT018_RS22455: mal

PKS_AT (563..860): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 171.3
inactive: 124.9
Methoxymalonyl-CoA: 85.4
Methylmalonyl-CoA: 72.9
Isobutyryl-CoA: 45.6
Propionyl-CoA: 45.0
Ethylmalonyl-CoA: 42.6
2-Methylbutyryl-CoA: 33.3
Benzoyl-CoA: 28.4
CHC-CoA: 22.8
fatty_acid: 21.3
Acetyl-CoA: 19.2
3-Methylbutyryl-CoA: 18.8
trans-1,2-CPDA: 14.2

GT018_RS22460: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (494..890): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFLCSGEHNLYGPTEAAIDVSA
Nearest Stachelhaus code(s):: Ser DVWHLSLIDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

GT018_RS22465: mal

PKS_AT (545..839): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 161.4
inactive: 89.0
Methoxymalonyl-CoA: 79.6
Methylmalonyl-CoA: 71.0
Propionyl-CoA: 53.7
Ethylmalonyl-CoA: 43.3
Isobutyryl-CoA: 38.9
CHC-CoA: 37.6
Benzoyl-CoA: 34.3
2-Methylbutyryl-CoA: 30.4
Acetyl-CoA: 29.9
trans-1,2-CPDA: 15.8
fatty_acid: 13.9
3-Methylbutyryl-CoA: 8.9

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_WWJS01000023.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 24,092 - 45,069 nt. (total: 20,978 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase

GT018_RS22925: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Lyases: cyclase hydratase

GT018_RS22915: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

GT018_RS22935: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.41	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0001743.3	0.39	ribosomal	plantaricyclin	Lactobacillus plantarum
BGC0000903.3	0.39	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000527.5	0.37	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000547.5	0.36	ribosomal	salivaricin 9	Streptococcus salivarius
BGC0001210.5	0.36	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001810.3	0.36	PKS	trehangelin	Polymorphospora rubra
BGC0001789.3	0.36	ribosomal	suicin 90-1330	Streptococcus suis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.41	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0001743.3	0.39	ribosomal	plantaricyclin	Lactobacillus plantarum
BGC0000903.3	0.39	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000527.5	0.37	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000547.5	0.36	ribosomal	salivaricin 9	Streptococcus salivarius
BGC0001210.5	0.36	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001810.3	0.36	PKS	trehangelin	Polymorphospora rubra
BGC0001789.3	0.36	ribosomal	suicin 90-1330	Streptococcus suis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

GT018_RS22935: T1TS

Domain 1 (1 - 305): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.64 out of 27.55

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (5):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.65 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.47 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.83 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.36 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.81 out of 18.57

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
GnfM	Regulator of nitrogen-fixation genes
OsdR	Development and stress management regulator

NZ_WWJS01000026.1 - Region 1 - melanin

Download region GenBank file

Download region SVG

Location: 143,121 - 153,621 nt. (total: 10,501 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

GT018_RS24225: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: glycosyltransferase

GT018_RS24255: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000911.3	0.81	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.42	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000662.5	0.37	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000889.5	0.36	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001624.3	0.36	other (other)	iso-A82775C	Pestalotiopsis fici
BGC0001223.5	0.35	other (other)	hydroxysporine	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000911.3	0.81	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.42	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000662.5	0.37	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000889.5	0.36	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001624.3	0.36	other (other)	iso-A82775C	Pestalotiopsis fici
BGC0001223.5	0.35	other (other)	hydroxysporine	uncultured bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (2):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.05 out of 26.85

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.63 out of 29.51

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor

NZ_WWJS01000026.1 - Region 2 - T2PKS,terpene

Download region GenBank file

Download region SVG

Location: 172,810 - 245,325 nt. (total: 72,516 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

GT018_RS24370: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

GT018_RS24380: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

GT018_RS24430: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

GT018_RS24465: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

GT018_RS24655: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: acetyltransferase methyltransferase

GT018_RS24505: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

GT018_RS24645: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: dehalogenase hydrolase

GT018_RS24445: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

GT018_RS24460: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

GT018_RS24600: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

GT018_RS24495: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

GT018_RS24500: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

GT018_RS24525: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase

GT018_RS24450: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS24455: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS24480: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GT018_RS24485: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	1.14	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000215.5	1.08	PKS	curamycin	Streptomyces cyaneus
BGC0000272.3	0.89	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.80	PKS	spore pigment	Streptomyces avermitilis
BGC0000231.5	0.55	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.48	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.47	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001197.5	0.47	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001273.3	0.45	PKS	asperlactone	Aspergillus ochraceus
BGC0001723.5	0.41	PKS	oviedomycin	Streptomyces antibioticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000215.5	0.81	PKS	curamycin	Streptomyces cyaneus
BGC0000271.5	0.75	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.74	PKS	spore pigment	Streptomyces collinus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001513.3	0.59	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

GT018_RS24525: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (337 - 697): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.52 out of 29.72

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.04 out of 23.79

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.17 out of 30.11

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.37 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.70 out of 23.79

Confidence: medium

Additional weak hits (20):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.17 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.03 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.89 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.54 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.26 out of 26.85

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.90 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.33 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.84 out of 28.14

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.13 out of 36.54

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.33 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.89 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.94 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.83 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.98 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.80 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Type II PKS

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 172809 - 245325:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal)
Non-colinear ordering:: GT018_RS24485 + GT018_RS24490

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GT018_RS24450: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (13..406): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: ASALAQMHVF-PFAYYGASYNCFGQSEIGPLATV
Nearest Stachelhaus code(s):: Abu DAWFYGAPLK (24% 8Å match)
Stachelhaus code match:: 60% (weak)

GT018_RS24455: X

AMP-binding (82..332): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SAAVYGLFTGGGMIVFGAEVDIYGLSE----VMG
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (26% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 172809 to 245325
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

GT018_RS24405: MET (Score: 55.2; E-value: 1.4e-17)
GT018_RS24430: OXY (Score: 18.4; E-value: 2.1e-06)
GT018_RS24465: OXY (Score: 289.5; E-value: 1.2e-88)
GT018_RS24475: CYC C5-C18 (Score: 212.1; E-value: 5e-66)
GT018_RS24480: KS (Score: 717.0; E-value: 1.6e-218)
GT018_RS24485: CLF (Score: 545.7; E-value: 1.4e-166)
GT018_RS24490: ACP (Score: 61.9; E-value: 9.9e-20)
GT018_RS24495: CYC C9-C14 (Score: 244.6; E-value: 6.9e-76)
GT018_RS24500: CYC C4-C21/C2-C23|C2-C19 (Score: 161.5; E-value: 1.2e-50)
GT018_RS24505: MET C6|C8 (Score: 530.4; E-value: 3.5e-162)

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C

NZ_WWJS01000026.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 254,183 - 266,392 nt. (total: 12,210 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

GT018_RS24725: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Lyases: cyclase

GT018_RS24730: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.42	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001948.3	0.37	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001911.3	0.36	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.34	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000444.5	0.29	NRPS	thaxtomin A	Streptomyces turgidiscabies Car8
BGC0001483.4	0.29	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001197.5	0.29	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001840.2	0.28	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0002482.2	0.26	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0002434.2	0.24	NRPS, PKS	clifednamide D, clifednamide E, clifednamide F, clifednamide G, clifednamide H, clifednamide I, clifednamide J	Kitasatospora sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.42	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001948.3	0.37	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001911.3	0.36	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.34	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000444.5	0.29	NRPS	thaxtomin A	Streptomyces turgidiscabies Car8
BGC0001483.4	0.29	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001197.5	0.29	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001840.2	0.28	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0002482.2	0.26	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0002434.2	0.24	NRPS, PKS	clifednamide D, clifednamide E, clifednamide F, clifednamide G, clifednamide H, clifednamide I, clifednamide J	Kitasatospora sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

GT018_RS24730: T1TS

Domain 1 (2 - 318): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.75 out of 23.05

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

Additional weak hits (6):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.29 out of 23.43

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.80 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.99 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.47 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.95 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.86 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_WWJS01000028.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 20,675 nt. (total: 20,675 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

GT018_RS24900: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.64	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000143.5	0.62	PKS	salinomycin	Streptomyces albus
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001051.5	0.59	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0001298.4	0.58	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus
BGC0000094.5	0.57	PKS, saccharide	methymycin	Streptomyces venezuelae
BGC0001065.5	0.55	PKS	herboxidiene	Streptomyces chromofuscus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.64	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000143.5	0.62	PKS	salinomycin	Streptomyces albus
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001051.5	0.59	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0001298.4	0.58	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus
BGC0000094.5	0.57	PKS, saccharide	methymycin	Streptomyces venezuelae
BGC0001065.5	0.55	PKS	herboxidiene	Streptomyces chromofuscus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 20675:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal - ohemal - ccmal) + (pk)
Non-colinear ordering:: GT018_RS24900 + GT018_RS31655

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GT018_RS31655: pk

PKS_AT (598..896): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 227.2
Methylmalonyl-CoA: 224.7
Methoxymalonyl-CoA: 189.0
2-Methylbutyryl-CoA: 177.4
trans-1,2-CPDA: 149.4
Malonyl-CoA: 121.2
Propionyl-CoA: 120.4
CHC-CoA: 114.2
Benzoyl-CoA: 78.5
Isobutyryl-CoA: 76.1
3-Methylbutyryl-CoA: 47.4
Acetyl-CoA: 44.2
inactive: 33.7
fatty_acid: 33.5

GT018_RS24900: mmal - emal - mal

PKS_AT (0..272): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 193.7
Ethylmalonyl-CoA: 186.1
Methoxymalonyl-CoA: 158.1
2-Methylbutyryl-CoA: 130.9
trans-1,2-CPDA: 112.1
Propionyl-CoA: 102.5
CHC-CoA: 89.8
Isobutyryl-CoA: 72.4
Malonyl-CoA: 67.8
Benzoyl-CoA: 62.8
Acetyl-CoA: 58.0
fatty_acid: 45.5
3-Methylbutyryl-CoA: 33.9
inactive: 17.2

PKS_AT (1563..1861): emal

ATSignature: Ethylmalonyl-CoA, Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 95.8%; Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 95.8%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 212.8
Methylmalonyl-CoA: 196.0
Methoxymalonyl-CoA: 177.9
trans-1,2-CPDA: 143.2
2-Methylbutyryl-CoA: 126.8
Propionyl-CoA: 101.7
CHC-CoA: 86.5
Malonyl-CoA: 85.1
Benzoyl-CoA: 61.4
Isobutyryl-CoA: 55.4
Acetyl-CoA: 37.7
3-Methylbutyryl-CoA: 31.5
fatty_acid: 25.2
inactive: 22.9

PKS_AT (3133..3429): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 216.0
inactive: 107.1
Methoxymalonyl-CoA: 62.7
Methylmalonyl-CoA: 55.6
Propionyl-CoA: 35.3
Ethylmalonyl-CoA: 31.4
Isobutyryl-CoA: 24.1
Acetyl-CoA: 23.1
CHC-CoA: 18.2
2-Methylbutyryl-CoA: 17.8
Benzoyl-CoA: 9.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

NZ_WWJS01000030.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 44,269 - 107,663 nt. (total: 63,395 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

GT018_RS26120: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GT018_RS26215: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: amidase esterase hydrolase protease

GT018_RS26140: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

GT018_RS26175: amidase

smcogs: SMCOG1105: amidase

GT018_RS26210: thioesterase

smcogs: SMCOG1004: thioesterase

GT018_RS26270: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Isomerases: isomerase

GT018_RS26190: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

GT018_RS26230: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GT018_RS26235: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GT018_RS26240: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000324.5	1.23	NRPS	coelibactin	Streptomyces coelicolor A3(2)
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.60	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000324.5	0.85	NRPS	coelibactin	Streptomyces coelicolor A3(2)
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	0.64	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.89 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.03 out of 20.97

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.41 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (20):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.20 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.25 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.64 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.54 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.58 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.37 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.23 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.76 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.10 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.10 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.13 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.73 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.54 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.36 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.62 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.23 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.39 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 44268 - 107663:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - Cys) + (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GT018_RS26230: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (543..941): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDIAFDLSVYDGNSLISGDVSLGGATEGSIWSIA
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

GT018_RS26235: Thr - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (564..959): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TAMSFDLATWDAQCLLGGDVALGGMTEAAVHSTV
Nearest Stachelhaus code(s):: Thr DLWQLGLVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1614..2007): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVSFDLSVYDGNTLVSGDVAMGGATEAAIWSNT
Nearest Stachelhaus code(s):: Cys DLYNLSMIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

GT018_RS26240: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (32..454): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NACLFTFACPGGSLQVGGAQQVFGMAEGLINLTR
Nearest Stachelhaus code(s):: diOH-Bz TMPSQGVVNK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_WWJS01000031.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 237,648 - 264,096 nt. (total: 26,449 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: synthase

GT018_RS27645: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Hydrolases: synthase

GT018_RS27645: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Lyases: cyclase dehydratase

GT018_RS27670: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

GT018_RS27675: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000927.3	0.44	other (flavin)	roseoflavin	Streptomyces davaonensis JCM 4913
BGC0000544.4	0.41	ribosomal	planosporicin	Planomonospora alba
BGC0002120.3	0.37	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000529.5	0.35	ribosomal	microbisporicin A2	Microbispora corallina
BGC0001959.4	0.34	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0001972.4	0.33	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000236.5	0.24	PKS	kinamycin	Streptomyces murayamaensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000927.3	0.44	other (flavin)	roseoflavin	Streptomyces davaonensis JCM 4913
BGC0000544.4	0.41	ribosomal	planosporicin	Planomonospora alba
BGC0002120.3	0.37	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000529.5	0.35	ribosomal	microbisporicin A2	Microbispora corallina
BGC0001959.4	0.34	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0001972.4	0.33	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000236.5	0.24	PKS	kinamycin	Streptomyces murayamaensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.44 out of 29.65

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 163 - 255; Score: 68.1

TFBS definitions

Regulator	Description

NZ_WWJS01000031.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 395,861 - 416,919 nt. (total: 21,059 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GT018_RS28390: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: formyltransferase

GT018_RS28360: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Lyases: cyclase hydratase

GT018_RS28380: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

GT018_RS28400: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002708.2	0.76	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002707.2	0.47	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000631.5	0.37	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0002034.3	0.36	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000879.5	0.35	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0000881.3	0.33	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001808.5	0.33	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0000772.5	0.33	saccharide	lipopolysaccharide	Brucella melitensis
BGC0002255.3	0.33	PKS	lijiquinone	Ascomycota sp. F53
BGC0001865.4	0.32	PKS	elsinochrome C	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002708.2	0.76	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002707.2	0.47	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000631.5	0.37	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0002034.3	0.36	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000879.5	0.35	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0000881.3	0.33	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001808.5	0.33	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0000772.5	0.33	saccharide	lipopolysaccharide	Brucella melitensis
BGC0002255.3	0.33	PKS	lijiquinone	Ascomycota sp. F53
BGC0001865.4	0.32	PKS	elsinochrome C	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene			C10	C1-C10	none
sesquiterpene			C15	C1-C10	none

Genes with terpene domains:

GT018_RS28380: T1TS

Domain 1 (4 - 315): Type 1 terpene synthase

Subtype: Germacrene A synthase type

Reactions:: GPP → monoterpene_C1-C10; FPP → sesquiterpene_C1-C10

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.10 out of 23.79

Confidence: medium

Additional weak hits (15):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.02 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.23 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.53 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.64 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.70 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.15 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.18 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.76 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.15 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.63 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.90 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.45 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.59 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.12 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GPP	Geranyl diphoshate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_WWJS01000032.1 - Region 1 - azole-containing-RiPP,terpene

Download region GenBank file

Download region SVG

Location: 85,421 - 139,947 nt. (total: 54,527 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GT018_RS28990: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

GT018_RS29005: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

GT018_RS29020: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

GT018_RS29035: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase methyltransferase

GT018_RS28980: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

GT018_RS29010: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

GT018_RS29075: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Lyases: dehydratase

GT018_RS29110: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Ligases: synthase synthetase

GT018_RS28985: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

GT018_RS29030: argininosuccinate synthase

smcogs: SMCOG1291: argininosuccinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.57	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.45	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.42	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.39	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.38	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000231.5	0.29	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.25	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.23	PKS	oviedomycin	Streptomyces antibioticus
BGC0001567.4	0.23	NRPS	cysteoamide	Streptomyces lincolnensis
BGC0000384.6	0.22	NRPS	lyngbyatoxin	Lyngbya majuscula

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.82	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.75	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.75	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.71	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.71	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.55	terpene	carotenoid	Myxococcus xanthus
BGC0001146.5	0.53	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001860.4	0.52	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000613.5	0.52	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

GT018_RS28985: PT_FPPS_like

Domain 1 (62 - 360): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

GT018_RS28995: PT_phytoene_like

Domain 1 (16 - 319): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

GT018_RS29015: Lycopene_cycl

Domain 1 (17 - 391): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 19.46 out of 20.01

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.44 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

Additional weak hits (11):

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.73 out of 36.53

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.66 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.40 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.68 out of 29.38

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.25 out of 20.01

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.82 out of 27.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.05 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.22 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.18 out of 20.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.31 out of 27.04

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.56 out of 32.93

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

Terpene

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 10 - 89; Score: 59.4; RRE type: Heterocycloanthracin_C_RRE; Location: 10 - 93; Score: 36.8

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
ArgR	Regulator of arginine biosynthesis genes
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_WWJS01000032.1 - Region 2 - NRP-metallophore,NRPS,NRPS-like,PKS-like,benzoxazole

Download region GenBank file

Download region SVG

Location: 206,602 - 327,044 nt. (total: 120,443 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
benzoxazole: (ksIII and AMP-binding and PP-binding and Amidohydro_1)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
PKS-like: (t2pks2 or ksIII)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

GT018_RS29515: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GT018_RS29655: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GT018_RS29695: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

GT018_RS29770: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GT018_RS29805: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GT018_RS29820: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: PPTase acetyltransferase aminotransferase halogenase

GT018_RS29590: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

GT018_RS29810: aminotransferase

smcogs: SMCOG1019: aminotransferase

GT018_RS29815: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
MITE: MITE0000030Halogenation (identity: 60.60%)
smcogs: SMCOG1119: halogenase

GT018_RS32590: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

GT018_RS32600: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Hydrolases: esterase hydrolase

GT018_RS29510: isochorismatase

smcogs: SMCOG1027: isochorismatase

GT018_RS29610: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

GT018_RS29690: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

GT018_RS29715: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

GT018_RS29720: thioesterase

smcogs: SMCOG1004: thioesterase

GT018_RS29800: thioesterase

smcogs: SMCOG1004: thioesterase

Isomerases: isomerase

GT018_RS29505: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

GT018_RS29545: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

GT018_RS29535: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS29540: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

GT018_RS29585: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS29645: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS29670: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS29680: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

GT018_RS29685: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

GT018_RS29700: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS29705: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS29740: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GT018_RS29745: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GT018_RS29750: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS29795: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

GT018_RS29580: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001444.5	2.31	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0002276.2	1.42	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001132.4	1.38	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	1.37	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	1.36	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	1.35	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	1.34	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.32	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	1.31	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.31	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001444.5	0.97	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0001249.5	0.75	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.69	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.69	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.12 out of 29.51

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.67 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.88 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 27.49 out of 30.12

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.90 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.68 out of 30.12

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.50 out of 27.18

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.07 out of 30.12

Confidence: medium

Additional weak hits (35):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.26 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.05 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.83 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.70 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.18 out of 30.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.75 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.14 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.62 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.20 out of 20.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.78 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.62 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.23 out of 20.01

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.79 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.93 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.78 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.15 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.93 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.41 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.37 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.48 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.36 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.59 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.77 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.99 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.42 out of 39.62

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 32.93

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.99 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.98 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.58 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 206601 - 327044:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Trp) + (Cys) + (Cys) + (Cys) + (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 206601 - 325119:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Trp) + (Cys) + (Cys) + (Cys) + (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 285277 - 327044:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Trp) + (Cys) + (Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GT018_RS29535: X

AMP-binding (32..445): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: pip (Hpr)

Stachelhaus prediction details:

Stachelhaus sequence:: QAALFTWGCPGGSLQIGGAQQVFGMAEGLLTLSR
Nearest Stachelhaus code(s):: Hpa TWPSQGVLCK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

GT018_RS29585: NH2

CAL_domain (150..481): NH2

minowa: NH2

Prediction, score:

NH2: 55.3
fatty_acid: 33.8
Acetyl-CoA: 18.7
shikimic_acid: 0.0
AHBA: 0.0

GT018_RS29645: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (535..933): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDIAFDLSVYDGNSLLSGDVALGGATEAAIWSIH
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

GT018_RS29670: X

AMP-binding (38..434): X

nrpys: Sal

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: QESLFALACPGGSLQVGGSQQVYGMAEGLLNFTR
Nearest Stachelhaus code(s):: Sal ALPSQGVLNK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

GT018_RS29675: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (573..987): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVSFDLSVWDGNSLLSGDVGLGGATEAAVWSNY
Nearest Stachelhaus code(s):: Cys DLWNLSLIWK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

GT018_RS29700: Acetyl-CoA

CAL_domain (45..494): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 51.1
NH2: 4.0
shikimic_acid: 0.0
AHBA: -0.0
fatty_acid: -3.9

GT018_RS29705: X

AMP-binding (8..418): X

nrpys: Ppa

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VQFLHAAGVFSAFLIYGAATEAYGLAEAFAGISF
Nearest Stachelhaus code(s):: Ppa VALFIGAAGK (29% 8Å match)
Stachelhaus code match:: 80% (moderate)

GT018_RS29740: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (546..939): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDIAFDLSVYDGNSLLSGDVGLGGATEAAIWSIH
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

GT018_RS29745: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (575..970): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVSFDLSVWDGNTLLSGDIALGGATEAAIWSNA
Nearest Stachelhaus code(s):: Cys DLWNLSLIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

GT018_RS29750: Trp

Search NORINE for peptide: strict or relaxed

AMP-binding (3..394): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTQAFDAWFWDLVLTSTGDYNAYGPTEVTVGASI
Nearest Stachelhaus code(s):: Trp DAWVMTGVGK (82% 8Å match); Kyn DAWTTTGVGK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

GT018_RS29795: X

AMP-binding (30..433): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NACNAALGCPGGTLQVGSSANVYGIGEGLITHTR
Nearest Stachelhaus code(s):: Hqa ALPTQGWLTK (74% 8Å match); COOH-Qui ALPTQGWLTK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
NrdR	Represses ribonucleotide reductase encoding genes
OsdR	Development and stress management regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_WWJS01000032.1 - Region 3 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 470,715 - 492,712 nt. (total: 21,998 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

GT018_RS30455: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

GT018_RS30500: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

GT018_RS30450: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002470.2	0.51	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii
BGC0002305.2	0.49	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002470.2	0.51	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii
BGC0002305.2	0.49	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.17 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

Additional weak hits (7):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.66 out of 23.43

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.61 out of 27.18

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NZ_WWJS01000033.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 40,831 nt. (total: 40,831 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GT018_RS30515: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

GT018_RS30530: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

GT018_RS30540: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

GT018_RS31715: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GT018_RS31720: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

GT018_RS30570: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase phosphatase

GT018_RS30545: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

GT018_RS30560: thioesterase

smcogs: SMCOG1004: thioesterase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.72	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000028.5	0.65	PKS	bafilomycin B1	Streptomyces lohii
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000041.3	0.62	PKS	oronofacic acid	Pseudomonas syringae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.72	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000028.5	0.65	PKS	bafilomycin B1	Streptomyces lohii
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000041.3	0.62	PKS	oronofacic acid	Pseudomonas syringae

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (11):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.37 out of 25.75

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.01 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.44 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.86 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.89 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.18 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.09 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.51 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.70 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.19 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 40831:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal - Me-ccmal) + (Me-ccmal)
Non-colinear ordering:: GT018_RS31715 + GT018_RS31720 + GT018_RS30525

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GT018_RS31715: mmal

PKS_AT (584..883): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 219.4
Ethylmalonyl-CoA: 217.7
Methoxymalonyl-CoA: 183.3
2-Methylbutyryl-CoA: 156.2
CHC-CoA: 117.5
Propionyl-CoA: 115.5
trans-1,2-CPDA: 114.6
Malonyl-CoA: 108.8
Isobutyryl-CoA: 95.4
Benzoyl-CoA: 75.5
Acetyl-CoA: 60.0
3-Methylbutyryl-CoA: 52.5
inactive: 43.0
fatty_acid: 36.8

GT018_RS31720: mmal

PKS_AT (0..229): mmal

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 66.7%; Methoxymalonyl-CoA: 66.7%; Malonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 164.8
Ethylmalonyl-CoA: 156.5
Methoxymalonyl-CoA: 136.1
2-Methylbutyryl-CoA: 104.2
trans-1,2-CPDA: 92.4
Propionyl-CoA: 81.2
CHC-CoA: 73.2
Malonyl-CoA: 67.2
Isobutyryl-CoA: 64.5
Benzoyl-CoA: 60.0
Acetyl-CoA: 57.1
fatty_acid: 42.8
3-Methylbutyryl-CoA: 37.9
inactive: 17.7

GT018_RS30525: mmal

PKS_AT (587..882): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 197.6
Ethylmalonyl-CoA: 187.0
Methoxymalonyl-CoA: 164.7
2-Methylbutyryl-CoA: 163.8
trans-1,2-CPDA: 130.5
Propionyl-CoA: 115.1
CHC-CoA: 98.4
Malonyl-CoA: 96.5
Isobutyryl-CoA: 62.1
Benzoyl-CoA: 61.7
fatty_acid: 59.8
Acetyl-CoA: 44.2
3-Methylbutyryl-CoA: 33.2
inactive: 24.1

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_WWJS01000004.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 26,110 - 38,053 nt. (total: 11,944 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.41	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000468.5	0.37	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.36	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.36	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.34	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000271.5	0.33	PKS	spore pigment	Streptomyces avermitilis
BGC0001778.5	0.32	other (other)	showdomycin	Streptomyces showdoensis
BGC0000598.5	0.31	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001753.3	0.30	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0001148.5	0.28	NRPS, ribosomal	pheganomycin	Streptomyces cirratus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.41	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000468.5	0.37	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.36	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.36	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.34	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000271.5	0.33	PKS	spore pigment	Streptomyces avermitilis
BGC0001778.5	0.32	other (other)	showdomycin	Streptomyces showdoensis
BGC0000598.5	0.31	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001753.3	0.30	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0001148.5	0.28	NRPS, ribosomal	pheganomycin	Streptomyces cirratus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

Additional weak hits (2):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.92 out of 26.06

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.28 out of 29.51

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_WWJS01000004.1 - Region 2 - NRPS-like,T1PKS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 73,795 - 125,875 nt. (total: 52,081 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: dehalogenase hydrolase

GT018_RS05665: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

GT018_RS05690: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: decarboxylase

GT018_RS05640: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

GT018_RS05630: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

GT018_RS05660: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	1.07	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	1.06	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.89	PKS	asperlactone	Aspergillus ochraceus
BGC0002154.2	0.89	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.88	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002191.2	0.88	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.83	PKS	ACT-Toxin II	Alternaria alternata
BGC0000883.5	0.68	other (other)	arginomycin	Streptomyces arginensis
BGC0001163.3	0.59	PKS	1-heptadecene	Moorea producens 3L
BGC0002171.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.68	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.68	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0000883.5	0.56	other (other)	arginomycin	Streptomyces arginensis
BGC0001163.3	0.52	PKS	1-heptadecene	Moorea producens 3L
BGC0002171.2	0.50	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.68 out of 27.04

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

Additional weak hits (15):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.61 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.88 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.14 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.33 out of 30.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.20 out of 30.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.93 out of 24.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.42 out of 28.14

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.30 out of 32.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.42 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.44 out of 24.78

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.21 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.21 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 73794 - 125875:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA - ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GT018_RS05660: AHBA - mal

CAL_domain (169..469): AHBA

minowa: AHBA

Prediction, score:

AHBA: 157.6
shikimic_acid: 118.9
Acetyl-CoA: 8.0
fatty_acid: 0.0
NH2: 0.0

PKS_AT (1198..1503): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 196.8
inactive: 99.5
Methoxymalonyl-CoA: 70.5
Methylmalonyl-CoA: 60.0
Isobutyryl-CoA: 48.3
Propionyl-CoA: 24.4
Ethylmalonyl-CoA: 23.7
Benzoyl-CoA: 19.9
2-Methylbutyryl-CoA: 17.5
fatty_acid: 14.2
Acetyl-CoA: 12.6
CHC-CoA: 12.4
trans-1,2-CPDA: 9.8
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
DasR	N-acetylglucosamine dependent repressor

NZ_WWJS01000004.1 - Region 3 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 177,311 - 198,354 nt. (total: 21,044 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: dehydratase

GT018_RS05995: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

GT018_RS06025: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001910.4	0.36	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000678.5	0.35	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000664.5	0.35	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000644.3	0.34	terpene	carotenoid	Dietzia sp. CQ4
BGC0000648.3	0.34	terpene	carotenoid	Myxococcus xanthus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001910.4	0.36	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000678.5	0.35	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000664.5	0.35	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000644.3	0.34	terpene	carotenoid	Dietzia sp. CQ4
BGC0000648.3	0.34	terpene	carotenoid	Myxococcus xanthus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

GT018_RS06025: PT_FPPS_like

Domain 1 (60 - 345): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.77 out of 23.79

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.16 out of 23.43

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.67 out of 23.43

Confidence: medium

Additional weak hits (9):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.16 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.20 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.32 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.35 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.91 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
IolR	Regulator of the inositol catabolism

NZ_WWJS01000005.1 - Region 1 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 3,664 - 16,792 nt. (total: 13,129 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxidoreductase reductase

GT018_RS10435: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

GT018_RS10445: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

GT018_RS10450: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Hydrolases: peptidase

GT018_RS10415: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002436.2	0.38	other (other)	coformycin	Streptomyces citricolor
BGC0002285.2	0.37	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001007.5	0.32	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001006.5	0.30	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0000595.3	0.29	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000135.5	0.22	PKS	reveromycin A	Streptomyces sp. SN-593

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002436.2	0.38	other (other)	coformycin	Streptomyces citricolor
BGC0002285.2	0.37	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001007.5	0.32	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001006.5	0.30	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0000595.3	0.29	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000135.5	0.22	PKS	reveromycin A	Streptomyces sp. SN-593

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.05 out of 22.40

Confidence: strong

Additional weak hits (4):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.89 out of 21.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.34 out of 32.93

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
HypR	L-hydroxyproline utilization repressor

NZ_WWJS01000005.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 122,251 - 133,648 nt. (total: 11,398 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GT018_RS10975: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: deacetylase

GT018_RS10930: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000498.5	0.32	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.32	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0000351.5	0.32	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0001363.5	0.32	NRPS, PKS	ralsolamycin	Ralstonia solanacearum GMI1000
BGC0002663.2	0.32	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0002710.2	0.32	NRPS	metachelin C, metachelin A, metachelin A-CE, metachelin B, dimerumic acid 11-mannoside, dimerumic acid	Metarhizium robertsii ARSEF 23
BGC0000565.5	0.31	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001928.2	0.31	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002579.2	0.31	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000498.5	0.32	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.32	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0000351.5	0.32	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0001363.5	0.32	NRPS, PKS	ralsolamycin	Ralstonia solanacearum GMI1000
BGC0002663.2	0.32	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0002710.2	0.32	NRPS	metachelin C, metachelin A, metachelin A-CE, metachelin B, dimerumic acid 11-mannoside, dimerumic acid	Metarhizium robertsii ARSEF 23
BGC0000565.5	0.31	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001928.2	0.31	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002579.2	0.31	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.90 out of 21.55

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_WWJS01000008.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 35,492 nt. (total: 35,492 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

GT018_RS11360: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

GT018_RS11365: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: PPTase acetyltransferase

GT018_RS11310: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

GT018_RS11340: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Ligases: ligase synthase

GT018_RS11305: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GT018_RS11315: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

GT018_RS11320: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS11325: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002154.2	0.61	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.61	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001257.3	0.61	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002175.3	0.61	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000037.4	0.61	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0000107.3	0.61	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002154.2	0.61	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.61	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001257.3	0.61	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002175.3	0.61	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000037.4	0.61	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0000107.3	0.61	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.87 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.91 out of 32.74

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.74 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.19 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.46 out of 21.55

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.79 out of 30.98

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 27.04

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.90 out of 33.73

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 35492:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-ohmal - ohmal - Me-mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GT018_RS11310: mmal - mmal - mal - mmal

PKS_AT (99..398): mmal

ATSignature: Isobutyryl-CoA

Top 3 matches:: Isobutyryl-CoA: 79.2%; Methoxymalonyl-CoA: 70.8%; Methylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 163.1
Ethylmalonyl-CoA: 161.0
2-Methylbutyryl-CoA: 151.4
Propionyl-CoA: 130.8
Methoxymalonyl-CoA: 129.3
CHC-CoA: 101.7
Isobutyryl-CoA: 85.8
Malonyl-CoA: 85.5
trans-1,2-CPDA: 83.6
Benzoyl-CoA: 49.8
3-Methylbutyryl-CoA: 35.3
Acetyl-CoA: 31.0
inactive: 20.7
fatty_acid: 12.1

PKS_AT (1101..1394): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 214.0
Ethylmalonyl-CoA: 201.8
2-Methylbutyryl-CoA: 176.9
Methoxymalonyl-CoA: 173.3
trans-1,2-CPDA: 150.0
Propionyl-CoA: 128.2
CHC-CoA: 107.1
Malonyl-CoA: 105.0
Isobutyryl-CoA: 76.2
Benzoyl-CoA: 73.2
fatty_acid: 52.9
Acetyl-CoA: 45.6
3-Methylbutyryl-CoA: 37.3
inactive: 29.7

PKS_AT (2713..3014): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 235.8
inactive: 116.0
Methoxymalonyl-CoA: 72.9
Methylmalonyl-CoA: 60.3
Propionyl-CoA: 47.7
Isobutyryl-CoA: 32.7
Benzoyl-CoA: 22.7
Ethylmalonyl-CoA: 19.2
2-Methylbutyryl-CoA: 18.8
Acetyl-CoA: 17.4
CHC-CoA: 11.0
fatty_acid: 9.2
trans-1,2-CPDA: 7.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (4248..4544): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Malonyl-CoA: 87.5%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 207.5
Ethylmalonyl-CoA: 199.8
Methoxymalonyl-CoA: 172.4
2-Methylbutyryl-CoA: 146.0
trans-1,2-CPDA: 125.0
Propionyl-CoA: 116.4
CHC-CoA: 99.6
Malonyl-CoA: 86.2
Isobutyryl-CoA: 79.7
Benzoyl-CoA: 71.4
Acetyl-CoA: 51.8
fatty_acid: 44.2
3-Methylbutyryl-CoA: 38.4
inactive: 25.8

GT018_RS11320: X

AMP-binding (14..418): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: -ARLHSSGATADLLTYVGSIQVYATSEAGFVSML
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

GT018_RS11325: X

AMP-binding (10..416): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NTTLFGQICG-TMGFSGGALEGYGLTETSPVVAY
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_WWJS01000008.1 - Region 2 - NRP-metallophore,NRPS,T1PKS,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 127,230 - 270,984 nt. (total: 143,755 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

GT018_RS11890: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GT018_RS11895: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

GT018_RS11900: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

GT018_RS11905: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

GT018_RS11935: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

GT018_RS11940: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GT018_RS12045: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GT018_RS12085: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

GT018_RS12095: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

GT018_RS12100: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

GT018_RS12135: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

GT018_RS12280: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

GT018_RS12335: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GT018_RS12360: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: formyltransferase

GT018_RS12285: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: amidase dehalogenase esterase hydrolase

GT018_RS12060: isochorismatase

smcogs: SMCOG1027: isochorismatase

GT018_RS12120: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

GT018_RS12240: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

GT018_RS12325: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

GT018_RS12355: amidase

smcogs: SMCOG1105: amidase

Lyases: cyclase decarboxylase

GT018_RS12165: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

GT018_RS12185: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Isomerases: isomerase

GT018_RS12050: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

GT018_RS11910: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GT018_RS12055: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS12065: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS12250: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transport

GT018_RS11955: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001043.4	2.28	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	2.28	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001833.4	1.84	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	1.82	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	1.80	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	1.79	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.77	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	1.69	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	1.56	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	1.45	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002365.2	0.86	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001043.4	0.86	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000325.5	0.76	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0000996.5	0.75	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001185.5	0.73	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000496.5	0.72	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001726.4	0.70	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.17 out of 29.51

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.81 out of 20.97

Confidence: medium

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 26.42 out of 35.63

Confidence: medium

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 28.18 out of 35.63

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.49 out of 24.78

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 35.53 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.36 out of 36.53

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.06 out of 30.11

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.90 out of 36.53

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (31):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.46 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.28 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.16 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.32 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.88 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.33 out of 30.22

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.37 out of 36.54

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.11 out of 27.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.32 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.44 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.04 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.94 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.04 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.91 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.37 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.91 out of 29.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.85 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.96 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.06 out of 33.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.86 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.14 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.77 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.39 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.47 out of 26.85

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.98 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.16 out of 36.53

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.07 out of 21.84

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.39 out of 36.53

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.77 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 2, location 127229 - 270984:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn - D-Thr - OH-Orn) + (pk - Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 127229 - 211334:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 212572 - 270984:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn - D-Thr - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GT018_RS11910: pk - Orn

Search NORINE for peptide: strict or relaxed

PKS_AT (569..865): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; CE-Malonyl-CoA: 54.2%; Acetyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 114.4
Malonyl-CoA: 112.6
Methoxymalonyl-CoA: 104.0
Ethylmalonyl-CoA: 90.3
Isobutyryl-CoA: 88.9
Acetyl-CoA: 77.2
2-Methylbutyryl-CoA: 70.2
Propionyl-CoA: 68.7
Benzoyl-CoA: 66.2
trans-1,2-CPDA: 56.1
fatty_acid: 49.6
CHC-CoA: 46.7
inactive: 38.6
3-Methylbutyryl-CoA: 32.9

AMP-binding (2328..2743): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: AAWAFDVFTGDREFVVGSDVNSYGLTEATVDSAF
Nearest Stachelhaus code(s):: Orn DVGEVGSIDK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

GT018_RS12055: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (35..443): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SGSLFPMSSPGGGMLVGGAMQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPGLGVVNK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

GT018_RS12065: X

AMP-binding (475..866): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDASLWEWHFFCGGEHHLHGPAEAAVDVTY
Nearest Stachelhaus code(s):: Glu DAWHFGGVDK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

GT018_RS12250: Fo-OH-Orn - Thr - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (144..542): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISVNELYLWCGGEYHGYGPAETTIGVSH
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1628..2036): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LRTHFDFAVWEGNQIFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3049..3449): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
DosR	Hypoxia stress response regulator
LexA variant 2	Repressor of DNA damage response
NrtR	NAD synthesis repressor
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_WWJS01000008.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 409,271 - 435,841 nt. (total: 26,571 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GT018_RS13070: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

GT018_RS13105: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

GT018_RS13045: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

GT018_RS13110: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase

GT018_RS13120: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

GT018_RS13065: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

GT018_RS13060: T2TS

Domain 1 (26 - 653): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

GT018_RS13065: PT_FPPS_like

Domain 1 (73 - 366): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

GT018_RS13075: PT_phytoene_like

Domain 1 (6 - 296): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

GT018_RS13080: PT_phytoene_like

Domain 1 (17 - 280): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.09 out of 23.79

Confidence: medium

Additional weak hits (6):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 26.85

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.84 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.08 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_WWJS01000009.1 - Region 1 - T1PKS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 1 - 59,779 nt. (total: 59,779 nt) Show pHMM detection rules used

Region on contig edge.

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase methyltransferase transketolase

GT018_RS13560: transketolase

smcogs: SMCOG1204: transketolase

GT018_RS13625: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

GT018_RS13630: methyltransferase

smcogs: SMCOG1089: methyltransferase

GT018_RS13690: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: dehalogenase

GT018_RS13580: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

GT018_RS13660: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: decarboxylase dehydratase

GT018_RS13615: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

GT018_RS13670: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

GT018_RS13610: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

GT018_RS13620: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

GT018_RS13650: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GT018_RS13655: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

GT018_RS13665: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS13680: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.57	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.54	PKS	FR901512	fungal sp. No.14919
BGC0001257.3	0.53	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.52	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.52	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001161.5	0.36	PKS	1-heptadecene	Moorea bouillonii PNG

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001161.5	0.49	PKS	1-heptadecene	Moorea bouillonii PNG

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.60 out of 20.97

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.44 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.04 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.04 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.64 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.36 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.36 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.18 out of 28.19

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

Additional weak hits (43):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.99 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.02 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.85 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.51 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.30 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.78 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.44 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.78 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.16 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.70 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.72 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.94 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.41 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.47 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.72 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.98 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.23 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.79 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.39 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.12 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.88 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.10 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.61 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.98 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.75 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.06 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.18 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 19.44 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.86 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.56 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.18 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.37 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.55 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.66 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.82 out of 32.93

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.36 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.05 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.41 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.23 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.31 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.41 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.62 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 59779:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GT018_RS13650: pk

PKS_AT (535..824): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 70.8%; Methoxymalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 110.6
Methoxymalonyl-CoA: 104.0
Malonyl-CoA: 95.0
Isobutyryl-CoA: 72.9
Ethylmalonyl-CoA: 66.4
Propionyl-CoA: 61.6
2-Methylbutyryl-CoA: 31.0
inactive: 27.9
fatty_acid: 25.2
CHC-CoA: 23.0
trans-1,2-CPDA: 22.9
Benzoyl-CoA: 22.5
Acetyl-CoA: 17.6
3-Methylbutyryl-CoA: 4.3

GT018_RS13665: X

AMP-binding (12..418): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QALL-----VAGLALSFGALSVYGATECLPVSAI
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
FuR variant 1	Ferric Uptake Regulator
MexT	Global virulence regulator
ZuR variant 1	Zinc-responsive repressor

NZ_WWJS01000009.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 105,473 - 168,320 nt. (total: 62,848 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GT018_RS13930: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acyltransferase aminotransferase formyltransferase

GT018_RS14005: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

GT018_RS14030: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

GT018_RS14090: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: deformylase esterase

GT018_RS13940: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

GT018_RS13990: thioesterase

smcogs: SMCOG1004: thioesterase

GT018_RS14010: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

GT018_RS14035: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

GT018_RS13980: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GT018_RS14000: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

GT018_RS14080: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.09 out of 24.78

Confidence: medium

Additional weak hits (15):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.27 out of 21.55

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.48 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.35 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.11 out of 32.74

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.16 out of 25.88

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.66 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.09 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.56 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.38 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.91 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.70 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 105472 - 168320:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala - X) + (Cys) + (D-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GT018_RS13980: X

AMP-binding (509..933): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSVLGGLVQHHDWMENGGEKPVFGMTETSSAVIA
Nearest Stachelhaus code(s):: Kiv GLYWLGSSGK (53% 8Å match)
Stachelhaus code match:: 60% (weak)

GT018_RS13990: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (470..873): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: NDYSFDISVCDCHSVLDGDVSAGGATELSVDSVM
Nearest Stachelhaus code(s):: Ser DVSHVSAVDK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

GT018_RS14005: Ala - X

Search NORINE for peptide: strict or relaxed

AMP-binding (466..854): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: FWATFDLSVFELNTNLAGEFNLYGPSEDTTYSTW
Nearest Stachelhaus code(s):: Ala DLFNNALTYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1504..1895): X

nrpys: R-bohPhe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LLHAFDASVWEMTMVLAGEWNAYGPSEATVCGTL
Nearest Stachelhaus code(s):: R-bohPhe DAWTVAAVCK (76% 8Å match); Phe DAWTVAAVCK (71% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response